SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q13398

- ZN211_HUMAN

UniProt

Q13398 - ZN211_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Zinc finger protein 211

Gene
ZNF211
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5 - Experimental evidence at transcript leveli

Functioni

May be involved in transcriptional regulation.

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri131 – 15727C2H2-type 1Add
BLAST
Zinc fingeri257 – 27923C2H2-type 2Add
BLAST
Zinc fingeri285 – 30723C2H2-type 3Add
BLAST
Zinc fingeri313 – 33523C2H2-type 4Add
BLAST
Zinc fingeri341 – 36323C2H2-type 5Add
BLAST
Zinc fingeri369 – 39123C2H2-type 6Add
BLAST
Zinc fingeri397 – 41923C2H2-type 7Add
BLAST
Zinc fingeri425 – 44723C2H2-type 8Add
BLAST
Zinc fingeri453 – 47523C2H2-type 9Add
BLAST
Zinc fingeri481 – 50323C2H2-type 10Add
BLAST
Zinc fingeri509 – 53123C2H2-type 11Add
BLAST
Zinc fingeri537 – 55923C2H2-type 12Add
BLAST

GO - Molecular functioni

  1. DNA binding Source: UniProtKB-KW
  2. metal ion binding Source: UniProtKB-KW

GO - Biological processi

  1. regulation of transcription, DNA-templated Source: UniProtKB-KW
  2. transcription, DNA-templated Source: UniProtKB-KW
Complete GO annotation...

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding, Metal-binding, Zinc

Enzyme and pathway databases

ReactomeiREACT_12627. Generic Transcription Pathway.

Names & Taxonomyi

Protein namesi
Recommended name:
Zinc finger protein 211
Alternative name(s):
Zinc finger protein C2H2-25
Gene namesi
Name:ZNF211
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 19

Organism-specific databases

HGNCiHGNC:13003. ZNF211.

Subcellular locationi

Nucleus Inferred

GO - Cellular componenti

  1. nucleus Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA37582.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 564564Zinc finger protein 211PRO_0000047455Add
BLAST

Proteomic databases

PaxDbiQ13398.
PRIDEiQ13398.

PTM databases

PhosphoSiteiQ13398.

Expressioni

Gene expression databases

ArrayExpressiQ13398.
BgeeiQ13398.
GenevestigatoriQ13398.

Organism-specific databases

HPAiHPA011340.
HPA049967.

Interactioni

Protein-protein interaction databases

BioGridi115775. 1 interaction.
IntActiQ13398. 1 interaction.

Structurei

3D structure databases

ProteinModelPortaliQ13398.
SMRiQ13398. Positions 29-73, 124-564.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini33 – 10674KRABAdd
BLAST

Sequence similaritiesi

Contains 12 C2H2-type zinc fingers.
Contains 1 KRAB domain.

Zinc finger

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri131 – 15727C2H2-type 1Add
BLAST
Zinc fingeri257 – 27923C2H2-type 2Add
BLAST
Zinc fingeri285 – 30723C2H2-type 3Add
BLAST
Zinc fingeri313 – 33523C2H2-type 4Add
BLAST
Zinc fingeri341 – 36323C2H2-type 5Add
BLAST
Zinc fingeri369 – 39123C2H2-type 6Add
BLAST
Zinc fingeri397 – 41923C2H2-type 7Add
BLAST
Zinc fingeri425 – 44723C2H2-type 8Add
BLAST
Zinc fingeri453 – 47523C2H2-type 9Add
BLAST
Zinc fingeri481 – 50323C2H2-type 10Add
BLAST
Zinc fingeri509 – 53123C2H2-type 11Add
BLAST
Zinc fingeri537 – 55923C2H2-type 12Add
BLAST

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiCOG5048.
HOVERGENiHBG018163.
InParanoidiQ13398.
KOiK09228.
OMAiNSNECEA.
PhylomeDBiQ13398.
TreeFamiTF339848.

