SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q13356

- PPIL2_HUMAN

UniProt

Q13356 - PPIL2_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Peptidyl-prolyl cis-trans isomerase-like 2
Gene
PPIL2
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.

Catalytic activityi

Peptidylproline (omega=180) = peptidylproline (omega=0).

GO - Molecular functioni

  1. peptidyl-prolyl cis-trans isomerase activity Source: UniProtKB-KW
  2. protein binding Source: IntAct
  3. ubiquitin-protein transferase activity Source: MGI
  4. ubiquitin-ubiquitin ligase activity Source: MGI

GO - Biological processi

  1. blood coagulation Source: Reactome
  2. leukocyte migration Source: Reactome
  3. protein folding Source: UniProtKB-KW
  4. protein polyubiquitination Source: MGI
Complete GO annotation...

Keywords - Molecular functioni

Isomerase, Rotamase

Enzyme and pathway databases

ReactomeiREACT_12560. Basigin interactions.

Names & Taxonomyi

Protein namesi
Recommended name:
Peptidyl-prolyl cis-trans isomerase-like 2 (EC:5.2.1.8)
Short name:
PPIase
Alternative name(s):
Cyclophilin-60
Cyclophilin-like protein Cyp-60
Rotamase PPIL2
Gene namesi
Name:PPIL2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 22

Organism-specific databases

HGNCiHGNC:9261. PPIL2.

Subcellular locationi

GO - Cellular componenti

  1. Golgi lumen Source: Reactome
  2. nucleus Source: UniProtKB
  3. ubiquitin ligase complex Source: InterPro
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA33588.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 520520Peptidyl-prolyl cis-trans isomerase-like 2
PRO_0000064171Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei482 – 4821N6-acetyllysine1 Publication

Keywords - PTMi

Acetylation

Proteomic databases

MaxQBiQ13356.
PaxDbiQ13356.
PeptideAtlasiQ13356.
PRIDEiQ13356.

PTM databases

PhosphoSiteiQ13356.

Expressioni

Tissue specificityi

Highest expression in thymus, pancreas and testis. Also detected in heart, placenta, lung, liver, skeletal muscle, kidney, spleen, prostate, ovary, small intestine and colon. Poorly detected in brain and leukocytes. Strong protein expression in lymph node (cortical, paracortical and medullar regions), thyroid (follicular epithelial cells), testis (developing spermatozoa), stomach (cells lining the gastric pit), pancreas, kidney (proximal and distal-tubule cells and collecting duct cells but not in glomeruli), endometrium and colon (goblet cells). Moderate protein expression in spleen, prostate (epithelium and squamous cell carcinomas), placenta and adrenal gland. Weak protein expression in liver, heart, breast, ovary, and lung. No protein expression in brain and bladder. High protein expression in most lymphomas and melanomas.

Gene expression databases

ArrayExpressiQ13356.
BgeeiQ13356.
CleanExiHS_PPIL2.
GenevestigatoriQ13356.

Organism-specific databases

HPAiHPA035344.
HPA055637.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
ZNF830Q96NB32EBI-7705988,EBI-3920997

Protein-protein interaction databases

BioGridi117260. 10 interactions.
IntActiQ13356. 2 interactions.
MINTiMINT-4654541.
STRINGi9606.ENSP00000390427.

Structurei

Secondary structure

Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi280 – 2867
Beta strandi289 – 2957
Turni297 – 2993
Helixi301 – 31212
Turni313 – 3186
Beta strandi323 – 3253
Turni326 – 3283
Beta strandi329 – 3324
Beta strandi337 – 3404
Beta strandi365 – 3684
Beta strandi380 – 3856
Helixi388 – 3903
Turni391 – 3933
Beta strandi396 – 4027
Helixi404 – 4129
Turni417 – 4193
Beta strandi422 – 4243
Beta strandi427 – 4359
Helixi439 – 45517

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
1ZKCX-ray1.65A/B280-457[»]
ProteinModelPortaliQ13356.
SMRiQ13356. Positions 277-457.

Miscellaneous databases

EvolutionaryTraceiQ13356.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini35 – 10874U-box
Add
BLAST
Domaini278 – 433156PPIase cyclophilin-type
Add
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili197 – 21721 Reviewed prediction
Add
BLAST

Sequence similaritiesi

Contains 1 U-box domain.

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiCOG0652.
HOGENOMiHOG000177172.
HOVERGENiHBG053655.
InParanoidiQ13356.
KOiK10598.
OMAiCCALSFQ.
OrthoDBiEOG769ZKZ.
PhylomeDBiQ13356.
TreeFamiTF300854.

