Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q13387

- JIP2_HUMAN

UniProt

Q13387 - JIP2_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

C-Jun-amino-terminal kinase-interacting protein 2

Gene

MAPK8IP2

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

The JNK-interacting protein (JIP) group of scaffold proteins selectively mediates JNK signaling by aggregating specific components of the MAPK cascade to form a functional JNK signaling module. JIP2 inhibits IL1 beta-induced apoptosis in insulin-secreting cells. May function as a regulator of vesicle transport, through interactions with the JNK-signaling components and motor proteins (By similarity).By similarity

GO - Molecular functioni

  1. beta-amyloid binding Source: UniProtKB
  2. kinesin binding Source: UniProtKB
  3. MAP-kinase scaffold activity Source: UniProtKB
  4. protein kinase activator activity Source: MGI
  5. protein kinase binding Source: UniProtKB
  6. structural molecule activity Source: ProtInc

GO - Biological processi

  1. behavioral fear response Source: BHF-UCL
  2. dendrite morphogenesis Source: BHF-UCL
  3. MAPK cascade Source: MGI
  4. nonassociative learning Source: BHF-UCL
  5. positive regulation of protein kinase activity Source: GOC
  6. positive regulation of signal transduction Source: GOC
  7. regulation of alpha-amino-3-hydroxy-5-methyl-4-isoxazole propionate selective glutamate receptor activity Source: BHF-UCL
  8. regulation of excitatory postsynaptic membrane potential Source: BHF-UCL
  9. regulation of JNK cascade Source: UniProtKB
  10. regulation of N-methyl-D-aspartate selective glutamate receptor activity Source: BHF-UCL
  11. regulation of receptor activity Source: BHF-UCL
  12. regulation of synaptic transmission, glutamatergic Source: BHF-UCL
  13. signal complex assembly Source: ProtInc
  14. social behavior Source: BHF-UCL
Complete GO annotation...

Enzyme and pathway databases

SignaLinkiQ13387.

Names & Taxonomyi

Protein namesi
Recommended name:
C-Jun-amino-terminal kinase-interacting protein 2
Short name:
JIP-2
Short name:
JNK-interacting protein 2
Alternative name(s):
Islet-brain-2
Short name:
IB-2
JNK MAP kinase scaffold protein 2
Mitogen-activated protein kinase 8-interacting protein 2
Gene namesi
Name:MAPK8IP2
Synonyms:IB2, JIP2, PRKM8IPL
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 22

Organism-specific databases

HGNCiHGNC:6883. MAPK8IP2.

Subcellular locationi

Cytoplasm
Note: Accumulates in cell surface projections.

GO - Cellular componenti

  1. cytoplasm Source: UniProtKB
  2. neuronal postsynaptic density Source: BHF-UCL
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA30627.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 824824C-Jun-amino-terminal kinase-interacting protein 2PRO_0000220631Add
BLAST

Proteomic databases

PaxDbiQ13387.
PRIDEiQ13387.

PTM databases

PhosphoSiteiQ13387.

Expressioni

Tissue specificityi

Expressed mainly in the brain and pancreas, including insulin-secreting cells. In the nervous system, more abundantly expressed in the cerebellum, pituitary gland, occipital lobe and the amygdala. Also expressed in fetal brain. Very low levels found in uterus, ovary, prostate, colon, testis, adrenal gland, thyroid gland and salivary gland.

Gene expression databases

BgeeiQ13387.
CleanExiHS_MAPK8IP2.
ExpressionAtlasiQ13387. baseline and differential.
GenevestigatoriQ13387.

Organism-specific databases

HPAiHPA034780.

Interactioni

Subunit structurei

Forms homo- or heterooligomeric complexes. Binds specific components of the JNK signaling pathway namely JNK1, JNK2, JNK3, MAP2K7, MAP3K10, MAP3K11, MAP3K12 and MAPK13. Also binds the proline-rich domain-containing splice variant of apolipoprotein E receptor 2 (ApoER2). Binds the cytoplasmic tails of LRP1 and LRP2 (Megalin). Binds the TPR motif-containing C-terminal of kinesin light chain, Klc1, pre-assembled MAPK8IP1 scaffolding complexes are then transported as a cargo of kinesin, to the required subcellular location (By similarity). Interacts with the cytoplasmic domain of APP (By similarity). Interacts with DCLK2. Interacts with TIAM1 and TIAM2 (By similarity). Interacts with FGF13; enables the interaction with MAPK13 and may regulate the MAPK8IP2 scaffolding activity.By similarity2 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
EGFRP005334EBI-722813,EBI-297353
ERBB2P046263EBI-722813,EBI-641062

Protein-protein interaction databases

BioGridi117086. 55 interactions.
IntActiQ13387. 34 interactions.
MINTiMINT-111751.
STRINGi9606.ENSP00000330572.