Family and domain databases

Gene3Di3.30.160.60. 12 hits.
InterProiIPR001909. Krueppel-associated_box.
IPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view]
PfamiPF01352. KRAB. 1 hit.
[Graphical view]
SMARTiSM00349. KRAB. 1 hit.
SM00355. ZnF_C2H2. 12 hits.
[Graphical view]
SUPFAMiSSF109640. SSF109640. 1 hit.
PROSITEiPS50805. KRAB. 1 hit.
PS00028. ZINC_FINGER_C2H2_1. 11 hits.
PS50157. ZINC_FINGER_C2H2_2. 12 hits.
[Graphical view]

Sequences (8)i

Sequence statusi: Complete.

This entry describes 8 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q13398-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MLGFPPGRPQ LPVQLRPQTR MATALRDPAS GSVTFEDVAV YFSWEEWDLL    50
DEAQKHLYFD VMLENFALTS SLGCWCGVEH EETPSEQRIS GERVPQFRTS 100
KEGSSSQNAD SCEICCLVLR DILHLAEHQG TNCGQKLHTC GKQFYISANL 150
QQHQRQHITE APFRSYVDTA SFTQSCIVHV SEKPFTCREI RKDFLANMRF 200
LHQDATQTGE KPNNSNKCAV AFYSGKSHHN WGKCSKAFSH IDTLVQDQRI 250
LTREGLFECS KCGKACTRRC NLIQHQKVHS EERPYECNEC GKFFTYYSSF 300
IIHQRVHTGE RPYACPECGK SFSQIYSLNS HRKVHTGERP YECGECGKSF 350
SQRSNLMQHR RVHTGERPYE CSECGKSFSQ NFSLIYHQRV HTGERPHECN 400
ECGKSFSRSS SLIHHRRLHT GERPYECSKC GKSFKQSSSF SSHRKVHTGE 450
RPYVCGECGK SFSHSSNLKN HQRVHTGERP VECSECSKSF SCKSNLIKHL 500
RVHTGERPYE CSECGKSFSQ SSSLIQHRRV HTGKRPYQCS QCGKSFGCKS 550
VLIQHQRVHI GEKP 564
Length:564
Mass (Da):64,535
Last modified:November 25, 2008 - v2
Checksum:i9506968ED6E36EE7
GO
Isoform 2 (identifier: Q13398-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-72: MLGFPPGRPQ...LENFALTSSL → MLENFALTSS...EWHLGKGMSS

Show »
Length:555
Mass (Da):63,207
Checksum:i3514A46C5D45C3CB
GO
Isoform 3 (identifier: Q13398-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-30: MLGFPPGRPQLPVQLRPQTRMATALRDPAS → MRTLRQREVEYFSKATQLVRGSTKDRGAQVPIATEVLFKLTQ

Show »
Length:576
Mass (Da):66,086
Checksum:iD6EEF6EE3B96EE74
GO
Isoform 4 (identifier: Q13398-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-30: MLGFPPGRPQLPVQLRPQTRMATALRDPAS → MISAYCNLHLLGSSDSPASASQVAGTTGMRHHAQ

Note: No experimental confirmation available.

Show »
Length:568
Mass (Da):64,732
Checksum:i4D27374C591C04F1
GO
Isoform 5 (identifier: Q13398-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-61: Missing.

Show »
Length:503
Mass (Da):57,530
Checksum:iC39EBEF2E28C434C
GO
Isoform 6 (identifier: Q13398-6) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-20: Missing.

Show »
Length:544
Mass (Da):62,265
Checksum:i2C5B0BFC61CB971D
GO
Isoform 7 (identifier: Q13398-7) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     30-30: S → SVPIATEVLFKLTQ

Note: No experimental confirmation available.

Show »
Length:577
Mass (Da):65,976
Checksum:iD4C8C5C5535400C5
GO
Isoform 8 (identifier: Q13398-8) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     30-30: S → SVPIATEVLFKLTQ
     73-73: G → GLISSWSHVVAQLGLGEVPSVLHRMFMTPASARWDQRGPGLHEWHLGKGMSSG

Note: Gene prediction based on EST data.

