Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q13398 (ZN211_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 125. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Zinc finger protein 211
Alternative name(s):
Zinc finger protein C2H2-25
Gene names
Name:ZNF211
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length564 AA.
Sequence statusComplete.
Protein existenceEvidence at transcript level

General annotation (Comments)

Function

May be involved in transcriptional regulation.

Subcellular location

Nucleus Probable.

Sequence similarities

Belongs to the krueppel C2H2-type zinc-finger protein family.

Contains 12 C2H2-type zinc fingers.

Contains 1 KRAB domain.

Sequence caution

The sequence AAA93261.1 differs from that shown. Reason: Erroneous initiation.

The sequence AAH34351.1 differs from that shown. Reason: Contaminating sequence. Potential poly-A sequence.

The sequence BAD93084.1 differs from that shown. Reason: Erroneous initiation.

Ontologies

Keywords
   Biological processTranscription
Transcription regulation
   Cellular componentNucleus
   Coding sequence diversityAlternative splicing
Polymorphism
   DomainRepeat
Zinc-finger
   LigandDNA-binding
Metal-binding
Zinc
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processregulation of transcription, DNA-templated

Inferred from electronic annotation. Source: UniProtKB-KW

transcription, DNA-templated

Inferred from electronic annotation. Source: UniProtKB-KW

   Cellular_componentnucleus

Inferred from electronic annotation. Source: UniProtKB-SubCell

   Molecular_functionDNA binding

Inferred from electronic annotation. Source: UniProtKB-KW

metal ion binding

Inferred from electronic annotation. Source: UniProtKB-KW

Complete GO annotation...

Alternative products

This entry describes 8 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q13398-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q13398-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1-72: MLGFPPGRPQ...LENFALTSSL → MLENFALTSS...EWHLGKGMSS
Isoform 3 (identifier: Q13398-3)

The sequence of this isoform differs from the canonical sequence as follows:
     1-30: MLGFPPGRPQLPVQLRPQTRMATALRDPAS → MRTLRQREVEYFSKATQLVRGSTKDRGAQVPIATEVLFKLTQ
Isoform 4 (identifier: Q13398-4)

The sequence of this isoform differs from the canonical sequence as follows:
     1-30: MLGFPPGRPQLPVQLRPQTRMATALRDPAS → MISAYCNLHLLGSSDSPASASQVAGTTGMRHHAQ
Note: No experimental confirmation available.
Isoform 5 (identifier: Q13398-5)

The sequence of this isoform differs from the canonical sequence as follows:
     1-61: Missing.
Isoform 6 (identifier: Q13398-6)

The sequence of this isoform differs from the canonical sequence as follows:
     1-20: Missing.
Isoform 7 (identifier: Q13398-7)

The sequence of this isoform differs from the canonical sequence as follows:
     30-30: S → SVPIATEVLFKLTQ
Note: No experimental confirmation available.
Isoform 8 (identifier: Q13398-8)

The sequence of this isoform differs from the canonical sequence as follows:
     30-30: S → SVPIATEVLFKLTQ
     73-73: G → GLISSWSHVVAQLGLGEVPSVLHRMFMTPASARWDQRGPGLHEWHLGKGMSSG
Note: Gene prediction based on EST data.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 564564Zinc finger protein 211
PRO_0000047455

Regions

Domain33 – 10674KRAB
Zinc finger131 – 15727C2H2-type 1
Zinc finger257 – 27923C2H2-type 2
Zinc finger285 – 30723C2H2-type 3
Zinc finger313 – 33523C2H2-type 4
Zinc finger341 – 36323C2H2-type 5
Zinc finger369 – 39123C2H2-type 6
Zinc finger397 – 41923C2H2-type 7
Zinc finger425 – 44723C2H2-type 8
Zinc finger453 – 47523C2H2-type 9
Zinc finger481 – 50323C2H2-type 10
Zinc finger509 – 53123C2H2-type 11
Zinc finger537 – 55923C2H2-type 12

