Q13398 (ZN211_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 29, 2013.
Version 114.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Zinc finger protein 211 Alternative name(s): Zinc finger protein C2H2-25 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 564 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | May be involved in transcriptional regulation. |
| Subcellular location | Nucleus Probable. |
| Sequence similarities | Belongs to the krueppel C2H2-type zinc-finger protein family. Contains 12 C2H2-type zinc fingers. Contains 1 KRAB domain. |
| Sequence caution | The sequence AAA93261.1 differs from that shown. Reason: Erroneous initiation. The sequence AAH34351.1 differs from that shown. Reason: Contaminating sequence. Potential poly-A sequence. The sequence BAD93084.1 differs from that shown. Reason: Erroneous initiation. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Transcription Transcription regulation |
| Cellular component | Nucleus |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Repeat Zinc-finger |
| Ligand | DNA-binding Metal-binding Zinc |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | regulation of transcription, DNA-dependent Inferred from electronic annotation. Source: UniProtKB-KW transcription, DNA-dependentInferred from electronic annotation. Source: UniProtKB-KW |
| Cellular_component | nucleus Inferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular_function | DNA binding Inferred from electronic annotation. Source: UniProtKB-KW zinc ion bindingInferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 7 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q13398-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q13398-2) The sequence of this isoform differs from the canonical sequence as follows: 1-72: MLGFPPGRPQ...LENFALTSSL → MLENFALTSS...EWHLGKGMSS | ||||||
| Isoform 3 (identifier: Q13398-3) The sequence of this isoform differs from the canonical sequence as follows: 1-30: MLGFPPGRPQLPVQLRPQTRMATALRDPAS → MRTLRQREVEYFSKATQLVRGSTKDRGAQVPIATEVLFKLTQ | ||||||
| Isoform 4 (identifier: Q13398-4) The sequence of this isoform differs from the canonical sequence as follows: 1-30: MLGFPPGRPQLPVQLRPQTRMATALRDPAS → MISAYCNLHLLGSSDSPASASQVAGTTGMRHHAQ | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 5 (identifier: Q13398-5) The sequence of this isoform differs from the canonical sequence as follows: 1-61: Missing. | ||||||
| Isoform 6 (identifier: Q13398-6) The sequence of this isoform differs from the canonical sequence as follows: 1-20: Missing. | ||||||
| Isoform 7 (identifier: Q13398-7) The sequence of this isoform differs from the canonical sequence as follows: 30-30: S → SVPIATEVLFKLTQ | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 564 | 564 | Zinc finger protein 211 | PRO_0000047455 | |||||
Regions | |||||||||
| Domain | 33 – 106 | 74 | KRAB | ||||||
| Zinc finger | 131 – 157 | 27 | C2H2-type 1 | ||||||
| Zinc finger | 257 – 279 | 23 | C2H2-type 2 | ||||||
| Zinc finger | 285 – 307 | 23 | C2H2-type 3 | ||||||
| Zinc finger | 313 – 335 | 23 | C2H2-type 4 | ||||||
| Zinc finger | 341 – 363 | 23 | C2H2-type 5 | ||||||
| Zinc finger | 369 – 391 | 23 | C2H2-type 6 | ||||||
| Zinc finger | 397 – 419 | 23 | C2H2-type 7 | ||||||
| Zinc finger | 425 – 447 | 23 | C2H2-type 8 | ||||||
| Zinc finger | 453 – 475 | 23 | C2H2-type 9 | ||||||
| Zinc finger | 481 – 503 | 23 | C2H2-type 10 | ||||||
| Zinc finger | 509 – 531 | 23 | C2H2-type 11 | ||||||
| Zinc finger | 537 – 559 | 23 | C2H2-type 12 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 72 | 72 | MLGFP…LTSSL → MLENFALTSSLGLISSWSHV VAQLGLGEVPSVLHRMFMTP ASARWDQRGPGLHEWHLGKG MSS in isoform 2. | VSP_035702 | |||||
| Alternative sequence | 1 – 61 | 61 | Missing in isoform 5. | VSP_035703 | |||||
| Alternative sequence | 1 – 30 | 30 | MLGFP…RDPAS → MRTLRQREVEYFSKATQLVR GSTKDRGAQVPIATEVLFKL TQ in isoform 3. | VSP_035704 | |||||
| Alternative sequence | 1 – 30 | 30 | MLGFP…RDPAS → MISAYCNLHLLGSSDSPASA SQVAGTTGMRHHAQ in isoform 4. | VSP_035705 | |||||
| Alternative sequence | 1 – 20 | 20 | Missing in isoform 6. | VSP_035706 | |||||
| Alternative sequence | 30 | 1 | S → SVPIATEVLFKLTQ in isoform 7. | VSP_045643 | |||||
| Natural variant | 110 | 1 | D → N. Corresponds to variant rs34897843 [ dbSNP | Ensembl ]. | VAR_047278 | |||||
| Natural variant | 314 | 1 | A → V. Ref.2 Ref.4 Corresponds to variant rs11879465 [ dbSNP | Ensembl ]. | VAR_057402 | |||||
Experimental info | |||||||||
| Sequence conflict | 178 | 1 | V → A in AK026941. Ref.1 | ||||||
| Sequence conflict | 276 | 1 | Q → L in BAG59491. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2; 3; 5; 6 AND 7). Tissue: Blood, Brain, Hepatoma, Tongue and Uterus. |