Structurei

3D structure databases

ProteinModelPortaliQ13387.
SMRiQ13387. Positions 606-660, 672-803.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini604 – 66562SH3PROSITE-ProRule annotationAdd
BLAST
Domaini677 – 813137PIDPROSITE-ProRule annotationAdd
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni110 – 275166JNK-binding domain (JBD)Add
BLAST
Regioni239 – 498260Necessary for interaction with FGF13Add
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi30 – 367Asp/Glu-rich (acidic)
Compositional biasi85 – 10319Asp/Glu-rich (acidic)Add
BLAST
Compositional biasi279 – 29113Ser-richAdd
BLAST
Compositional biasi417 – 43418Pro-richAdd
BLAST
Compositional biasi469 – 48113Asp/Glu-rich (acidic)Add
BLAST

Sequence similaritiesi

Belongs to the JIP scaffold family.Curated
Contains 1 PID domain.PROSITE-ProRule annotation
Contains 1 SH3 domain.PROSITE-ProRule annotation

Keywords - Domaini

SH3 domain

Phylogenomic databases

eggNOGiNOG296587.
GeneTreeiENSGT00390000003908.
HOGENOMiHOG000231470.
HOVERGENiHBG018568.
InParanoidiQ13387.
KOiK04435.
OMAiNETHICV.
OrthoDBiEOG74J97M.
PhylomeDBiQ13387.

Family and domain databases

Gene3Di2.30.29.30. 1 hit.
InterProiIPR011993. PH_like_dom.
IPR006020. PTB/PI_dom.
IPR001452. SH3_domain.
[Graphical view]
PfamiPF00640. PID. 1 hit.
PF14604. SH3_9. 1 hit.
[Graphical view]
SMARTiSM00462. PTB. 1 hit.
SM00326. SH3. 1 hit.
[Graphical view]
PROSITEiPS01179. PID. 1 hit.
PS50002. SH3. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. Align

Note: Experimental confirmation may be lacking for some isoforms.

Isoform 1 (identifier: Q13387-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MADRAEMFSL STFHSLSPPG CRPPQDISLE EFDDEDLSEI TDDCGLGLSY
60 70 80 90 100
DSDHCEKDSL SLGRSEQPHP ICSFQDDFQE FEMIDDNEEE DDEDEEEEEE
110 120 130 140 150
EEEGDGEGQE GGDPGSEAPA PGPLIPSPSV EEPHKHRPTT LRLTTLGAQD
160 170 180 190 200
SLNNNGGFDL VRPASWQETA LCSPAPEALR ELPGPLPATD TGPGGAQSPV
210 220 230 240 250
RPGCDCEGNR PAEPPAPGGT SPSSDPGIEA DLRSRSSGGR GGRRSSQELS
260 270 280 290 300
SPGSDSEDAG GARLGRMISS ISETELELSS DGGSSSSGRS SHLTNSIEEA
310 320 330 340 350
SSPASEPEPP REPPRRPAFL PVGPDDTNSE YESGSESEPD LSEDADSPWL
360 370 380 390 400
LSNLVSRMIS EGSSPIRCPG QCLSPAPRPP GEPVSPAGGA AQDSQDPEAA
410 420 430 440 450
AGPGGVELVD METLCAPPPP APAAPRPGPA QPGPCLFLSN PTRDTITPLW
460 470 480 490 500
AAPGRAARPG RACSAACSEE EDEEDDEEEE DAEDSAGSPG GRGTGPSAPR
510 520 530 540 550
DASLVYDAVK YTLVVDEHTQ LELVSLRRCA GLGHDSEEDS GGEASEEEAG
560 570 580 590 600
AALLGGGQVS GDTSPDSPDL TFSKKFLNVF VNSTSRSSST ESFGLFSCLV
610 620 630 640 650
NGEEREQTHR AVFRFIPRHP DELELDVDDP VLVEAEEDDF WFRGFNMRTG
660 670 680 690 700
ERGVFPAFYA HAVPGPAKDL LGSKRSPCWV ERFDVQFLGS VEVPCHQGNG
710 720 730 740 750
ILCAAMQKIA TARKLTVHLR PPASCDLEIS LRGVKLSLSG GGPEFQRCSH
760 770 780 790 800
FFQMKNISFC GCHPRNSCYF GFITKHPLLS RFACHVFVSQ ESMRPVAQSV
810 820
GRAFLEYYQE HLAYACPTED IYLE
Length:824
Mass (Da):87,975
Last modified:December 5, 2001 - v2
Checksum:i7EFC8F3BC58E37BB
GO
Isoform 2 (identifier: Q13387-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-57: MADRAEMFSL...LSYDSDHCEK → MLPDFPSPSTWAPGLLLPSGPALLSPSVLQ