Natural variations

Alternative sequence1 – 7272MLGFP…LTSSL → MLENFALTSSLGLISSWSHV VAQLGLGEVPSVLHRMFMTP ASARWDQRGPGLHEWHLGKG MSS in isoform 2.
VSP_035702
Alternative sequence1 – 6161Missing in isoform 5.
VSP_035703
Alternative sequence1 – 3030MLGFP…RDPAS → MRTLRQREVEYFSKATQLVR GSTKDRGAQVPIATEVLFKL TQ in isoform 3.
VSP_035704
Alternative sequence1 – 3030MLGFP…RDPAS → MISAYCNLHLLGSSDSPASA SQVAGTTGMRHHAQ in isoform 4.
VSP_035705
Alternative sequence1 – 2020Missing in isoform 6.
VSP_035706
Alternative sequence301S → SVPIATEVLFKLTQ in isoform 7 and isoform 8.
VSP_045643
Alternative sequence731G → GLISSWSHVVAQLGLGEVPS VLHRMFMTPASARWDQRGPG LHEWHLGKGMSSG in isoform 8.
VSP_046769
Natural variant1101D → N.
Corresponds to variant rs34897843 [ dbSNP | Ensembl ].
VAR_047278
Natural variant3141A → V. Ref.2 Ref.4
Corresponds to variant rs11879465 [ dbSNP | Ensembl ].
VAR_057402

Experimental info

Sequence conflict1781V → A in AK026941. Ref.1
Sequence conflict2761Q → L in BAG59491. Ref.1

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified November 25, 2008. Version 2.
Checksum: 9506968ED6E36EE7

FASTA56464,535
        10         20         30         40         50         60 
MLGFPPGRPQ LPVQLRPQTR MATALRDPAS GSVTFEDVAV YFSWEEWDLL DEAQKHLYFD 

        70         80         90        100        110        120 
VMLENFALTS SLGCWCGVEH EETPSEQRIS GERVPQFRTS KEGSSSQNAD SCEICCLVLR 

       130        140        150        160        170        180 
DILHLAEHQG TNCGQKLHTC GKQFYISANL QQHQRQHITE APFRSYVDTA SFTQSCIVHV 

       190        200        210        220        230        240 
SEKPFTCREI RKDFLANMRF LHQDATQTGE KPNNSNKCAV AFYSGKSHHN WGKCSKAFSH 

       250        260        270        280        290        300 
IDTLVQDQRI LTREGLFECS KCGKACTRRC NLIQHQKVHS EERPYECNEC GKFFTYYSSF 

       310        320        330        340        350        360 
IIHQRVHTGE RPYACPECGK SFSQIYSLNS HRKVHTGERP YECGECGKSF SQRSNLMQHR 

       370        380        390        400        410        420 
RVHTGERPYE CSECGKSFSQ NFSLIYHQRV HTGERPHECN ECGKSFSRSS SLIHHRRLHT 

       430        440        450        460        470        480 
GERPYECSKC GKSFKQSSSF SSHRKVHTGE RPYVCGECGK SFSHSSNLKN HQRVHTGERP 

       490        500        510        520        530        540 
VECSECSKSF SCKSNLIKHL RVHTGERPYE CSECGKSFSQ SSSLIQHRRV HTGKRPYQCS 

       550        560 
QCGKSFGCKS VLIQHQRVHI GEKP 

« Hide

Isoform 2 [UniParc].

Checksum: 3514A46C5D45C3CB
Show »

FASTA55563,207
Isoform 3 [UniParc].

Checksum: D6EEF6EE3B96EE74
Show »

FASTA57666,086
Isoform 4 [UniParc].

Checksum: 4D27374C591C04F1
Show »

FASTA56864,732
Isoform 5 [UniParc].