| [2] | Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S., Ohara O., Nagase T., Kikuno R.F. Submitted (MAR-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4), VARIANT VAL-314. Tissue: Brain and Endothelial cell. |
| [3] | "The DNA sequence and biology of human chromosome 19." Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J., Lamerdin J.E., Hellsten U., Goodstein D., Couronne O., Tran-Gyamfi M., Aerts A., Altherr M., Ashworth L., Bajorek E., Black S., Branscomb E., Caenepeel S., Carrano A.V. Lucas S.M.Nature 428:529-535(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-505 (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 24-564 (ISOFORM 1), VARIANT VAL-314. Tissue: Chondrosarcoma, Skin and Uterus. |
| [5] | "Molecular cloning and mapping of a novel developmentally regulated human C2H2-type zinc finger." Becker K.G., Canning R.D., Nagle J.W., Dehejia A.M., Polymeropoulos M.H., Lee I.J., Gado A.M., Biddison W.E., Drew P.D. Mamm. Genome 8:287-289(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 160-564 (ISOFORMS 1/2/3/4/5/6). Tissue: Brain. |
| [6] | "Rapid isolation and characterization of 118 novel C2H2-type zinc finger cDNAs expressed in human brain." Becker K.G., Nagle J.W., Canning R.D., Biddison W.E., Ozato K., Drew P.D. Hum. Mol. Genet. 4:685-691(1995) [PubMed] [Europe PMC] [Abstract] Cited for: PARTIAL NUCLEOTIDE SEQUENCE [MRNA]. Tissue: Hippocampus. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AK026941 mRNA. No translation available. AK294869 mRNA. Translation: BAG57971.1. AK296942 mRNA. Translation: BAG59491.1. AK297047 mRNA. Translation: BAG59573.1. AK304666 mRNA. Translation: BAG65441.1. AB209273 mRNA. Translation: BAD92510.1. AB209847 mRNA. Translation: BAD93084.1. Different initiation. AC003682 Genomic DNA. No translation available. BC034351 mRNA. Translation: AAH34351.1. Sequence problems. BC089440 mRNA. Translation: AAH89440.1. BC110856 mRNA. Translation: AAI10857.1. U38904 mRNA. Translation: AAA93261.1. Different initiation. |
| IPI | IPI00012868. IPI00394844. IPI00419492. IPI00746528. IPI00883583. IPI00914861. IPI00915004. |
| RefSeq | NP_001252526.1. NM_001265597.1. NP_001252527.1. NM_001265598.1. NP_001252528.1. NM_001265599.1. NP_001252529.1. NM_001265600.1. NP_006376.2. NM_006385.3. NP_942152.1. NM_198855.2. |
| UniGene | Hs.590977. |
3D structure databases | |
| ProteinModelPortal | Q13398. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q13398. 1 interaction. |
PTM databases | |
| PhosphoSite | Q13398. |
Polymorphism databases | |
| DMDM | 215273921. |
Proteomic databases | |
| PaxDb | Q13398. |
| PRIDE | Q13398. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000240731; ENSP00000240731; ENSG00000121417. ENST00000254182; ENSP00000254182; ENSG00000121417. ENST00000347302; ENSP00000339562; ENSG00000121417. ENST00000391703; ENSP00000375584; ENSG00000121417. ENST00000420680; ENSP00000399193; ENSG00000121417. ENST00000541801; ENSP00000442601; ENSG00000121417. ENST00000544273; ENSP00000441386; ENSG00000121417. |
| GeneID | 10520. |
| KEGG | hsa:10520. |
| UCSC | uc002qpp.2. human. uc002qpq.2. human. uc002qpt.2. human. uc010yhb.1. human. uc010yhe.1. human. |
Organism-specific databases | |
| CTD | 10520. |
| GeneCards | GC19P058141. |
| HGNC | HGNC:13003. ZNF211. |
| HPA | HPA011340. |
| MIM | 601856. gene. |
| neXtProt | NX_Q13398. |
| PharmGKB | PA37582. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG5048. |
| HOVERGEN | HBG018163. |
| InParanoid | Q13398. |
| KO | K09228. |
Enzyme and pathway databases | |
| Reactome | REACT_71. Gene Expression. |
Gene expression databases | |
| ArrayExpress | Q13398. |
| Bgee | Q13398. |
| Genevestigator | Q13398. |
| GermOnline | ENSG00000121417. Homo sapiens. |
Family and domain databases | |
| Gene3D | 3.30.160.60. 12 hits. |
| InterPro | IPR001909. Krueppel-associated_box. IPR007087. Znf_C2H2. IPR015880. Znf_C2H2-like. IPR013087. Znf_C2H2/integrase_DNA-bd. [Graphical view] |
| Pfam | PF01352. KRAB. 1 hit. [Graphical view] |
| SMART | SM00349. KRAB. 1 hit. SM00355. ZnF_C2H2. 12 hits. [Graphical view] |
| SUPFAM | SSF109640. Krueppel-associated_box. 1 hit. |
| PROSITE | PS50805. KRAB. 1 hit. PS00028. ZINC_FINGER_C2H2_1. 11 hits. PS50157. ZINC_FINGER_C2H2_2. 12 hits. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 10520. |
| NextBio | 39896. |
| SOURCE | Search... |
Entry information
| Entry name | ZN211_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q13398 Secondary accession number(s): B4DH10 Q5EBL6 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 19 Human chromosome 19: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
