Q13362 (2A5G_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 132.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit gamma isoform Alternative name(s): PP2A B subunit isoform B'-gamma PP2A B subunit isoform B56-gamma PP2A B subunit isoform PR61-gamma PP2A B subunit isoform R5-gamma Renal carcinoma antigen NY-REN-29 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 524 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | The B regulatory subunit might modulate substrate selectivity and catalytic activity, and also might direct the localization of the catalytic enzyme to a particular subcellular compartment. The PP2A-PPP2R5C holoenzyme may specifically dephosphorylate and activate TP53 and play a role in DNA damage-induced inhibition of cell proliferation. PP2A-PPP2R5C may also regulate the ERK signaling pathway through ERK dephosphorylation. Ref.12 Ref.14 |
| Subunit structure | PP2A consists of a common heterodimeric core enzyme, composed of PPP2CA a 36 kDa catalytic subunit (subunit C) and PPP2R1A a 65 kDa constant regulatory subunit (PR65 or subunit A), that associates with a variety of regulatory subunits. Proteins that associate with the core dimer include three families of regulatory subunits B (the R2/B/PR55/B55, R3/B''/PR72/PR130/PR59 and R5/B'/B56 families), the 48 kDa variable regulatory subunit, viral proteins, and cell signaling molecules. Interacts with PPP2CA AND PPP2R1A; the interaction is direct. Interacts with SGOL1; the interaction is direct. Isoform 1 and isoform 2 interact with TP53 (phosphorylated at Ser-15 by ATM); increased upon DNA damage it drives PP2A-mediated dephosphorylation of TP53 at Thr-55. Interacts with IER3 and/or ERK kinases; regulates ERK dephosphorylation. Ref.11 Ref.12 Ref.13 Ref.14 Ref.15 |
| Subcellular location | |
| Tissue specificity | Highest levels in heart, skeletal muscle and brain. Lower levels in pancreas, kidney, lung and placenta. Very low levels in liver. |
| Induction | Up-regulated upon DNA damage. Ref.14 |
| Post-translational modification | Isoform Gamma-3 is phosphorylated on serine residues. Isoform Gamma-1 phosphorylation by ERK2 is IER3-dependent and inhibits ERK dephosphorylation by PP2A-PPP2R5C. Ref.9 Ref.12 |
| Sequence similarities | Belongs to the phosphatase 2A regulatory subunit B56 family. |
| Sequence caution | The sequence AAC50387.1 differs from that shown. Reason: Erroneous initiation. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| CHEK2 | O96017 | 4 | EBI-1266176,EBI-1180783 | |
| PPP2R1A | P30153 | 3 | EBI-1266170,EBI-302388 |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform Gamma-3 (identifier: Q13362-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform Gamma-1 (identifier: Q13362-2) The sequence of this isoform differs from the canonical sequence as follows: 443-524: YTVYSQASTM...ADELASQDGR → VLKKRIT | ||||||
| Isoform Gamma-2 (identifier: Q13362-3) The sequence of this isoform differs from the canonical sequence as follows: 443-481: Missing. | ||||||
| Isoform 4 (identifier: Q13362-4) The sequence of this isoform differs from the canonical sequence as follows: 1-31: MLTCNKAGSRMVVDAANSNGPFQPVVLLHIR → MPNKNKKEKE...RELQKLPSLK 443-481: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 524 | 524 | Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit gamma isoform | PRO_0000071457 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Motif | 416 – 422 | 7 | Nuclear localization signal Potential | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 497 | 1 | Phosphoserine By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 31 | 31 | MLTCN…LLHIR → MPNKNKKEKESPKAGKSGKS SKEGQDTVESEQISVRKNSL VAVPSTVSAKIKVPVSQPIV KKDKRQNSSRFSASNNRELQ KLPSLK in isoform 4. | VSP_043645 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 443 – 524 | 82 | YTVYS…SQDGR → VLKKRIT in isoform Gamma-1. | VSP_005112 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 443 – 481 | 39 | Missing in isoform Gamma-2 and isoform 4. | VSP_005113 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 515 | 1 | A → P. Corresponds to variant rs3742424 [ dbSNP | Ensembl ]. | VAR_051745 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 494 | 1 | R → L in AAC50387. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 40 – 48 | 9 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 55 – 58 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 59 – 62 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 63 – 80 | 18 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 83 – 85 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 91 – 103 | 13 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 115 – 118 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 120 – 122 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 131 – 146 | 16 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 152 – 155 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 156 – 158 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 161 – 170 | 10 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 176 – 192 | 17 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 194 – 196 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 197 – 212 | 16 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 213 – 215 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 221 – 233 | 13 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 241 – 249 | 9 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 252 – 255 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 258 – 262 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 264 – 277 | 14 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 279 – 281 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 282 – 291 | 10 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 301 – 313 | 13 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 317 – 335 | 19 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 340 – 347 | 8 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 348 – 351 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 353 – 361 | 9 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 363 – 366 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 367 – 369 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 372 – 377 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 384 – 398 | 15 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 409 – 430 | 22 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Identification of a novel protein phosphatase 2A regulatory subunit highly expressed in muscle." Tehrani M.A., Mumby M.C., Kamibayashi C. J. Biol. Chem. 271:5164-5170(1996) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM GAMMA-3). Tissue: Umbilical vein. |
| [2] | "The variable subunit associated with protein phosphatase 2A0 defines a novel multimember family of regulatory subunits." Zolnierowicz S., van Hoof C., Andjelkovic N., Cron P., Stevens I., Merlevede W., Goris J., Hemmings B.A. Biochem. J. 317:187-194(1996) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM GAMMA-1). Tissue: Fetal retina. |
| [3] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4). Tissue: Hippocampus. |
| [4] | "Human protein factory for converting the transcriptome into an in vitro-expressed proteome." Goshima N., Kawamura Y., Fukumoto A., Miura A., Honma R., Satoh R., Wakamatsu A., Yamamoto J., Kimura K., Nishikawa T., Andoh T., Iida Y., Ishikawa K., Ito E., Kagawa N., Kaminaga C., Kanehori K., Kawakami B. Nomura N.Nat. Methods 5:1011-1017(2008) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM GAMMA-3). |
| [5] | "The DNA sequence and analysis of human chromosome 14." Heilig R., Eckenberg R., Petit J.-L., Fonknechten N., Da Silva C., Cattolico L., Levy M., Barbe V., De Berardinis V., Ureta-Vidal A., Pelletier E., Vico V., Anthouard V., Rowen L., Madan A., Qin S., Sun H., Du H. Weissenbach J.Nature 421:601-607(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [7] | "Prediction of the coding sequences of unidentified human genes. II. The coding sequences of 40 new genes (KIAA0041-KIAA0080) deduced by analysis of cDNA clones from human cell line KG-1." Nomura N., Nagase T., Miyajima N., Sazuka T., Tanaka A., Sato S., Seki N., Kawarabayasi Y., Ishikawa K., Tabata S. DNA Res. 1:223-229(1994) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 2-524 (ISOFORM GAMMA-2). Tissue: Bone marrow. |
| [8] | "Identification of a new family of protein phosphatase 2A regulatory subunits." McCright B., Virshup D.M. J. Biol. Chem. 270:26123-26128(1995) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 11-524 (ISOFORM GAMMA-1). |