Checksum: C39EBEF2E28C434C
Show »

FASTA50357,530
Isoform 6 [UniParc].

Checksum: 2C5B0BFC61CB971D
Show »

FASTA54462,265
Isoform 7 [UniParc].

Checksum: D4C8C5C5535400C5
Show »

FASTA57765,976
Isoform 8 [UniParc].

Checksum: 01F0BD30953F2EA7
Show »

FASTA62971,654

References

« Hide 'large scale' references
[1]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2; 3; 5; 6 AND 7).
Tissue: Blood, Brain, Hepatoma, Tongue and Uterus.
[2]Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S., Ohara O., Nagase T., Kikuno R.F.
Submitted (MAR-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4), VARIANT VAL-314.
Tissue: Brain and Endothelial cell.
[3]"The DNA sequence and biology of human chromosome 19."
Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J., Lamerdin J.E., Hellsten U., Goodstein D., Couronne O., Tran-Gyamfi M., Aerts A., Altherr M., Ashworth L., Bajorek E., Black S., Branscomb E., Caenepeel S., Carrano A.V. expand/collapse author list , Caoile C., Chan Y.M., Christensen M., Cleland C.A., Copeland A., Dalin E., Dehal P., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Garcia C., Georgescu A.M., Glavina T., Gomez M., Gonzales E., Groza M., Hammon N., Hawkins T., Haydu L., Ho I., Huang W., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Larionov V., Leem S.-H., Lopez F., Lou Y., Lowry S., Malfatti S., Martinez D., McCready P.M., Medina C., Morgan J., Nelson K., Nolan M., Ovcharenko I., Pitluck S., Pollard M., Popkie A.P., Predki P., Quan G., Ramirez L., Rash S., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., She X., Smith D., Slezak T., Solovyev V., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wagner M., Wheeler J., Wu K., Xie G., Yang J., Dubchak I., Furey T.S., DeJong P., Dickson M., Gordon D., Eichler E.E., Pennacchio L.A., Richardson P., Stubbs L., Rokhsar D.S., Myers R.M., Rubin E.M., Lucas S.M.
Nature 428:529-535(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[4]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-505 (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 24-564 (ISOFORM 1), VARIANT VAL-314.
Tissue: Chondrosarcoma, Skin and Uterus.
[5]"Molecular cloning and mapping of a novel developmentally regulated human C2H2-type zinc finger."
Becker K.G., Canning R.D., Nagle J.W., Dehejia A.M., Polymeropoulos M.H., Lee I.J., Gado A.M., Biddison W.E., Drew P.D.
Mamm. Genome 8:287-289(1997) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 160-564 (ISOFORMS 1/2/3/4/5/6).
Tissue: Brain.
[6]"Rapid isolation and characterization of 118 novel C2H2-type zinc finger cDNAs expressed in human brain."
Becker K.G., Nagle J.W., Canning R.D., Biddison W.E., Ozato K., Drew P.D.
Hum. Mol. Genet. 4:685-691(1995) [PubMed] [Europe PMC] [Abstract]
Cited for: PARTIAL NUCLEOTIDE SEQUENCE [MRNA].
Tissue: Hippocampus.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AK026941 mRNA. No translation available.
AK294869 mRNA. Translation: BAG57971.1.
AK296942 mRNA. Translation: BAG59491.1.
AK297047 mRNA. Translation: BAG59573.1.
AK304666 mRNA. Translation: BAG65441.1.
AB209273 mRNA. Translation: BAD92510.1.
AB209847 mRNA. Translation: BAD93084.1. Different initiation.
AC003682 Genomic DNA. No translation available.
BC034351 mRNA. Translation: AAH34351.1. Sequence problems.
BC089440 mRNA. Translation: AAH89440.1.
BC110856 mRNA. Translation: AAI10857.1.
U38904 mRNA. Translation: AAA93261.1. Different initiation.
CCDSCCDS12956.1. [Q13398-7]
CCDS12957.1. [Q13398-1]
CCDS58686.1. [Q13398-8]
CCDS58687.1. [Q13398-2]
CCDS58688.1. [Q13398-5]
RefSeqNP_001252526.1. NM_001265597.1. [Q13398-8]
NP_001252527.1. NM_001265598.1.
NP_001252528.1. NM_001265599.1. [Q13398-2]
NP_001252529.1. NM_001265600.1. [Q13398-5]
NP_006376.2. NM_006385.3. [Q13398-7]
NP_942152.1. NM_198855.2. [Q13398-1]
UniGeneHs.590977.

