Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q13398

- ZN211_HUMAN

UniProt

Q13398 - ZN211_HUMAN

Protein

Zinc finger protein 211

Gene

ZNF211

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 127 (01 Oct 2014)
      Sequence version 2 (25 Nov 2008)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    May be involved in transcriptional regulation.

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Zinc fingeri131 – 15727C2H2-type 1PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri257 – 27923C2H2-type 2PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri285 – 30723C2H2-type 3PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri313 – 33523C2H2-type 4PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri341 – 36323C2H2-type 5PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri369 – 39123C2H2-type 6PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri397 – 41923C2H2-type 7PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri425 – 44723C2H2-type 8PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri453 – 47523C2H2-type 9PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri481 – 50323C2H2-type 10PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri509 – 53123C2H2-type 11PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri537 – 55923C2H2-type 12PROSITE-ProRule annotationAdd
    BLAST

    GO - Molecular functioni

    1. DNA binding Source: UniProtKB-KW
    2. metal ion binding Source: UniProtKB-KW

    GO - Biological processi

    1. regulation of transcription, DNA-templated Source: UniProtKB-KW
    2. transcription, DNA-templated Source: UniProtKB-KW

    Keywords - Biological processi

    Transcription, Transcription regulation

    Keywords - Ligandi

    DNA-binding, Metal-binding, Zinc

    Enzyme and pathway databases

    ReactomeiREACT_12627. Generic Transcription Pathway.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Zinc finger protein 211
    Alternative name(s):
    Zinc finger protein C2H2-25
    Gene namesi
    Name:ZNF211
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 19

    Organism-specific databases

    HGNCiHGNC:13003. ZNF211.

    Subcellular locationi

    Nucleus Curated

    GO - Cellular componenti

    1. nucleus Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Nucleus

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA37582.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 564564Zinc finger protein 211PRO_0000047455Add
    BLAST

    Proteomic databases

    PaxDbiQ13398.
    PRIDEiQ13398.

    PTM databases

    PhosphoSiteiQ13398.

    Expressioni

    Gene expression databases

    ArrayExpressiQ13398.
    BgeeiQ13398.
    GenevestigatoriQ13398.

    Organism-specific databases

    HPAiHPA011340.
    HPA049967.

    Interactioni

    Protein-protein interaction databases

    BioGridi115775. 1 interaction.
    IntActiQ13398. 1 interaction.

    Structurei

    3D structure databases

    ProteinModelPortaliQ13398.
    SMRiQ13398. Positions 29-73, 124-564.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini33 – 10674KRABPROSITE-ProRule annotationAdd
    BLAST

    Sequence similaritiesi

    Contains 12 C2H2-type zinc fingers.PROSITE-ProRule annotation
    Contains 1 KRAB domain.PROSITE-ProRule annotation

    Zinc finger

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Zinc fingeri131 – 15727C2H2-type 1PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri257 – 27923C2H2-type 2PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri285 – 30723C2H2-type 3PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri313 – 33523C2H2-type 4PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri341 – 36323C2H2-type 5PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri369 – 39123C2H2-type 6PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri397 – 41923C2H2-type 7PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri425 – 44723C2H2-type 8PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri453 – 47523C2H2-type 9PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri481 – 50323C2H2-type 10PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri509 – 53123C2H2-type 11PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri537 – 55923C2H2-type 12PROSITE-ProRule annotationAdd
    BLAST

    Keywords - Domaini

    Repeat, Zinc-finger

    Phylogenomic databases

    eggNOGiCOG5048.
    HOVERGENiHBG018163.
    InParanoidiQ13398.
    KOiK09228.
    OMAiNSNECEA.
    PhylomeDBiQ13398.
    TreeFamiTF339848.