Show »
Length:629
Mass (Da):71,654
Checksum:i01F0BD30953F2EA7
GO

Sequence cautioni

The sequence AAH34351.1 differs from that shown. Reason: Contaminating sequence. Potential poly-A sequence.
The sequence AAA93261.1 differs from that shown. Reason: Erroneous initiation.
The sequence BAD93084.1 differs from that shown. Reason: Erroneous initiation.

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti110 – 1101D → N.
Corresponds to variant rs34897843 [ dbSNP | Ensembl ].
VAR_047278
Natural varianti314 – 3141A → V.2 Publications
Corresponds to variant rs11879465 [ dbSNP | Ensembl ].
VAR_057402

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 7272MLGFP…LTSSL → MLENFALTSSLGLISSWSHV VAQLGLGEVPSVLHRMFMTP ASARWDQRGPGLHEWHLGKG MSS in isoform 2. VSP_035702Add
BLAST
Alternative sequencei1 – 6161Missing in isoform 5. VSP_035703Add
BLAST
Alternative sequencei1 – 3030MLGFP…RDPAS → MRTLRQREVEYFSKATQLVR GSTKDRGAQVPIATEVLFKL TQ in isoform 3. VSP_035704Add
BLAST
Alternative sequencei1 – 3030MLGFP…RDPAS → MISAYCNLHLLGSSDSPASA SQVAGTTGMRHHAQ in isoform 4. VSP_035705Add
BLAST
Alternative sequencei1 – 2020Missing in isoform 6. VSP_035706Add
BLAST
Alternative sequencei30 – 301S → SVPIATEVLFKLTQ in isoform 7 and isoform 8. VSP_045643
Alternative sequencei73 – 731G → GLISSWSHVVAQLGLGEVPS VLHRMFMTPASARWDQRGPG LHEWHLGKGMSSG in isoform 8. VSP_046769

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti178 – 1781V → A in AK026941. 1 Publication
Sequence conflicti276 – 2761Q → L in BAG59491. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK026941 mRNA. No translation available.
AK294869 mRNA. Translation: BAG57971.1.
AK296942 mRNA. Translation: BAG59491.1.
AK297047 mRNA. Translation: BAG59573.1.
AK304666 mRNA. Translation: BAG65441.1.
AB209273 mRNA. Translation: BAD92510.1.
AB209847 mRNA. Translation: BAD93084.1. Different initiation.
AC003682 Genomic DNA. No translation available.
BC034351 mRNA. Translation: AAH34351.1. Sequence problems.
BC089440 mRNA. Translation: AAH89440.1.
BC110856 mRNA. Translation: AAI10857.1.
U38904 mRNA. Translation: AAA93261.1. Different initiation.
CCDSiCCDS12956.1. [Q13398-7]
CCDS12957.1. [Q13398-1]
CCDS58686.1. [Q13398-8]
CCDS58687.1. [Q13398-2]
CCDS58688.1. [Q13398-5]
RefSeqiNP_001252526.1. NM_001265597.1. [Q13398-8]
NP_001252527.1. NM_001265598.1.
NP_001252528.1. NM_001265599.1. [Q13398-2]
NP_001252529.1. NM_001265600.1. [Q13398-5]
NP_006376.2. NM_006385.3. [Q13398-7]
NP_942152.1. NM_198855.2. [Q13398-1]
UniGeneiHs.590977.