| [9] | "The B56 family of protein phosphatase 2A (PP2A) regulatory subunits encodes differentiation-induced phosphoproteins that target PP2A to both nucleus and cytoplasm." McCright B., Rivers A.M., Audlin S., Virshup D.M. J. Biol. Chem. 271:22081-22089(1996) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION, SUBCELLULAR LOCATION. |
| [10] | "Antigens recognized by autologous antibody in patients with renal-cell carcinoma." Scanlan M.J., Gordan J.D., Williamson B., Stockert E., Bander N.H., Jongeneel C.V., Gure A.O., Jaeger D., Jaeger E., Knuth A., Chen Y.-T., Old L.J. Int. J. Cancer 83:456-464(1999) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION AS A RENAL CANCER ANTIGEN. Tissue: Renal cell carcinoma. |
| [11] | "PP2A is required for centromeric localization of Sgo1 and proper chromosome segregation." Tang Z., Shu H., Qi W., Mahmood N.A., Mumby M.C., Yu H. Dev. Cell 10:575-585(2006) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY, INTERACTION WITH SGOL1, SUBCELLULAR LOCATION. |
| [12] | "B56-containing PP2A dephosphorylate ERK and their activity is controlled by the early gene IEX-1 and ERK." Letourneux C., Rocher G., Porteu F. EMBO J. 25:727-738(2006) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH IER3 AND ERK KINASES, PHOSPHORYLATION. |
| [13] | "Shugoshin collaborates with protein phosphatase 2A to protect cohesin." Kitajima T.S., Sakuno T., Ishiguro K., Iemura S., Natsume T., Kawashima S.A., Watanabe Y. Nature 441:46-52(2006) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH SGOL1. |
| [14] | "A specific PP2A regulatory subunit, B56gamma, mediates DNA damage-induced dephosphorylation of p53 at Thr55." Li H.H., Cai X., Shouse G.P., Piluso L.G., Liu X. EMBO J. 26:402-411(2007) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH TP53, INDUCTION. |
| [15] | "Serine 15 phosphorylation of p53 directs its interaction with B56gamma and the tumor suppressor activity of B56gamma-specific protein phosphatase 2A." Shouse G.P., Cai X., Liu X. Mol. Cell. Biol. 28:448-456(2008) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH TP53. |
| [16] | "Structure of the protein phosphatase 2A holoenzyme." Xu Y., Xing Y., Chen Y., Chao Y., Lin Z., Fan E., Yu J.W., Strack S., Jeffrey P.D., Shi Y. Cell 127:1239-1251(2006) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (3.30 ANGSTROMS) OF 1-442 IN COMPLEX WITH PPP2CA AND PPP2R1A. |
| [17] | "Crystal structure of a protein phosphatase 2A heterotrimeric holoenzyme." Cho U.S., Xu W. Nature 445:53-57(2007) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (3.50 ANGSTROMS) OF 30-436 IN COMPLEX WITH PPP2CA AND PPP2R1A. |
| [18] | "Structure and function of the PP2A-shugoshin interaction." Xu Z., Cetin B., Anger M., Cho U.S., Helmhart W., Nasmyth K., Xu W. Mol. Cell 35:426-441(2009) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.70 ANGSTROMS) OF 34-436 IN COMPLEX WITH PPP2CA; PPP2R1A AND SGOL1. |
| [19] | "The structure of the PP2A regulatory subunit B56 gamma: the remaining piece of the PP2A jigsaw puzzle." Magnusdottir A., Stenmark P., Flodin S., Nyman T., Kotenyova T., Graeslund S., Ogg D., Nordlund P. Proteins 74:212-221(2009) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.60 ANGSTROMS) OF 11-380. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | U37352 mRNA. Translation: AAC50387.1. Different initiation. Z69030 mRNA. Translation: CAA93154.1. AK131391 mRNA. Translation: BAD18542.1. AB451341 mRNA. Translation: BAG70155.1. AL118558 Genomic DNA. No translation available. AL137779 Genomic DNA. No translation available. CH471061 Genomic DNA. Translation: EAW81756.1. D26445 mRNA. Translation: BAA05465.1. L42375 mRNA. Translation: AAC37603.1. | ||||||||||||||||||||||||||||||||||||||||||
| IPI | IPI00012834. IPI00185637. IPI00220145. IPI00442098. | ||||||||||||||||||||||||||||||||||||||||||
| RefSeq | NP_001155197.1. NM_001161725.1. NP_001155198.1. NM_001161726.1. NP_002710.2. NM_002719.3. NP_848701.1. NM_178586.2. NP_848702.1. NM_178587.2. | ||||||||||||||||||||||||||||||||||||||||||
| UniGene | Hs.368264. | ||||||||||||||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||||||||||||||||||||
| ProteinModelPortal | Q13362. | ||||||||||||||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||||||||||||||