Show »
Length:797
Mass (Da):84,711
Checksum:i715D63743DF04E7B
GO
Isoform 3 (identifier: Q13387-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-57: MADRAEMFSL...LSYDSDHCEK → MLPDFPSPSTWAPGLLLPSGPALLSPSVLQ
     152-394: Missing.
     415-439: Missing.
     768-768: C → CEAPQGAAFQWERGVDRKRVLQTRGNVQPHLGAGQGAALNRATEGSSTGSEKGEWTPLVIMELTQSVNSC

Note: Might be artifactual as it is only predicted from a genomic sequence.

Show »
Length:598
Mass (Da):64,934
Checksum:i863EA918E833DCAE
GO
Isoform 4 (identifier: Q13387-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     88-468: Missing.

Show »
Length:443
Mass (Da):49,070
Checksum:i6340E55966B6EFC3
GO

Sequence cautioni

The sequence CAA16714.1 differs from that shown. Reason: Erroneous initiation.

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti743 – 7431P → L.
Corresponds to variant rs1140555 [ dbSNP | Ensembl ].
VAR_049666

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 5757MADRA…DHCEK → MLPDFPSPSTWAPGLLLPSG PALLSPSVLQ in isoform 2 and isoform 3. 1 PublicationVSP_002770Add
BLAST
Alternative sequencei88 – 468381Missing in isoform 4. 1 PublicationVSP_002771Add
BLAST
Alternative sequencei152 – 394243Missing in isoform 3. CuratedVSP_002772Add
BLAST
Alternative sequencei415 – 43925Missing in isoform 3. CuratedVSP_002773Add
BLAST
Alternative sequencei768 – 7681C → CEAPQGAAFQWERGVDRKRV LQTRGNVQPHLGAGQGAALN RATEGSSTGSEKGEWTPLVI MELTQSVNSC in isoform 3. CuratedVSP_002774

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF136382 mRNA. Translation: AAF00980.1.
AF218778 mRNA. Translation: AAF32323.1.
U62317 Genomic DNA. Translation: AAB03340.1.
BC009940 mRNA. Translation: AAH09940.2.
AL021708 mRNA. Translation: CAA16714.1. Different initiation.
U79261 mRNA. Translation: AAB50207.1.
CCDSiCCDS74886.1. [Q13387-1]
RefSeqiNP_036456.1. NM_012324.4. [Q13387-1]
UniGeneiHs.558180.

Genome annotation databases

EnsembliENST00000008876; ENSP00000008876; ENSG00000008735. [Q13387-2]
ENST00000329492; ENSP00000330572; ENSG00000008735. [Q13387-1]
GeneIDi23542.
KEGGihsa:23542.
UCSCiuc003bmx.3. human. [Q13387-1]
uc003bmy.3. human. [Q13387-2]

Polymorphism databases

DMDMi17433017.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF136382 mRNA. Translation: AAF00980.1 .
AF218778 mRNA. Translation: AAF32323.1 .
U62317 Genomic DNA. Translation: AAB03340.1 .
BC009940 mRNA. Translation: AAH09940.2 .
AL021708 mRNA. Translation: CAA16714.1 . Different initiation.
U79261 mRNA. Translation: AAB50207.1 .
CCDSi CCDS74886.1. [Q13387-1 ]
RefSeqi NP_036456.1. NM_012324.4. [Q13387-1 ]
UniGenei Hs.558180.