    Family and domain databases

    Gene3Di3.30.160.60. 12 hits.
    InterProiIPR001909. Krueppel-associated_box.
    IPR007087. Znf_C2H2.
    IPR015880. Znf_C2H2-like.
    IPR013087. Znf_C2H2/integrase_DNA-bd.
    [Graphical view]
    PfamiPF01352. KRAB. 1 hit.
    [Graphical view]
    SMARTiSM00349. KRAB. 1 hit.
    SM00355. ZnF_C2H2. 12 hits.
    [Graphical view]
    SUPFAMiSSF109640. SSF109640. 1 hit.
    PROSITEiPS50805. KRAB. 1 hit.
    PS00028. ZINC_FINGER_C2H2_1. 11 hits.
    PS50157. ZINC_FINGER_C2H2_2. 12 hits.
    [Graphical view]

    Sequences (8)i

    Sequence statusi: Complete.

    This entry describes 8 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q13398-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MLGFPPGRPQ LPVQLRPQTR MATALRDPAS GSVTFEDVAV YFSWEEWDLL    50
    DEAQKHLYFD VMLENFALTS SLGCWCGVEH EETPSEQRIS GERVPQFRTS 100
    KEGSSSQNAD SCEICCLVLR DILHLAEHQG TNCGQKLHTC GKQFYISANL 150
    QQHQRQHITE APFRSYVDTA SFTQSCIVHV SEKPFTCREI RKDFLANMRF 200
    LHQDATQTGE KPNNSNKCAV AFYSGKSHHN WGKCSKAFSH IDTLVQDQRI 250
    LTREGLFECS KCGKACTRRC NLIQHQKVHS EERPYECNEC GKFFTYYSSF 300
    IIHQRVHTGE RPYACPECGK SFSQIYSLNS HRKVHTGERP YECGECGKSF 350
    SQRSNLMQHR RVHTGERPYE CSECGKSFSQ NFSLIYHQRV HTGERPHECN 400
    ECGKSFSRSS SLIHHRRLHT GERPYECSKC GKSFKQSSSF SSHRKVHTGE 450
    RPYVCGECGK SFSHSSNLKN HQRVHTGERP VECSECSKSF SCKSNLIKHL 500
    RVHTGERPYE CSECGKSFSQ SSSLIQHRRV HTGKRPYQCS QCGKSFGCKS 550
    VLIQHQRVHI GEKP 564
    Length:564
    Mass (Da):64,535
    Last modified:November 25, 2008 - v2
    Checksum:i9506968ED6E36EE7
    GO
    Isoform 2 (identifier: Q13398-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-72: MLGFPPGRPQ...LENFALTSSL → MLENFALTSS...EWHLGKGMSS

    Show »
    Length:555
    Mass (Da):63,207
    Checksum:i3514A46C5D45C3CB
    GO
    Isoform 3 (identifier: Q13398-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-30: MLGFPPGRPQLPVQLRPQTRMATALRDPAS → MRTLRQREVEYFSKATQLVRGSTKDRGAQVPIATEVLFKLTQ

    Show »
    Length:576
    Mass (Da):66,086
    Checksum:iD6EEF6EE3B96EE74
    GO
    Isoform 4 (identifier: Q13398-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-30: MLGFPPGRPQLPVQLRPQTRMATALRDPAS → MISAYCNLHLLGSSDSPASASQVAGTTGMRHHAQ

    Note: No experimental confirmation available.

    Show »
    Length:568
    Mass (Da):64,732
    Checksum:i4D27374C591C04F1
    GO
    Isoform 5 (identifier: Q13398-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-61: Missing.

    Show »
    Length:503
    Mass (Da):57,530
    Checksum:iC39EBEF2E28C434C
    GO
    Isoform 6 (identifier: Q13398-6) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-20: Missing.

    Show »
    Length:544
    Mass (Da):62,265
    Checksum:i2C5B0BFC61CB971D
    GO
    Isoform 7 (identifier: Q13398-7) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         30-30: S → SVPIATEVLFKLTQ

    Note: No experimental confirmation available.

    Show »
    Length:577
    Mass (Da):65,976
    Checksum:iD4C8C5C5535400C5
    GO
    Isoform 8 (identifier: Q13398-8) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         30-30: S → SVPIATEVLFKLTQ
         73-73: G → GLISSWSHVVAQLGLGEVPSVLHRMFMTPASARWDQRGPGLHEWHLGKGMSSG

    Note: Gene prediction based on EST data.