3D structure databases

ProteinModelPortalQ13398.
SMRQ13398. Positions 29-73, 124-564.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid115775. 1 interaction.
IntActQ13398. 1 interaction.

PTM databases

PhosphoSiteQ13398.

Polymorphism databases

DMDM215273921.

Proteomic databases

PaxDbQ13398.
PRIDEQ13398.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000240731; ENSP00000240731; ENSG00000121417. [Q13398-7]
ENST00000254182; ENSP00000254182; ENSG00000121417. [Q13398-2]
ENST00000299871; ENSP00000299871; ENSG00000121417. [Q13398-8]
ENST00000347302; ENSP00000339562; ENSG00000121417. [Q13398-1]
ENST00000391703; ENSP00000375584; ENSG00000121417. [Q13398-5]
ENST00000420680; ENSP00000399193; ENSG00000121417. [Q13398-4]
ENST00000541801; ENSP00000442601; ENSG00000121417. [Q13398-2]
ENST00000544273; ENSP00000441386; ENSG00000121417. [Q13398-3]
GeneID10520.
KEGGhsa:10520.
UCSCuc002qpq.2. human. [Q13398-1]
uc002qpt.2. human. [Q13398-3]
uc010yhb.1. human. [Q13398-4]
uc010yhe.2. human. [Q13398-2]

Organism-specific databases

CTD10520.
GeneCardsGC19P058141.
HGNCHGNC:13003. ZNF211.
HPAHPA011340.
HPA049967.
MIM601856. gene.
neXtProtNX_Q13398.
PharmGKBPA37582.
GenAtlasSearch...

Phylogenomic databases

eggNOGCOG5048.
HOVERGENHBG018163.
InParanoidQ13398.
KOK09228.
OMANSNECEA.
PhylomeDBQ13398.
TreeFamTF339848.

Enzyme and pathway databases

ReactomeREACT_71. Gene Expression.

Gene expression databases

ArrayExpressQ13398.
BgeeQ13398.
GenevestigatorQ13398.

Family and domain databases

Gene3D3.30.160.60. 12 hits.
InterProIPR001909. Krueppel-associated_box.
IPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view]
PfamPF01352. KRAB. 1 hit.
[Graphical view]
SMARTSM00349. KRAB. 1 hit.
SM00355. ZnF_C2H2. 12 hits.
[Graphical view]
SUPFAMSSF109640. SSF109640. 1 hit.
PROSITEPS50805. KRAB. 1 hit.
PS00028. ZINC_FINGER_C2H2_1. 11 hits.
PS50157. ZINC_FINGER_C2H2_2. 12 hits.
[Graphical view]
ProtoNetSearch...

Other

GenomeRNAi10520.
NextBio39896.
PROQ13398.
SOURCESearch...

Entry information

Entry nameZN211_HUMAN
AccessionPrimary (citable) accession number: Q13398
Secondary accession number(s): B4DH10 expand/collapse secondary AC list , B4DLC9, B4E3C9, B9ZVS7, B9ZVW1, F8WDV2, Q05BQ7, Q2TAL7, Q59EG4, Q59G36, Q5EBL6
Entry history
Integrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: November 25, 2008
Last modified: July 9, 2014
This is version 125 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 19

Human chromosome 19: entries, gene names and cross-references to MIM