Genome annotation databases

EnsembliENST00000240731; ENSP00000240731; ENSG00000121417. [Q13398-7]
ENST00000254182; ENSP00000254182; ENSG00000121417. [Q13398-2]
ENST00000299871; ENSP00000299871; ENSG00000121417. [Q13398-8]
ENST00000347302; ENSP00000339562; ENSG00000121417. [Q13398-1]
ENST00000391703; ENSP00000375584; ENSG00000121417. [Q13398-5]
ENST00000420680; ENSP00000399193; ENSG00000121417. [Q13398-4]
ENST00000541801; ENSP00000442601; ENSG00000121417. [Q13398-2]
ENST00000544273; ENSP00000441386; ENSG00000121417. [Q13398-3]
GeneIDi10520.
KEGGihsa:10520.
UCSCiuc002qpq.2. human. [Q13398-1]
uc002qpt.2. human. [Q13398-3]
uc010yhb.1. human. [Q13398-4]
uc010yhe.2. human. [Q13398-2]

Polymorphism databases

DMDMi215273921.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK026941 mRNA. No translation available.
AK294869 mRNA. Translation: BAG57971.1 .
AK296942 mRNA. Translation: BAG59491.1 .
AK297047 mRNA. Translation: BAG59573.1 .
AK304666 mRNA. Translation: BAG65441.1 .
AB209273 mRNA. Translation: BAD92510.1 .
AB209847 mRNA. Translation: BAD93084.1 . Different initiation.
AC003682 Genomic DNA. No translation available.
BC034351 mRNA. Translation: AAH34351.1 . Sequence problems.
BC089440 mRNA. Translation: AAH89440.1 .
BC110856 mRNA. Translation: AAI10857.1 .
U38904 mRNA. Translation: AAA93261.1 . Different initiation.
CCDSi CCDS12956.1. [Q13398-7 ]
CCDS12957.1. [Q13398-1 ]
CCDS58686.1. [Q13398-8 ]
CCDS58687.1. [Q13398-2 ]
CCDS58688.1. [Q13398-5 ]
RefSeqi NP_001252526.1. NM_001265597.1. [Q13398-8 ]
NP_001252527.1. NM_001265598.1.
NP_001252528.1. NM_001265599.1. [Q13398-2 ]
NP_001252529.1. NM_001265600.1. [Q13398-5 ]
NP_006376.2. NM_006385.3. [Q13398-7 ]
NP_942152.1. NM_198855.2. [Q13398-1 ]
UniGenei Hs.590977.

3D structure databases

ProteinModelPortali Q13398.
SMRi Q13398. Positions 29-73, 124-564.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 115775. 1 interaction.
IntActi Q13398. 1 interaction.

PTM databases

PhosphoSitei Q13398.

Polymorphism databases

DMDMi 215273921.

Proteomic databases

PaxDbi Q13398.
PRIDEi Q13398.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000240731 ; ENSP00000240731 ; ENSG00000121417 . [Q13398-7 ]
ENST00000254182 ; ENSP00000254182 ; ENSG00000121417 . [Q13398-2 ]
ENST00000299871 ; ENSP00000299871 ; ENSG00000121417 . [Q13398-8 ]
ENST00000347302 ; ENSP00000339562 ; ENSG00000121417 . [Q13398-1 ]
ENST00000391703 ; ENSP00000375584 ; ENSG00000121417 . [Q13398-5 ]
ENST00000420680 ; ENSP00000399193 ; ENSG00000121417 . [Q13398-4 ]
ENST00000541801 ; ENSP00000442601 ; ENSG00000121417 . [Q13398-2 ]
ENST00000544273 ; ENSP00000441386 ; ENSG00000121417 . [Q13398-3 ]
GeneIDi 10520.
KEGGi hsa:10520.
UCSCi uc002qpq.2. human. [Q13398-1 ]
uc002qpt.2. human. [Q13398-3 ]
uc010yhb.1. human. [Q13398-4 ]
uc010yhe.2. human. [Q13398-2 ]

Organism-specific databases

CTDi 10520.
GeneCardsi GC19P058141.
HGNCi HGNC:13003. ZNF211.
HPAi HPA011340.
HPA049967.
MIMi 601856. gene.
neXtProti NX_Q13398.
PharmGKBi PA37582.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG5048.
HOVERGENi HBG018163.
InParanoidi Q13398.
KOi K09228.
OMAi NSNECEA.
PhylomeDBi Q13398.
TreeFami TF339848.