    Show »
    Length:629
    Mass (Da):71,654
    Checksum:i01F0BD30953F2EA7
    GO

    Sequence cautioni

    The sequence AAH34351.1 differs from that shown. Reason: Contaminating sequence. Potential poly-A sequence.
    The sequence AAA93261.1 differs from that shown. Reason: Erroneous initiation.
    The sequence BAD93084.1 differs from that shown. Reason: Erroneous initiation.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti178 – 1781V → A in AK026941. (PubMed:14702039)Curated
    Sequence conflicti276 – 2761Q → L in BAG59491. (PubMed:14702039)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti110 – 1101D → N.
    Corresponds to variant rs34897843 [ dbSNP | Ensembl ].
    VAR_047278
    Natural varianti314 – 3141A → V.2 Publications
    Corresponds to variant rs11879465 [ dbSNP | Ensembl ].
    VAR_057402

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 7272MLGFP…LTSSL → MLENFALTSSLGLISSWSHV VAQLGLGEVPSVLHRMFMTP ASARWDQRGPGLHEWHLGKG MSS in isoform 2. 1 PublicationVSP_035702Add
    BLAST
    Alternative sequencei1 – 6161Missing in isoform 5. 1 PublicationVSP_035703Add
    BLAST
    Alternative sequencei1 – 3030MLGFP…RDPAS → MRTLRQREVEYFSKATQLVR GSTKDRGAQVPIATEVLFKL TQ in isoform 3. 2 PublicationsVSP_035704Add
    BLAST
    Alternative sequencei1 – 3030MLGFP…RDPAS → MISAYCNLHLLGSSDSPASA SQVAGTTGMRHHAQ in isoform 4. 1 PublicationVSP_035705Add
    BLAST
    Alternative sequencei1 – 2020Missing in isoform 6. 1 PublicationVSP_035706Add
    BLAST
    Alternative sequencei30 – 301S → SVPIATEVLFKLTQ in isoform 7 and isoform 8. 1 PublicationVSP_045643
    Alternative sequencei73 – 731G → GLISSWSHVVAQLGLGEVPS VLHRMFMTPASARWDQRGPG LHEWHLGKGMSSG in isoform 8. CuratedVSP_046769

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK026941 mRNA. No translation available.
    AK294869 mRNA. Translation: BAG57971.1.
    AK296942 mRNA. Translation: BAG59491.1.
    AK297047 mRNA. Translation: BAG59573.1.
    AK304666 mRNA. Translation: BAG65441.1.
    AB209273 mRNA. Translation: BAD92510.1.
    AB209847 mRNA. Translation: BAD93084.1. Different initiation.
    AC003682 Genomic DNA. No translation available.
    BC034351 mRNA. Translation: AAH34351.1. Sequence problems.
    BC089440 mRNA. Translation: AAH89440.1.
    BC110856 mRNA. Translation: AAI10857.1.
    U38904 mRNA. Translation: AAA93261.1. Different initiation.
    CCDSiCCDS12956.1. [Q13398-7]
    CCDS12957.1. [Q13398-1]
    CCDS58686.1. [Q13398-8]
    CCDS58687.1. [Q13398-2]
    CCDS58688.1. [Q13398-5]
    RefSeqiNP_001252526.1. NM_001265597.1. [Q13398-8]
    NP_001252527.1. NM_001265598.1.
    NP_001252528.1. NM_001265599.1. [Q13398-2]
    NP_001252529.1. NM_001265600.1. [Q13398-5]
    NP_006376.2. NM_006385.3. [Q13398-7]
    NP_942152.1. NM_198855.2. [Q13398-1]
    UniGeneiHs.590977.

