Q13387 (JIP2_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 101.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: C-Jun-amino-terminal kinase-interacting protein 2 Short name=JIP-2 Short name=JNK-interacting protein 2 Alternative name(s): Islet-brain-2 Short name=IB-2 JNK MAP kinase scaffold protein 2 Mitogen-activated protein kinase 8-interacting protein 2 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 824 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | The JNK-interacting protein (JIP) group of scaffold proteins selectively mediates JNK signaling by aggregating specific components of the MAPK cascade to form a functional JNK signaling module. JIP2 inhibits IL1 beta-induced apoptosis in insulin-secreting cells. May function as a regulator of vesicle transport, through interations with the JNK-signaling components and motor proteins By similarity. |
| Subunit structure | Forms homo- or heterooligomeric complexes. Binds specific components of the JNK signaling pathway namely JNK, MAPKK7 and MLK2, MLK3 and DLK. Also binds the proline-rich domain-containing splice variant of apolipoprotein E receptor 2 (ApoER2). Binds the cytoplasmic tails of LRP1 and LRP2 (Megalin). Binds the TPR motif-containing C-terminal of kinesin light chain, Klc1, pre-assembled MAPK8IP1 scaffolding complexes are then transported as a cargo of kinesin, to the required subcellular location By similarity. Interacts with the cytoplasmic domain of APP By similarity. Interacts with DCLK2 By similarity. |
| Subcellular location | Cytoplasm. Note: Accumulates in cell surface projections. |
| Tissue specificity | Expressed mainly in the brain and pancreas, including insulin-secreting cells. In the nervous system, more abundantly expressed in the cerebellum, pituitary gland, occipital lobe and the amygdala. Also expressed in fetal brain. Very low levels found in uterus, ovary, prostate, colon, testis, adrenal gland, thyroid gland and salivary gland. |
| Sequence similarities | Belongs to the JIP scaffold family. Contains 1 PID domain. Contains 1 SH3 domain. |
| Sequence caution | The sequence CAA16714.1 differs from that shown. Reason: Erroneous initiation. |
Ontologies
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] Note: Experimental confirmation may be lacking for some isoforms. | ||||||
| Isoform 1 (identifier: Q13387-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q13387-2) The sequence of this isoform differs from the canonical sequence as follows: 1-57: MADRAEMFSL...LSYDSDHCEK → MLPDFPSPSTWAPGLLLPSGPALLSPSVLQ | ||||||
| Isoform 3 (identifier: Q13387-3) The sequence of this isoform differs from the canonical sequence as follows: 1-57: MADRAEMFSL...LSYDSDHCEK → MLPDFPSPSTWAPGLLLPSGPALLSPSVLQ 152-394: Missing. 415-439: Missing. 768-768: C → CEAPQGAAFQWERGVDRKRVLQTRGNVQPHLGAGQGAALNRATEGSSTGSEKGEWTPLVIMELTQSVNSC | ||||||
| Note: Might be artifactual as it is only predicted from a genomic sequence. | ||||||
| Isoform 4 (identifier: Q13387-4) The sequence of this isoform differs from the canonical sequence as follows: 88-468: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 824 | 824 | C-Jun-amino-terminal kinase-interacting protein 2 | PRO_0000220631 | |||||
Regions | |||||||||
| Domain | 604 – 665 | 62 | SH3 | ||||||
| Domain | 677 – 813 | 137 | PID | ||||||
| Region | 110 – 275 | 166 | JNK-binding domain (JBD) | ||||||
| Compositional bias | 30 – 36 | 7 | Asp/Glu-rich (acidic) | ||||||
| Compositional bias | 85 – 103 | 19 | Asp/Glu-rich (acidic) | ||||||
| Compositional bias | 279 – 291 | 13 | Ser-rich | ||||||
| Compositional bias | 417 – 434 | 18 | Pro-rich | ||||||
| Compositional bias | 469 – 481 | 13 | Asp/Glu-rich (acidic) | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 57 | 57 | MADRA…DHCEK → MLPDFPSPSTWAPGLLLPSG PALLSPSVLQ in isoform 2 and isoform 3. | VSP_002770 | |||||
| Alternative sequence | 88 – 468 | 381 | Missing in isoform 4. | VSP_002771 | |||||
| Alternative sequence | 152 – 394 | 243 | Missing in isoform 3. | VSP_002772 | |||||
| Alternative sequence | 415 – 439 | 25 | Missing in isoform 3. | VSP_002773 | |||||
| Alternative sequence | 768 | 1 | C → CEAPQGAAFQWERGVDRKRV LQTRGNVQPHLGAGQGAALN RATEGSSTGSEKGEWTPLVI MELTQSVNSC in isoform 3. | VSP_002774 | |||||
| Natural variant | 743 | 1 | P → L. Corresponds to variant rs1140555 [ dbSNP | Ensembl ]. | VAR_049666 | |||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "The JIP group of mitogen-activated protein kinase scaffold proteins." Yasuda J., Whitmarsh A.J., Cavanagh J., Sharma M., Davis R.J. Mol. Cell. Biol. 19:7245-7254(1999) [PubMed: 10490659] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Brain. |
| [2] | "cDNA cloning and mapping of a novel islet-brain/JNK interacting protein." Negri S., Oberson A., Steinmann M., Sauser C., Nicod P., Waeber G., Schorderet D.F., Bonny C. Genomics 64:324-330(2000) [PubMed: 10756100] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2). Tissue: Brain and Insulinoma. |
| [3] | "The DNA sequence of human chromosome 22." Dunham I., Hunt A.R., Collins J.E., Bruskiewich R., Beare D.M., Clamp M., Smink L.J., Ainscough R., Almeida J.P., Babbage A.K., Bagguley C., Bailey J., Barlow K.F., Bates K.N., Beasley O.P., Bird C.P., Blakey S.E., Bridgeman A.M. Wright H.Nature 402:489-495(1999) [PubMed: 10591208] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | Adams M.D. Submitted (JUN-1996) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM 3). |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4). Tissue: Brain. |
| [6] | "Reevaluating human gene annotation: a second-generation analysis of chromosome 22." Collins J.E., Goward M.E., Cole C.G., Smink L.J., Huckle E.J., Knowles S., Bye J.M., Beare D.M., Dunham I. Genome Res. 13:27-36(2003) [PubMed: 12529303] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 289-824. |
| [7] | "Large-scale concatenation cDNA sequencing." Yu W., Andersson B., Worley K.C., Muzny D.M., Ding Y., Liu W., Ricafrente J.Y., Wentland M.A., Lennon G., Gibbs R.A. Genome Res. 7:353-358(1997) [PubMed: 9110174] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 599-824 (ISOFORM 1). Tissue: Brain. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF136382 mRNA. Translation: AAF00980.1. AF218778 mRNA. Translation: AAF32323.1. U62317 Genomic DNA. Translation: AAB03340.1. BC009940 mRNA. Translation: AAH09940.2. AL021708 mRNA. Translation: CAA16714.1. Different initiation. U79261 mRNA. Translation: AAB50207.1. |
| IPI | IPI00031777. IPI00221227. IPI00221228. IPI00221229. |
| RefSeq | NP_036456.1. NM_012324.3. NP_057515.1. NM_016431.3. |
| UniGene | Hs.558180. |
3D structure databases | |
| ProteinModelPortal | Q13387. |
| SMR | Q13387. Positions 606-814. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q13387. 1 interaction. |
| MINT | MINT-111751. |
| STRING | Q13387. |
PTM databases | |
| PhosphoSite | Q13387. |
Polymorphism databases | |
| DMDM | 17433017. |
Proteomic databases | |
| PRIDE | Q13387. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000329492; ENSP00000330572; ENSG00000008735. |
| GeneID | 23542. |
| KEGG | hsa:23542. |
Organism-specific databases | |
| CTD | 23542. |
| GeneCards | GC22P051039. |
| H-InvDB | HIX0027837. |
| HGNC | HGNC:6883. MAPK8IP2. |
| HPA | HPA034780. |
| MIM | 607755. gene. |
| neXtProt | NX_Q13387. |
| PharmGKB | PA30627. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | prNOG11185. |
| HOGENOM | HBG713638. |
| HOVERGEN | HBG018568. |
| InParanoid | Q13387. |
Gene expression databases | |
| ArrayExpress | Q13387. |
| Bgee | Q13387. |
| CleanEx | HS_MAPK8IP2. |
| Genevestigator | Q13387. |
| GermOnline | ENSG00000008735. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR011993. PH_type. IPR006020. PTyr_interaction_dom. IPR001452. SH3_domain. [Graphical view] |
| Gene3D | G3DSA:2.30.29.30. PH_type. 1 hit. |
| KO | K04435. |
| Pfam | PF00640. PID. 1 hit. PF00018. SH3_1. 1 hit. [Graphical view] |
| SMART | SM00462. PTB. 1 hit. SM00326. SH3. 1 hit. [Graphical view] |
| SUPFAM | SSF50044. SH3. 1 hit. |
| PROSITE | PS01179. PID. 1 hit. PS50002. SH3. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 46052. |
| SOURCE | Search... |
Entry information
| Entry name | JIP2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q13387 Secondary accession number(s): Q96G62 Q9UKQ4 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 22 Human chromosome 22: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with