Enzyme and pathway databases

Reactomei REACT_12627. Generic Transcription Pathway.

Miscellaneous databases

GenomeRNAii 10520.
NextBioi 39896.
PROi Q13398.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q13398.
Bgeei Q13398.
Genevestigatori Q13398.

Family and domain databases

Gene3Di 3.30.160.60. 12 hits.
InterProi IPR001909. Krueppel-associated_box.
IPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view ]
Pfami PF01352. KRAB. 1 hit.
[Graphical view ]
SMARTi SM00349. KRAB. 1 hit.
SM00355. ZnF_C2H2. 12 hits.
[Graphical view ]
SUPFAMi SSF109640. SSF109640. 1 hit.
PROSITEi PS50805. KRAB. 1 hit.
PS00028. ZINC_FINGER_C2H2_1. 11 hits.
PS50157. ZINC_FINGER_C2H2_2. 12 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2; 3; 5; 6 AND 7).
    Tissue: Blood, Brain, Hepatoma, Tongue and Uterus.
  2. Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S., Ohara O., Nagase T., Kikuno R.F.
    Submitted (MAR-2005) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4), VARIANT VAL-314.
    Tissue: Brain and Endothelial cell.
  3. "The DNA sequence and biology of human chromosome 19."
    Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J., Lamerdin J.E., Hellsten U., Goodstein D., Couronne O., Tran-Gyamfi M., Aerts A., Altherr M., Ashworth L., Bajorek E., Black S., Branscomb E., Caenepeel S., Carrano A.V.
    , Caoile C., Chan Y.M., Christensen M., Cleland C.A., Copeland A., Dalin E., Dehal P., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Garcia C., Georgescu A.M., Glavina T., Gomez M., Gonzales E., Groza M., Hammon N., Hawkins T., Haydu L., Ho I., Huang W., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Larionov V., Leem S.-H., Lopez F., Lou Y., Lowry S., Malfatti S., Martinez D., McCready P.M., Medina C., Morgan J., Nelson K., Nolan M., Ovcharenko I., Pitluck S., Pollard M., Popkie A.P., Predki P., Quan G., Ramirez L., Rash S., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., She X., Smith D., Slezak T., Solovyev V., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wagner M., Wheeler J., Wu K., Xie G., Yang J., Dubchak I., Furey T.S., DeJong P., Dickson M., Gordon D., Eichler E.E., Pennacchio L.A., Richardson P., Stubbs L., Rokhsar D.S., Myers R.M., Rubin E.M., Lucas S.M.
    Nature 428:529-535(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-505 (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 24-564 (ISOFORM 1), VARIANT VAL-314.
    Tissue: Chondrosarcoma, Skin and Uterus.
  5. "Molecular cloning and mapping of a novel developmentally regulated human C2H2-type zinc finger."
    Becker K.G., Canning R.D., Nagle J.W., Dehejia A.M., Polymeropoulos M.H., Lee I.J., Gado A.M., Biddison W.E., Drew P.D.
    Mamm. Genome 8:287-289(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 160-564 (ISOFORMS 1/2/3/4/5/6).
    Tissue: Brain.
  6. "Rapid isolation and characterization of 118 novel C2H2-type zinc finger cDNAs expressed in human brain."
    Becker K.G., Nagle J.W., Canning R.D., Biddison W.E., Ozato K., Drew P.D.
    Hum. Mol. Genet. 4:685-691(1995) [PubMed] [Europe PMC] [Abstract]
    Cited for: PARTIAL NUCLEOTIDE SEQUENCE [MRNA].
    Tissue: Hippocampus.

Entry informationi

Entry nameiZN211_HUMAN
AccessioniPrimary (citable) accession number: Q13398
Secondary accession number(s): B4DH10
, B4DLC9, B4E3C9, B9ZVS7, B9ZVW1, F8WDV2, Q05BQ7, Q2TAL7, Q59EG4, Q59G36, Q5EBL6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: November 25, 2008
Last modified: September 3, 2014
This is version 126 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi