Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q13387

- JIP2_HUMAN

UniProt

Q13387 - JIP2_HUMAN

Protein

C-Jun-amino-terminal kinase-interacting protein 2

Gene

MAPK8IP2

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 128 (01 Oct 2014)
      Sequence version 2 (05 Dec 2001)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    The JNK-interacting protein (JIP) group of scaffold proteins selectively mediates JNK signaling by aggregating specific components of the MAPK cascade to form a functional JNK signaling module. JIP2 inhibits IL1 beta-induced apoptosis in insulin-secreting cells. May function as a regulator of vesicle transport, through interactions with the JNK-signaling components and motor proteins By similarity.By similarity

    GO - Molecular functioni

    1. beta-amyloid binding Source: UniProtKB
    2. kinesin binding Source: UniProtKB
    3. MAP-kinase scaffold activity Source: UniProtKB
    4. protein binding Source: IntAct
    5. protein kinase activator activity Source: MGI
    6. protein kinase binding Source: UniProtKB
    7. structural molecule activity Source: ProtInc

    GO - Biological processi

    1. behavioral fear response Source: BHF-UCL
    2. dendrite morphogenesis Source: BHF-UCL
    3. MAPK cascade Source: MGI
    4. nonassociative learning Source: BHF-UCL
    5. positive regulation of protein kinase activity Source: GOC
    6. positive regulation of signal transduction Source: GOC
    7. regulation of alpha-amino-3-hydroxy-5-methyl-4-isoxazole propionate selective glutamate receptor activity Source: BHF-UCL
    8. regulation of excitatory postsynaptic membrane potential Source: BHF-UCL
    9. regulation of JNK cascade Source: UniProtKB
    10. regulation of N-methyl-D-aspartate selective glutamate receptor activity Source: BHF-UCL
    11. regulation of receptor activity Source: BHF-UCL
    12. regulation of synaptic transmission, glutamatergic Source: BHF-UCL
    13. signal complex assembly Source: ProtInc
    14. social behavior Source: BHF-UCL

    Enzyme and pathway databases

    SignaLinkiQ13387.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    C-Jun-amino-terminal kinase-interacting protein 2
    Short name:
    JIP-2
    Short name:
    JNK-interacting protein 2
    Alternative name(s):
    Islet-brain-2
    Short name:
    IB-2
    JNK MAP kinase scaffold protein 2
    Mitogen-activated protein kinase 8-interacting protein 2
    Gene namesi
    Name:MAPK8IP2
    Synonyms:IB2, JIP2, PRKM8IPL
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 22

    Organism-specific databases

    HGNCiHGNC:6883. MAPK8IP2.

    Subcellular locationi

    Cytoplasm
    Note: Accumulates in cell surface projections.

    GO - Cellular componenti

    1. cytoplasm Source: UniProtKB
    2. neuronal postsynaptic density Source: BHF-UCL

    Keywords - Cellular componenti

    Cytoplasm

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA30627.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 824824C-Jun-amino-terminal kinase-interacting protein 2PRO_0000220631Add
    BLAST

    Proteomic databases

    PaxDbiQ13387.
    PRIDEiQ13387.

    PTM databases

    PhosphoSiteiQ13387.

    Expressioni

    Tissue specificityi

    Expressed mainly in the brain and pancreas, including insulin-secreting cells. In the nervous system, more abundantly expressed in the cerebellum, pituitary gland, occipital lobe and the amygdala. Also expressed in fetal brain. Very low levels found in uterus, ovary, prostate, colon, testis, adrenal gland, thyroid gland and salivary gland.

    Gene expression databases

    ArrayExpressiQ13387.
    BgeeiQ13387.
    CleanExiHS_MAPK8IP2.
    GenevestigatoriQ13387.

    Organism-specific databases

    HPAiHPA034780.

    Interactioni

    Subunit structurei

    Forms homo- or heterooligomeric complexes. Binds specific components of the JNK signaling pathway namely JNK1, JNK2, JNK3, MAP2K7, MAP3K10, MAP3K11, MAP3K12 and MAPK13. Also binds the proline-rich domain-containing splice variant of apolipoprotein E receptor 2 (ApoER2). Binds the cytoplasmic tails of LRP1 and LRP2 (Megalin). Binds the TPR motif-containing C-terminal of kinesin light chain, Klc1, pre-assembled MAPK8IP1 scaffolding complexes are then transported as a cargo of kinesin, to the required subcellular location By similarity. Interacts with the cytoplasmic domain of APP By similarity. Interacts with DCLK2. Interacts with TIAM1 and TIAM2 By similarity. Interacts with FGF13; enables the interaction with MAPK13 and may regulate the MAPK8IP2 scaffolding activity.By similarity2 Publications

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    EGFRP005333EBI-722813,EBI-297353
    ERBB2P046263EBI-722813,EBI-641062

    Protein-protein interaction databases

    BioGridi117086. 55 interactions.
    IntActiQ13387. 34 interactions.
    MINTiMINT-111751.
    STRINGi9606.ENSP00000330572.

    Structurei

    3D structure databases

    ProteinModelPortaliQ13387.
    SMRiQ13387. Positions 606-660.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini604 – 66562SH3PROSITE-ProRule annotationAdd
    BLAST
    Domaini677 – 813137PIDPROSITE-ProRule annotationAdd
    BLAST

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni110 – 275166JNK-binding domain (JBD)Add
    BLAST
    Regioni239 – 498260Necessary for interaction with FGF13Add
    BLAST

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi30 – 367Asp/Glu-rich (acidic)
    Compositional biasi85 – 10319Asp/Glu-rich (acidic)Add
    BLAST
    Compositional biasi279 – 29113Ser-richAdd
    BLAST
    Compositional biasi417 – 43418Pro-richAdd
    BLAST
    Compositional biasi469 – 48113Asp/Glu-rich (acidic)Add
    BLAST

    Sequence similaritiesi

    Belongs to the JIP scaffold family.Curated
    Contains 1 PID domain.PROSITE-ProRule annotation
    Contains 1 SH3 domain.PROSITE-ProRule annotation

    Keywords - Domaini

    SH3 domain

    Phylogenomic databases

    eggNOGiNOG296587.
    HOGENOMiHOG000231470.
    HOVERGENiHBG018568.
    InParanoidiQ13387.
    KOiK04435.
    OMAiNETHICV.
    OrthoDBiEOG74J97M.
    PhylomeDBiQ13387.

    Family and domain databases

    Gene3Di2.30.29.30. 1 hit.
    InterProiIPR011993. PH_like_dom.
    IPR006020. PTB/PI_dom.
    IPR001452. SH3_domain.
    [Graphical view]
    PfamiPF00640. PID. 1 hit.
    PF14604. SH3_9. 1 hit.
    [Graphical view]
    SMARTiSM00462. PTB. 1 hit.
    SM00326. SH3. 1 hit.
    [Graphical view]
    PROSITEiPS01179. PID. 1 hit.
    PS50002. SH3. 1 hit.
    [Graphical view]

    Sequences (4)i

    Sequence statusi: Complete.

    This entry describes 4 isoformsi produced by alternative splicing. Align

    Note: Experimental confirmation may be lacking for some isoforms.

    Isoform 1 (identifier: Q13387-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MADRAEMFSL STFHSLSPPG CRPPQDISLE EFDDEDLSEI TDDCGLGLSY    50
    DSDHCEKDSL SLGRSEQPHP ICSFQDDFQE FEMIDDNEEE DDEDEEEEEE 100
    EEEGDGEGQE GGDPGSEAPA PGPLIPSPSV EEPHKHRPTT LRLTTLGAQD 150
    SLNNNGGFDL VRPASWQETA LCSPAPEALR ELPGPLPATD TGPGGAQSPV 200
    RPGCDCEGNR PAEPPAPGGT SPSSDPGIEA DLRSRSSGGR GGRRSSQELS 250
    SPGSDSEDAG GARLGRMISS ISETELELSS DGGSSSSGRS SHLTNSIEEA 300
    SSPASEPEPP REPPRRPAFL PVGPDDTNSE YESGSESEPD LSEDADSPWL 350
    LSNLVSRMIS EGSSPIRCPG QCLSPAPRPP GEPVSPAGGA AQDSQDPEAA 400
    AGPGGVELVD METLCAPPPP APAAPRPGPA QPGPCLFLSN PTRDTITPLW 450
    AAPGRAARPG RACSAACSEE EDEEDDEEEE DAEDSAGSPG GRGTGPSAPR 500
    DASLVYDAVK YTLVVDEHTQ LELVSLRRCA GLGHDSEEDS GGEASEEEAG 550
    AALLGGGQVS GDTSPDSPDL TFSKKFLNVF VNSTSRSSST ESFGLFSCLV 600
    NGEEREQTHR AVFRFIPRHP DELELDVDDP VLVEAEEDDF WFRGFNMRTG 650
    ERGVFPAFYA HAVPGPAKDL LGSKRSPCWV ERFDVQFLGS VEVPCHQGNG 700
    ILCAAMQKIA TARKLTVHLR PPASCDLEIS LRGVKLSLSG GGPEFQRCSH 750
    FFQMKNISFC GCHPRNSCYF GFITKHPLLS RFACHVFVSQ ESMRPVAQSV 800
    GRAFLEYYQE HLAYACPTED IYLE 824
    Length:824
    Mass (Da):87,975
    Last modified:December 5, 2001 - v2
    Checksum:i7EFC8F3BC58E37BB
    GO
    Isoform 2 (identifier: Q13387-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-57: MADRAEMFSL...LSYDSDHCEK → MLPDFPSPSTWAPGLLLPSGPALLSPSVLQ

    Show »
    Length:797
    Mass (Da):84,711
    Checksum:i715D63743DF04E7B
    GO
    Isoform 3 (identifier: Q13387-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-57: MADRAEMFSL...LSYDSDHCEK → MLPDFPSPSTWAPGLLLPSGPALLSPSVLQ
         152-394: Missing.
         415-439: Missing.
         768-768: C → CEAPQGAAFQWERGVDRKRVLQTRGNVQPHLGAGQGAALNRATEGSSTGSEKGEWTPLVIMELTQSVNSC

    Note: Might be artifactual as it is only predicted from a genomic sequence.

    Show »
    Length:598
    Mass (Da):64,934
    Checksum:i863EA918E833DCAE
    GO
    Isoform 4 (identifier: Q13387-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         88-468: Missing.

    Show »
    Length:443
    Mass (Da):49,070
    Checksum:i6340E55966B6EFC3
    GO

    Sequence cautioni

    The sequence CAA16714.1 differs from that shown. Reason: Erroneous initiation.

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti743 – 7431P → L.
    Corresponds to variant rs1140555 [ dbSNP | Ensembl ].
    VAR_049666

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 5757MADRA…DHCEK → MLPDFPSPSTWAPGLLLPSG PALLSPSVLQ in isoform 2 and isoform 3. 1 PublicationVSP_002770Add
    BLAST
    Alternative sequencei88 – 468381Missing in isoform 4. 1 PublicationVSP_002771Add
    BLAST
    Alternative sequencei152 – 394243Missing in isoform 3. CuratedVSP_002772Add
    BLAST
    Alternative sequencei415 – 43925Missing in isoform 3. CuratedVSP_002773Add
    BLAST
    Alternative sequencei768 – 7681C → CEAPQGAAFQWERGVDRKRV LQTRGNVQPHLGAGQGAALN RATEGSSTGSEKGEWTPLVI MELTQSVNSC in isoform 3. CuratedVSP_002774

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF136382 mRNA. Translation: AAF00980.1.
    AF218778 mRNA. Translation: AAF32323.1.
    U62317 Genomic DNA. Translation: AAB03340.1.
    BC009940 mRNA. Translation: AAH09940.2.
    AL021708 mRNA. Translation: CAA16714.1. Different initiation.
    U79261 mRNA. Translation: AAB50207.1.
    RefSeqiNP_036456.1. NM_012324.4. [Q13387-1]
    UniGeneiHs.558180.

    Genome annotation databases

    EnsembliENST00000008876; ENSP00000008876; ENSG00000008735. [Q13387-3]
    GeneIDi23542.
    KEGGihsa:23542.
    UCSCiuc003bmx.3. human. [Q13387-1]
    uc003bmy.3. human. [Q13387-2]

    Polymorphism databases

    DMDMi17433017.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF136382 mRNA. Translation: AAF00980.1 .
    AF218778 mRNA. Translation: AAF32323.1 .
    U62317 Genomic DNA. Translation: AAB03340.1 .
    BC009940 mRNA. Translation: AAH09940.2 .
    AL021708 mRNA. Translation: CAA16714.1 . Different initiation.
    U79261 mRNA. Translation: AAB50207.1 .
    RefSeqi NP_036456.1. NM_012324.4. [Q13387-1 ]
    UniGenei Hs.558180.

    3D structure databases

    ProteinModelPortali Q13387.
    SMRi Q13387. Positions 606-660.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 117086. 55 interactions.
    IntActi Q13387. 34 interactions.
    MINTi MINT-111751.
    STRINGi 9606.ENSP00000330572.

    PTM databases

    PhosphoSitei Q13387.

    Polymorphism databases

    DMDMi 17433017.

    Proteomic databases

    PaxDbi Q13387.
    PRIDEi Q13387.

    Protocols and materials databases

    DNASUi 23542.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000008876 ; ENSP00000008876 ; ENSG00000008735 . [Q13387-3 ]
    GeneIDi 23542.
    KEGGi hsa:23542.
    UCSCi uc003bmx.3. human. [Q13387-1 ]
    uc003bmy.3. human. [Q13387-2 ]

    Organism-specific databases

    CTDi 23542.
    GeneCardsi GC22P051039.
    HGNCi HGNC:6883. MAPK8IP2.
    HPAi HPA034780.
    MIMi 607755. gene.
    neXtProti NX_Q13387.
    PharmGKBi PA30627.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG296587.
    HOGENOMi HOG000231470.
    HOVERGENi HBG018568.
    InParanoidi Q13387.
    KOi K04435.
    OMAi NETHICV.
    OrthoDBi EOG74J97M.
    PhylomeDBi Q13387.

    Enzyme and pathway databases

    SignaLinki Q13387.

    Miscellaneous databases

    GeneWikii MAPK8IP2.
    GenomeRNAii 23542.
    NextBioi 46052.
    PROi Q13387.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q13387.
    Bgeei Q13387.
    CleanExi HS_MAPK8IP2.
    Genevestigatori Q13387.

    Family and domain databases

    Gene3Di 2.30.29.30. 1 hit.
    InterProi IPR011993. PH_like_dom.
    IPR006020. PTB/PI_dom.
    IPR001452. SH3_domain.
    [Graphical view ]
    Pfami PF00640. PID. 1 hit.
    PF14604. SH3_9. 1 hit.
    [Graphical view ]
    SMARTi SM00462. PTB. 1 hit.
    SM00326. SH3. 1 hit.
    [Graphical view ]
    PROSITEi PS01179. PID. 1 hit.
    PS50002. SH3. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "The JIP group of mitogen-activated protein kinase scaffold proteins."
      Yasuda J., Whitmarsh A.J., Cavanagh J., Sharma M., Davis R.J.
      Mol. Cell. Biol. 19:7245-7254(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), INTERACTION WITH JNK1; JNK2; JNK3; MAP2K7; MAP3K10; MAP3K11 AND MAP3K12.
      Tissue: Brain.
    2. "cDNA cloning and mapping of a novel islet-brain/JNK interacting protein."
      Negri S., Oberson A., Steinmann M., Sauser C., Nicod P., Waeber G., Schorderet D.F., Bonny C.
      Genomics 64:324-330(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
      Tissue: Brain and Insulinoma.
    3. "The DNA sequence of human chromosome 22."
      Dunham I., Hunt A.R., Collins J.E., Bruskiewich R., Beare D.M., Clamp M., Smink L.J., Ainscough R., Almeida J.P., Babbage A.K., Bagguley C., Bailey J., Barlow K.F., Bates K.N., Beasley O.P., Bird C.P., Blakey S.E., Bridgeman A.M.
      , Buck D., Burgess J., Burrill W.D., Burton J., Carder C., Carter N.P., Chen Y., Clark G., Clegg S.M., Cobley V.E., Cole C.G., Collier R.E., Connor R., Conroy D., Corby N.R., Coville G.J., Cox A.V., Davis J., Dawson E., Dhami P.D., Dockree C., Dodsworth S.J., Durbin R.M., Ellington A.G., Evans K.L., Fey J.M., Fleming K., French L., Garner A.A., Gilbert J.G.R., Goward M.E., Grafham D.V., Griffiths M.N.D., Hall C., Hall R.E., Hall-Tamlyn G., Heathcott R.W., Ho S., Holmes S., Hunt S.E., Jones M.C., Kershaw J., Kimberley A.M., King A., Laird G.K., Langford C.F., Leversha M.A., Lloyd C., Lloyd D.M., Martyn I.D., Mashreghi-Mohammadi M., Matthews L.H., Mccann O.T., Mcclay J., Mclaren S., McMurray A.A., Milne S.A., Mortimore B.J., Odell C.N., Pavitt R., Pearce A.V., Pearson D., Phillimore B.J.C.T., Phillips S.H., Plumb R.W., Ramsay H., Ramsey Y., Rogers L., Ross M.T., Scott C.E., Sehra H.K., Skuce C.D., Smalley S., Smith M.L., Soderlund C., Spragon L., Steward C.A., Sulston J.E., Swann R.M., Vaudin M., Wall M., Wallis J.M., Whiteley M.N., Willey D.L., Williams L., Williams S.A., Williamson H., Wilmer T.E., Wilming L., Wright C.L., Hubbard T., Bentley D.R., Beck S., Rogers J., Shimizu N., Minoshima S., Kawasaki K., Sasaki T., Asakawa S., Kudoh J., Shintani A., Shibuya K., Yoshizaki Y., Aoki N., Mitsuyama S., Roe B.A., Chen F., Chu L., Crabtree J., Deschamps S., Do A., Do T., Dorman A., Fang F., Fu Y., Hu P., Hua A., Kenton S., Lai H., Lao H.I., Lewis J., Lewis S., Lin S.-P., Loh P., Malaj E., Nguyen T., Pan H., Phan S., Qi S., Qian Y., Ray L., Ren Q., Shaull S., Sloan D., Song L., Wang Q., Wang Y., Wang Z., White J., Willingham D., Wu H., Yao Z., Zhan M., Zhang G., Chissoe S., Murray J., Miller N., Minx P., Fulton R., Johnson D., Bemis G., Bentley D., Bradshaw H., Bourne S., Cordes M., Du Z., Fulton L., Goela D., Graves T., Hawkins J., Hinds K., Kemp K., Latreille P., Layman D., Ozersky P., Rohlfing T., Scheet P., Walker C., Wamsley A., Wohldmann P., Pepin K., Nelson J., Korf I., Bedell J.A., Hillier L.W., Mardis E., Waterston R., Wilson R., Emanuel B.S., Shaikh T., Kurahashi H., Saitta S., Budarf M.L., McDermid H.E., Johnson A., Wong A.C.C., Morrow B.E., Edelmann L., Kim U.J., Shizuya H., Simon M.I., Dumanski J.P., Peyrard M., Kedra D., Seroussi E., Fransson I., Tapia I., Bruder C.E., O'Brien K.P., Wilkinson P., Bodenteich A., Hartman K., Hu X., Khan A.S., Lane L., Tilahun Y., Wright H.
      Nature 402:489-495(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. Adams M.D.
      Submitted (JUN-1996) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM 3).
    5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
      Tissue: Brain.
    6. "Reevaluating human gene annotation: a second-generation analysis of chromosome 22."
      Collins J.E., Goward M.E., Cole C.G., Smink L.J., Huckle E.J., Knowles S., Bye J.M., Beare D.M., Dunham I.
      Genome Res. 13:27-36(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 289-824.
    7. "Large-scale concatenation cDNA sequencing."
      Yu W., Andersson B., Worley K.C., Muzny D.M., Ding Y., Liu W., Ricafrente J.Y., Wentland M.A., Lennon G., Gibbs R.A.
      Genome Res. 7:353-358(1997) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 599-824 (ISOFORM 1).
      Tissue: Brain.
    8. "Fibroblast growth factor homologous factors are intracellular signaling proteins."
      Schoorlemmer J., Goldfarb M.
      Curr. Biol. 11:793-797(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH FGF13 AND MAPK13.

    Entry informationi

    Entry nameiJIP2_HUMAN
    AccessioniPrimary (citable) accession number: Q13387
    Secondary accession number(s): Q96G62
    , Q99771, Q9NZ59, Q9UKQ4
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: December 5, 2001
    Last sequence update: December 5, 2001
    Last modified: October 1, 2014
    This is version 128 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 22
      Human chromosome 22: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3