3D structure databases

ProteinModelPortali Q13387.
SMRi Q13387. Positions 606-660, 672-803.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 117086. 55 interactions.
IntActi Q13387. 34 interactions.
MINTi MINT-111751.
STRINGi 9606.ENSP00000330572.

PTM databases

PhosphoSitei Q13387.

Polymorphism databases

DMDMi 17433017.

Proteomic databases

PaxDbi Q13387.
PRIDEi Q13387.

Protocols and materials databases

DNASUi 23542.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000008876 ; ENSP00000008876 ; ENSG00000008735 . [Q13387-2 ]
ENST00000329492 ; ENSP00000330572 ; ENSG00000008735 . [Q13387-1 ]
GeneIDi 23542.
KEGGi hsa:23542.
UCSCi uc003bmx.3. human. [Q13387-1 ]
uc003bmy.3. human. [Q13387-2 ]

Organism-specific databases

CTDi 23542.
GeneCardsi GC22P051039.
HGNCi HGNC:6883. MAPK8IP2.
HPAi HPA034780.
MIMi 607755. gene.
neXtProti NX_Q13387.
PharmGKBi PA30627.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG296587.
GeneTreei ENSGT00390000003908.
HOGENOMi HOG000231470.
HOVERGENi HBG018568.
InParanoidi Q13387.
KOi K04435.
OMAi NETHICV.
OrthoDBi EOG74J97M.
PhylomeDBi Q13387.

Enzyme and pathway databases

SignaLinki Q13387.

Miscellaneous databases

GeneWikii MAPK8IP2.
GenomeRNAii 23542.
NextBioi 46052.
PROi Q13387.
SOURCEi Search...

Gene expression databases

Bgeei Q13387.
CleanExi HS_MAPK8IP2.
ExpressionAtlasi Q13387. baseline and differential.
Genevestigatori Q13387.

Family and domain databases

Gene3Di 2.30.29.30. 1 hit.
InterProi IPR011993. PH_like_dom.
IPR006020. PTB/PI_dom.
IPR001452. SH3_domain.
[Graphical view ]
Pfami PF00640. PID. 1 hit.
PF14604. SH3_9. 1 hit.
[Graphical view ]
SMARTi SM00462. PTB. 1 hit.
SM00326. SH3. 1 hit.
[Graphical view ]
PROSITEi PS01179. PID. 1 hit.
PS50002. SH3. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "The JIP group of mitogen-activated protein kinase scaffold proteins."
    Yasuda J., Whitmarsh A.J., Cavanagh J., Sharma M., Davis R.J.
    Mol. Cell. Biol. 19:7245-7254(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), INTERACTION WITH JNK1; JNK2; JNK3; MAP2K7; MAP3K10; MAP3K11 AND MAP3K12.
    Tissue: Brain.
  2. "cDNA cloning and mapping of a novel islet-brain/JNK interacting protein."
    Negri S., Oberson A., Steinmann M., Sauser C., Nicod P., Waeber G., Schorderet D.F., Bonny C.
    Genomics 64:324-330(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
    Tissue: Brain and Insulinoma.
  3. "The DNA sequence of human chromosome 22."
    Dunham I., Hunt A.R., Collins J.E., Bruskiewich R., Beare D.M., Clamp M., Smink L.J., Ainscough R., Almeida J.P., Babbage A.K., Bagguley C., Bailey J., Barlow K.F., Bates K.N., Beasley O.P., Bird C.P., Blakey S.E., Bridgeman A.M.
    , Buck D., Burgess J., Burrill W.D., Burton J., Carder C., Carter N.P., Chen Y., Clark G., Clegg S.M., Cobley V.E., Cole C.G., Collier R.E., Connor R., Conroy D., Corby N.R., Coville G.J., Cox A.V., Davis J., Dawson E., Dhami P.D., Dockree C., Dodsworth S.J., Durbin R.M., Ellington A.G., Evans K.L., Fey J.M., Fleming K., French L., Garner A.A., Gilbert J.G.R., Goward M.E., Grafham D.V., Griffiths M.N.D., Hall C., Hall R.E., Hall-Tamlyn G., Heathcott R.W., Ho S., Holmes S., Hunt S.E., Jones M.C., Kershaw J., Kimberley A.M., King A., Laird G.K., Langford C.F., Leversha M.A., Lloyd C., Lloyd D.M., Martyn I.D., Mashreghi-Mohammadi M., Matthews L.H., Mccann O.T., Mcclay J., Mclaren S., McMurray A.A., Milne S.A., Mortimore B.J., Odell C.N., Pavitt R., Pearce A.V., Pearson D., Phillimore B.J.C.T., Phillips S.H., Plumb R.W., Ramsay H., Ramsey Y., Rogers L., Ross M.T., Scott C.E., Sehra H.K., Skuce C.D., Smalley S., Smith M.L., Soderlund C., Spragon L., Steward C.A., Sulston J.E., Swann R.M., Vaudin M., Wall M., Wallis J.M., Whiteley M.N., Willey D.L., Williams L., Williams S.A., Williamson H., Wilmer T.E., Wilming L., Wright C.L., Hubbard T., Bentley D.R., Beck S., Rogers J., Shimizu N., Minoshima S., Kawasaki K., Sasaki T., Asakawa S., Kudoh J., Shintani A., Shibuya K., Yoshizaki Y., Aoki N., Mitsuyama S., Roe B.A., Chen F., Chu L., Crabtree J., Deschamps S., Do A., Do T., Dorman A., Fang F., Fu Y., Hu P., Hua A., Kenton S., Lai H., Lao H.I., Lewis J., Lewis S., Lin S.-P., Loh P., Malaj E., Nguyen T., Pan H., Phan S., Qi S., Qian Y., Ray L., Ren Q., Shaull S., Sloan D., Song L., Wang Q., Wang Y., Wang Z., White J., Willingham D., Wu H., Yao Z., Zhan M., Zhang G., Chissoe S., Murray J., Miller N., Minx P., Fulton R., Johnson D., Bemis G., Bentley D., Bradshaw H., Bourne S., Cordes M., Du Z., Fulton L., Goela D., Graves T., Hawkins J., Hinds K., Kemp K., Latreille P., Layman D., Ozersky P., Rohlfing T., Scheet P., Walker C., Wamsley A., Wohldmann P., Pepin K., Nelson J., Korf I., Bedell J.A., Hillier L.W., Mardis E., Waterston R., Wilson R., Emanuel B.S., Shaikh T., Kurahashi H., Saitta S., Budarf M.L., McDermid H.E., Johnson A., Wong A.C.C., Morrow B.E., Edelmann L., Kim U.J., Shizuya H., Simon M.I., Dumanski J.P., Peyrard M., Kedra D., Seroussi E., Fransson I., Tapia I., Bruder C.E., O'Brien K.P., Wilkinson P., Bodenteich A., Hartman K., Hu X., Khan A.S., Lane L., Tilahun Y., Wright H.
    Nature 402:489-495(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. Adams M.D.
    Submitted (JUN-1996) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM 3).
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
    Tissue: Brain.
  6. "Reevaluating human gene annotation: a second-generation analysis of chromosome 22."
    Collins J.E., Goward M.E., Cole C.G., Smink L.J., Huckle E.J., Knowles S., Bye J.M., Beare D.M., Dunham I.
    Genome Res. 13:27-36(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 289-824.
  7. "Large-scale concatenation cDNA sequencing."
    Yu W., Andersson B., Worley K.C., Muzny D.M., Ding Y., Liu W., Ricafrente J.Y., Wentland M.A., Lennon G., Gibbs R.A.
    Genome Res. 7:353-358(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 599-824 (ISOFORM 1).
    Tissue: Brain.
  8. "Fibroblast growth factor homologous factors are intracellular signaling proteins."
    Schoorlemmer J., Goldfarb M.
    Curr. Biol. 11:793-797(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH FGF13 AND MAPK13.

Entry informationi

Entry nameiJIP2_HUMAN
AccessioniPrimary (citable) accession number: Q13387
Secondary accession number(s): Q96G62
, Q99771, Q9NZ59, Q9UKQ4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 5, 2001
Last sequence update: December 5, 2001
Last modified: October 29, 2014
This is version 129 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 22
    Human chromosome 22: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3