    Genome annotation databases

    EnsembliENST00000240731; ENSP00000240731; ENSG00000121417. [Q13398-7]
    ENST00000254182; ENSP00000254182; ENSG00000121417. [Q13398-2]
    ENST00000299871; ENSP00000299871; ENSG00000121417. [Q13398-8]
    ENST00000347302; ENSP00000339562; ENSG00000121417. [Q13398-1]
    ENST00000391703; ENSP00000375584; ENSG00000121417. [Q13398-5]
    ENST00000541801; ENSP00000442601; ENSG00000121417. [Q13398-2]
    GeneIDi10520.
    KEGGihsa:10520.
    UCSCiuc002qpq.2. human. [Q13398-1]
    uc002qpt.2. human. [Q13398-3]
    uc010yhb.1. human. [Q13398-4]
    uc010yhe.2. human. [Q13398-2]

    Polymorphism databases

    DMDMi215273921.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK026941 mRNA. No translation available.
    AK294869 mRNA. Translation: BAG57971.1 .
    AK296942 mRNA. Translation: BAG59491.1 .
    AK297047 mRNA. Translation: BAG59573.1 .
    AK304666 mRNA. Translation: BAG65441.1 .
    AB209273 mRNA. Translation: BAD92510.1 .
    AB209847 mRNA. Translation: BAD93084.1 . Different initiation.
    AC003682 Genomic DNA. No translation available.
    BC034351 mRNA. Translation: AAH34351.1 . Sequence problems.
    BC089440 mRNA. Translation: AAH89440.1 .
    BC110856 mRNA. Translation: AAI10857.1 .
    U38904 mRNA. Translation: AAA93261.1 . Different initiation.
    CCDSi CCDS12956.1. [Q13398-7 ]
    CCDS12957.1. [Q13398-1 ]
    CCDS58686.1. [Q13398-8 ]
    CCDS58687.1. [Q13398-2 ]
    CCDS58688.1. [Q13398-5 ]
    RefSeqi NP_001252526.1. NM_001265597.1. [Q13398-8 ]
    NP_001252527.1. NM_001265598.1.
    NP_001252528.1. NM_001265599.1. [Q13398-2 ]
    NP_001252529.1. NM_001265600.1. [Q13398-5 ]
    NP_006376.2. NM_006385.3. [Q13398-7 ]
    NP_942152.1. NM_198855.2. [Q13398-1 ]
    UniGenei Hs.590977.

    3D structure databases

    ProteinModelPortali Q13398.
    SMRi Q13398. Positions 29-73, 124-564.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 115775. 1 interaction.
    IntActi Q13398. 1 interaction.

    PTM databases

    PhosphoSitei Q13398.

    Polymorphism databases

    DMDMi 215273921.

    Proteomic databases

    PaxDbi Q13398.
    PRIDEi Q13398.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000240731 ; ENSP00000240731 ; ENSG00000121417 . [Q13398-7 ]
    ENST00000254182 ; ENSP00000254182 ; ENSG00000121417 . [Q13398-2 ]
    ENST00000299871 ; ENSP00000299871 ; ENSG00000121417 . [Q13398-8 ]
    ENST00000347302 ; ENSP00000339562 ; ENSG00000121417 . [Q13398-1 ]
    ENST00000391703 ; ENSP00000375584 ; ENSG00000121417 . [Q13398-5 ]
    ENST00000541801 ; ENSP00000442601 ; ENSG00000121417 . [Q13398-2 ]
    GeneIDi 10520.
    KEGGi hsa:10520.
    UCSCi uc002qpq.2. human. [Q13398-1 ]
    uc002qpt.2. human. [Q13398-3 ]
    uc010yhb.1. human. [Q13398-4 ]
    uc010yhe.2. human. [Q13398-2 ]

    Organism-specific databases

    CTDi 10520.
    GeneCardsi GC19P058141.
    HGNCi HGNC:13003. ZNF211.
    HPAi HPA011340.
    HPA049967.
    MIMi 601856. gene.
    neXtProti NX_Q13398.
    PharmGKBi PA37582.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG5048.
    HOVERGENi HBG018163.
    InParanoidi Q13398.
    KOi K09228.
    OMAi NSNECEA.
    PhylomeDBi Q13398.
    TreeFami TF339848.

    Enzyme and pathway databases

    Reactomei REACT_12627. Generic Transcription Pathway.

    Miscellaneous databases

    GenomeRNAii 10520.
    NextBioi 39896.
    PROi Q13398.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q13398.
    Bgeei Q13398.
    Genevestigatori Q13398.

    Family and domain databases

    Gene3Di 3.30.160.60. 12 hits.
    InterProi IPR001909. Krueppel-associated_box.
    IPR007087. Znf_C2H2.
    IPR015880. Znf_C2H2-like.
    IPR013087. Znf_C2H2/integrase_DNA-bd.
    [Graphical view ]
    Pfami PF01352. KRAB. 1 hit.
    [Graphical view ]
    SMARTi SM00349. KRAB. 1 hit.
    SM00355. ZnF_C2H2. 12 hits.
    [Graphical view ]
    SUPFAMi SSF109640. SSF109640. 1 hit.
    PROSITEi PS50805. KRAB. 1 hit.
    PS00028. ZINC_FINGER_C2H2_1. 11 hits.
    PS50157. ZINC_FINGER_C2H2_2. 12 hits.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2; 3; 5; 6 AND 7).
      Tissue: Blood, Brain, Hepatoma, Tongue and Uterus.
    2. Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S., Ohara O., Nagase T., Kikuno R.F.
      Submitted (MAR-2005) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4), VARIANT VAL-314.
      Tissue: Brain and Endothelial cell.
    3. "The DNA sequence and biology of human chromosome 19."
      Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J., Lamerdin J.E., Hellsten U., Goodstein D., Couronne O., Tran-Gyamfi M., Aerts A., Altherr M., Ashworth L., Bajorek E., Black S., Branscomb E., Caenepeel S., Carrano A.V.
      , Caoile C., Chan Y.M., Christensen M., Cleland C.A., Copeland A., Dalin E., Dehal P., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Garcia C., Georgescu A.M., Glavina T., Gomez M., Gonzales E., Groza M., Hammon N., Hawkins T., Haydu L., Ho I., Huang W., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Larionov V., Leem S.-H., Lopez F., Lou Y., Lowry S., Malfatti S., Martinez D., McCready P.M., Medina C., Morgan J., Nelson K., Nolan M., Ovcharenko I., Pitluck S., Pollard M., Popkie A.P., Predki P., Quan G., Ramirez L., Rash S., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., She X., Smith D., Slezak T., Solovyev V., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wagner M., Wheeler J., Wu K., Xie G., Yang J., Dubchak I., Furey T.S., DeJong P., Dickson M., Gordon D., Eichler E.E., Pennacchio L.A., Richardson P., Stubbs L., Rokhsar D.S., Myers R.M., Rubin E.M., Lucas S.M.
      Nature 428:529-535(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-505 (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 24-564 (ISOFORM 1), VARIANT VAL-314.
      Tissue: Chondrosarcoma, Skin and Uterus.
    5. "Molecular cloning and mapping of a novel developmentally regulated human C2H2-type zinc finger."
      Becker K.G., Canning R.D., Nagle J.W., Dehejia A.M., Polymeropoulos M.H., Lee I.J., Gado A.M., Biddison W.E., Drew P.D.
      Mamm. Genome 8:287-289(1997) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 160-564 (ISOFORMS 1/2/3/4/5/6).
      Tissue: Brain.
    6. "Rapid isolation and characterization of 118 novel C2H2-type zinc finger cDNAs expressed in human brain."
      Becker K.G., Nagle J.W., Canning R.D., Biddison W.E., Ozato K., Drew P.D.
      Hum. Mol. Genet. 4:685-691(1995) [PubMed] [Europe PMC] [Abstract]
      Cited for: PARTIAL NUCLEOTIDE SEQUENCE [MRNA].
      Tissue: Hippocampus.

    Entry informationi

    Entry nameiZN211_HUMAN
    AccessioniPrimary (citable) accession number: Q13398
    Secondary accession number(s): B4DH10
    , B4DLC9, B4E3C9, B9ZVS7, B9ZVW1, F8WDV2, Q05BQ7, Q2TAL7, Q59EG4, Q59G36, Q5EBL6
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: May 30, 2000
    Last sequence update: November 25, 2008
    Last modified: October 1, 2014
    This is version 127 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 19
      Human chromosome 19: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3