| DIP | DIP-29396N. DIP-39401N. | ||||||||||||||||||||||||||||||||||||||||||
| IntAct | Q13362. 9 interactions. | ||||||||||||||||||||||||||||||||||||||||||
| MINT | MINT-2835438. | ||||||||||||||||||||||||||||||||||||||||||
| STRING | 9606.ENSP00000333905. | ||||||||||||||||||||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||||||||||||||||||||
| PhosphoSite | Q13362. | ||||||||||||||||||||||||||||||||||||||||||
Polymorphism databases | |||||||||||||||||||||||||||||||||||||||||||
| DMDM | 116241235. | ||||||||||||||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||||||||||||||
| PaxDb | Q13362. | ||||||||||||||||||||||||||||||||||||||||||
| PRIDE | Q13362. | ||||||||||||||||||||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||||||||||||||||||||
| DNASU | 5527. | ||||||||||||||||||||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||||||||||||||
| Ensembl | ENST00000328724; ENSP00000329009; ENSG00000078304. ENST00000334743; ENSP00000333905; ENSG00000078304. ENST00000350249; ENSP00000262239; ENSG00000078304. ENST00000445439; ENSP00000408389; ENSG00000078304. | ||||||||||||||||||||||||||||||||||||||||||
| GeneID | 5527. | ||||||||||||||||||||||||||||||||||||||||||
| KEGG | hsa:5527. | ||||||||||||||||||||||||||||||||||||||||||
| UCSC | uc001ykn.3. human. uc001yko.3. human. uc001ykp.3. human. | ||||||||||||||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||||||||||||||
| CTD | 5527. | ||||||||||||||||||||||||||||||||||||||||||
| GeneCards | GC14P102228. | ||||||||||||||||||||||||||||||||||||||||||
| HGNC | HGNC:9311. PPP2R5C. | ||||||||||||||||||||||||||||||||||||||||||
| HPA | HPA027553. | ||||||||||||||||||||||||||||||||||||||||||
| MIM | 601645. gene. | ||||||||||||||||||||||||||||||||||||||||||
| neXtProt | NX_Q13362. | ||||||||||||||||||||||||||||||||||||||||||
| PharmGKB | PA33674. | ||||||||||||||||||||||||||||||||||||||||||
| HUGE | Search... | ||||||||||||||||||||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||||||||||||||
| eggNOG | NOG264925. | ||||||||||||||||||||||||||||||||||||||||||
| HOGENOM | HOG000067326. | ||||||||||||||||||||||||||||||||||||||||||
| HOVERGEN | HBG000009. | ||||||||||||||||||||||||||||||||||||||||||
| KO | K11584. | ||||||||||||||||||||||||||||||||||||||||||
| OMA | ESHCRAD. | ||||||||||||||||||||||||||||||||||||||||||
| PhylomeDB | Q13362. | ||||||||||||||||||||||||||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||||||||||||||||||||||||||
| Reactome | REACT_111102. Signal Transduction. REACT_115566. Cell Cycle. REACT_21300. Mitotic M-M/G1 phases. REACT_604. Hemostasis. REACT_6900. Immune System. | ||||||||||||||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||||||||||||||
| ArrayExpress | Q13362. | ||||||||||||||||||||||||||||||||||||||||||
| Bgee | Q13362. | ||||||||||||||||||||||||||||||||||||||||||
| CleanEx | HS_PPP2R5C. | ||||||||||||||||||||||||||||||||||||||||||
| Genevestigator | Q13362. | ||||||||||||||||||||||||||||||||||||||||||
| GermOnline | ENSG00000078304. Homo sapiens. | ||||||||||||||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||||||||||||||
| InterPro | IPR016024. ARM-type_fold. IPR002554. PP2A_B56. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||
| PANTHER | PTHR10257. PTHR10257. 1 hit. | ||||||||||||||||||||||||||||||||||||||||||
| Pfam | PF01603. B56. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||
| PIRSF | PIRSF028043. PP2A_B56. 1 hit. | ||||||||||||||||||||||||||||||||||||||||||
| SUPFAM | SSF48371. ARM-type_fold. 1 hit. | ||||||||||||||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||||||||||||||
Other | |||||||||||||||||||||||||||||||||||||||||||
| ChiTaRS | PPP2R5C. human. | ||||||||||||||||||||||||||||||||||||||||||
| EvolutionaryTrace | Q13362. | ||||||||||||||||||||||||||||||||||||||||||
| GenomeRNAi | 5527. | ||||||||||||||||||||||||||||||||||||||||||
| NextBio | 21400. | ||||||||||||||||||||||||||||||||||||||||||
| PMAP-CutDB | Q13362. | ||||||||||||||||||||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||||||||||||||||||||
Entry information
| Entry name | 2A5G_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q13362 Secondary accession number(s): B5BUA5 Q6ZN33 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 14 Human chromosome 14: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