Family and domain databases

Gene3Di2.40.100.10. 1 hit.
3.30.40.10. 1 hit.
InterProiIPR029000. Cyclophilin-like_dom.
IPR020892. Cyclophilin-type_PPIase_CS.
IPR002130. Cyclophilin-type_PPIase_dom.
IPR027799. Rtf2_RING-finger.
IPR003613. Ubox_domain.
IPR013083. Znf_RING/FYVE/PHD.
[Graphical view]
PfamiPF00160. Pro_isomerase. 1 hit.
PF04641. Rtf2. 1 hit.
[Graphical view]
PRINTSiPR00153. CSAPPISMRASE.
SMARTiSM00504. Ubox. 1 hit.
[Graphical view]
SUPFAMiSSF50891. SSF50891. 1 hit.
PROSITEiPS00170. CSA_PPIASE_1. 1 hit.
PS50072. CSA_PPIASE_2. 1 hit.
PS51698. U_BOX. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q13356-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MGKRQHQKDK MYITCAEYTH FYGGKKPDLP QTNFRRLPFD HCSLSLQPFV    50
YPVCTPDGIV FDLLNIVPWL KKYGTNPSNG EKLDGRSLIK LNFSKNSEGK 100
YHCPVLFTVF TNNTHIVAVR TTGNVYAYEA VEQLNIKAKN FRDLLTDEPF 150
SRQDIITLQD PTNLDKFNVS NFYHVKNNMK IIDPDEEKAK QDPSYYLKNT 200
NAETRETLQE LYKEFKGDEI LAATMKAPEK KKVDKLNAAH YSTGKVSASF 250
TSTAMVPETT HEAAAIDEDV LRYQFVKKKG YVRLHTNKGD LNLELHCDLT 300
PKTCENFIRL CKKHYYDGTI FHRSIRNFVI QGGDPTGTGT GGESYWGKPF 350
KDEFRPNLSH TGRGILSMAN SGPNSNRSQF FITFRSCAYL DKKHTIFGRV 400
VGGFDVLTAM ENVESDPKTD RPKEEIRIDA TTVFVDPYEE ADAQIAQERK 450
TQLKVAPETK VKSSQPQAGS QGPQTFRQGV GKYINPAATK RAAEEEPSTS 500
ATVPMSKKKP SRGFGDFSSW 520
Length:520
Mass (Da):58,823
Last modified:November 1, 1996 - v1
Checksum:i3FFA51C3D82F0957
GO
Isoform 2 (identifier: Q13356-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     490-520: KRAAEEEPSTSATVPMSKKKPSRGFGDFSSW → EQQRKSPQPVPLSPCPRRSPVGVLGTSAPGSSRLPDDH

Note: No experimental confirmation available.

Show »
Length:527
Mass (Da):59,458
Checksum:i9B494AE6D29EBAC3
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei490 – 52031KRAAE…DFSSW → EQQRKSPQPVPLSPCPRRSP VGVLGTSAPGSSRLPDDH in isoform 2.
VSP_005182Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti455 – 4551V → I in AAH28385. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U37219 mRNA. Translation: AAC50376.1.
U37220 mRNA. Translation: AAC50377.1.
U37221 mRNA. Translation: AAC50378.1.
CR456548 mRNA. Translation: CAG30434.1.
BC028385 mRNA. Translation: AAH28385.1.
BC000022 mRNA. Translation: AAH00022.1.
CCDSiCCDS13793.1. [Q13356-1]
CCDS46670.1. [Q13356-2]
PIRiS64705.
RefSeqiNP_055152.1. NM_014337.3. [Q13356-1]
NP_680480.1. NM_148175.2. [Q13356-1]
NP_680481.1. NM_148176.2. [Q13356-2]
XP_005261504.1. XM_005261447.2. [Q13356-1]
XP_005261505.1. XM_005261448.2. [Q13356-1]
XP_006724260.1. XM_006724197.1. [Q13356-1]
UniGeneiHs.438587.

Genome annotation databases

EnsembliENST00000335025; ENSP00000334553; ENSG00000100023. [Q13356-1]
ENST00000398831; ENSP00000381812; ENSG00000100023. [Q13356-1]
ENST00000406385; ENSP00000384299; ENSG00000100023. [Q13356-1]
ENST00000412327; ENSP00000390427; ENSG00000100023. [Q13356-2]
ENST00000492445; ENSP00000445312; ENSG00000100023. [Q13356-1]
GeneIDi23759.
KEGGihsa:23759.
UCSCiuc002zvg.4. human. [Q13356-1]
uc002zvh.4. human. [Q13356-2]

Polymorphism databases

DMDMi23813917.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U37219 mRNA. Translation: AAC50376.1 .
U37220 mRNA. Translation: AAC50377.1 .
U37221 mRNA. Translation: AAC50378.1 .
CR456548 mRNA. Translation: CAG30434.1 .
BC028385 mRNA. Translation: AAH28385.1 .
BC000022 mRNA. Translation: AAH00022.1 .
CCDSi CCDS13793.1. [Q13356-1 ]
CCDS46670.1. [Q13356-2 ]
PIRi S64705.
RefSeqi NP_055152.1. NM_014337.3. [Q13356-1 ]
NP_680480.1. NM_148175.2. [Q13356-1 ]
NP_680481.1. NM_148176.2. [Q13356-2 ]
XP_005261504.1. XM_005261447.2. [Q13356-1 ]
XP_005261505.1. XM_005261448.2. [Q13356-1 ]
XP_006724260.1. XM_006724197.1. [Q13356-1 ]
UniGenei Hs.438587.

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
1ZKC X-ray 1.65 A/B 280-457 [» ]
ProteinModelPortali Q13356.
SMRi Q13356. Positions 277-457.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 117260. 10 interactions.
IntActi Q13356. 2 interactions.
MINTi MINT-4654541.
STRINGi 9606.ENSP00000390427.

PTM databases

PhosphoSitei Q13356.

Polymorphism databases

DMDMi 23813917.

Proteomic databases

MaxQBi Q13356.
PaxDbi Q13356.
PeptideAtlasi Q13356.
PRIDEi Q13356.

Protocols and materials databases

DNASUi 23759.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000335025 ; ENSP00000334553 ; ENSG00000100023 . [Q13356-1 ]
ENST00000398831 ; ENSP00000381812 ; ENSG00000100023 . [Q13356-1 ]
ENST00000406385 ; ENSP00000384299 ; ENSG00000100023 . [Q13356-1 ]
ENST00000412327 ; ENSP00000390427 ; ENSG00000100023 . [Q13356-2 ]
ENST00000492445 ; ENSP00000445312 ; ENSG00000100023 . [Q13356-1 ]
GeneIDi 23759.
KEGGi hsa:23759.
UCSCi uc002zvg.4. human. [Q13356-1 ]
uc002zvh.4. human. [Q13356-2 ]

Organism-specific databases

CTDi 23759.
GeneCardsi GC22P022006.
HGNCi HGNC:9261. PPIL2.
HPAi HPA035344.
HPA055637.
MIMi 607588. gene.
neXtProti NX_Q13356.
PharmGKBi PA33588.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG0652.
HOGENOMi HOG000177172.
HOVERGENi HBG053655.
InParanoidi Q13356.
KOi K10598.
OMAi CCALSFQ.
OrthoDBi EOG769ZKZ.
PhylomeDBi Q13356.
TreeFami TF300854.

Enzyme and pathway databases

Reactomei REACT_12560. Basigin interactions.

Miscellaneous databases

ChiTaRSi PPIL2. human.
EvolutionaryTracei Q13356.
GeneWikii PPIL2.
GenomeRNAii 23759.
NextBioi 46699.
PROi Q13356.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q13356.
Bgeei Q13356.
CleanExi HS_PPIL2.
Genevestigatori Q13356.

Family and domain databases

Gene3Di 2.40.100.10. 1 hit.
3.30.40.10. 1 hit.
InterProi IPR029000. Cyclophilin-like_dom.
IPR020892. Cyclophilin-type_PPIase_CS.
IPR002130. Cyclophilin-type_PPIase_dom.
IPR027799. Rtf2_RING-finger.
IPR003613. Ubox_domain.
IPR013083. Znf_RING/FYVE/PHD.
[Graphical view ]
Pfami PF00160. Pro_isomerase. 1 hit.
PF04641. Rtf2. 1 hit.
[Graphical view ]
PRINTSi PR00153. CSAPPISMRASE.
SMARTi SM00504. Ubox. 1 hit.
[Graphical view ]
SUPFAMi SSF50891. SSF50891. 1 hit.
PROSITEi PS00170. CSA_PPIASE_1. 1 hit.
PS50072. CSA_PPIASE_2. 1 hit.
PS51698. U_BOX. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Identification of a nuclear-specific cyclophilin which interacts with the proteinase inhibitor eglin c."
    Wang B.B., Hayenga K.J., Payan D.G., Fisher J.M.
    Biochem. J. 314:313-319(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), CHARACTERIZATION.
    Tissue: Lymphocyte.
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    Tissue: Hippocampus and Kidney.
  4. "Lysine acetylation targets protein complexes and co-regulates major cellular functions."
    Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.C., Olsen J.V., Mann M.
    Science 325:834-840(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-482, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  5. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  6. "Crystal structure of the human peptidylprolyl isomerase-like 2 isoform B."
    Structural genomics consortium (SGC)
    Submitted (JAN-2006) to the PDB data bank
    Cited for: X-RAY CRYSTALLOGRAPHY (1.65 ANGSTROMS) OF 280-457.

Entry informationi

Entry nameiPPIL2_HUMAN
AccessioniPrimary (citable) accession number: Q13356
Secondary accession number(s): Q13357, Q8TAH2, Q9BWR8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 10, 2002
Last sequence update: November 1, 1996
Last modified: September 3, 2014
This is version 133 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 22
    Human chromosome 22: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi