Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Centromere protein R

Gene

ITGB3BP

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Transcription coregulator that can have both coactivator and corepressor functions. Isoform 1, but not other isoforms, is involved in the coactivation of nuclear receptors for retinoid X (RXRs) and thyroid hormone (TRs) in a ligand-dependent fashion. In contrast, it does not coactivate nuclear receptors for retinoic acid, vitamin D, progesterone receptor, nor glucocorticoid. Acts as a coactivator for estrogen receptor alpha. Acts as a transcriptional corepressor via its interaction with the NFKB1 NF-kappa-B subunit, possibly by interfering with the transactivation domain of NFKB1. Induces apoptosis in breast cancer cells, but not in other cancer cells, via a caspase-2 mediated pathway that involves mitochondrial membrane permeabilization but does not require other caspases. May also act as an inhibitor of cyclin A-associated kinase. Also acts a component of the CENPA-CAD (nucleosome distal) complex, a complex recruited to centromeres which is involved in assembly of kinetochore proteins, mitotic progression and chromosome segregation. May be involved in incorporation of newly synthesized CENPA into centromeres via its interaction with the CENPA-NAC complex.5 Publications

GO - Molecular functioni

  • protein C-terminus binding Source: ProtInc
  • signal transducer activity Source: ProtInc

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Activator, Repressor

Keywords - Biological processi

Apoptosis, Cell cycle, Cell division, Mitosis, Transcription, Transcription regulation

Enzyme and pathway databases

ReactomeiR-HSA-205043. NRIF signals cell death from the nucleus.
R-HSA-2467813. Separation of Sister Chromatids.
R-HSA-2500257. Resolution of Sister Chromatid Cohesion.
R-HSA-5663220. RHO GTPases Activate Formins.
R-HSA-606279. Deposition of new CENPA-containing nucleosomes at the centromere.
R-HSA-68877. Mitotic Prometaphase.
SIGNORiQ13352.

Names & Taxonomyi

Protein namesi
Recommended name:
Centromere protein R
Short name:
CENP-R
Alternative name(s):
Beta-3-endonexin
Integrin beta-3-binding protein
Nuclear receptor-interacting factor 3
Gene namesi
Name:ITGB3BP
Synonyms:CENPR, NRIF3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

HGNCiHGNC:6157. ITGB3BP.

Subcellular locationi

Isoform 3 :
  • Nucleus
  • Cytoplasm

  • Note: Isoform 3 is predominantly nuclear and weakly cytoplasmic.

GO - Cellular componenti

  • condensed chromosome kinetochore Source: UniProtKB-SubCell
  • cytoplasm Source: ProtInc
  • cytosol Source: Reactome
  • membrane Source: ProtInc
  • nucleoplasm Source: HPA
  • nucleus Source: ProtInc
Complete GO annotation...

Keywords - Cellular componenti

Centromere, Chromosome, Cytoplasm, Kinetochore, Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi9L → A: Decreased interaction with nuclear receptors. 1 Publication1
Mutagenesisi28S → A: Loss of repressor function. 2 Publications1
Mutagenesisi63 – 66Missing : Abolishes localization to nucleus. 1 Publication4
Mutagenesisi63 – 65KRK → AAA: Abolishes localization to nucleus. 1 Publication3
Mutagenesisi89L → R: Abolishes dimerization, but not interactions with nuclear receptors; when associated with R-96. 1 Publication1
Mutagenesisi96L → R: Abolishes dimerization, but not interactions with nuclear receptors; when associated with R-89. 1 Publication1
Mutagenesisi172 – 176LKAIL → AKAAA: Abolishes interaction with nuclear receptors. 1 Publication5

Organism-specific databases

DisGeNETi23421.
OpenTargetsiENSG00000142856.
PharmGKBiPA29956.

Polymorphism and mutation databases

BioMutaiITGB3BP.
DMDMi50400855.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000579491 – 177Centromere protein RAdd BLAST177

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei17PhosphoserineCombined sources1
Modified residuei28Phosphoserine1 Publication1
Modified residuei71PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ13352.
PaxDbiQ13352.
PeptideAtlasiQ13352.
PRIDEiQ13352.
TopDownProteomicsiQ13352-1. [Q13352-1]

PTM databases

iPTMnetiQ13352.
PhosphoSitePlusiQ13352.

Expressioni

Tissue specificityi

Widely expressed. Expressed in spleen, thymus, prostate, ovary, small intestine and white blood cells. Highly expressed in testis and colon. Isoform 4 is expressed in platelets, lymphocytes and granulocytes.2 Publications

Inductioni

By estrogen.1 Publication

Gene expression databases

BgeeiENSG00000142856.
GenevisibleiQ13352. HS.

Organism-specific databases

HPAiHPA028463.

Interactioni

Subunit structurei

Homodimer; mediated by the coiled coil domain. Isoform 3, but not other isoforms, interacts with the cytoplasmic tail of integrin ITGB3. The relevance of the interaction with ITGB3 is however uncertain, since isoform 3 is mainly nuclear. Interacts with CCNA2 and MTA1. Interacts with NFKB1 NF-kappa-B subunit. Component of the CENPA-CAD complex, composed of CENPI, CENPK, CENPL, CENPO, CENPP, CENPQ, CENPR and CENPS. The CENPA-CAD complex interacts with the CENPA-NAC complex, at least composed of CENPA, CENPC, CENPH, CENPM, CENPN, CENPT and CENPU.7 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
B2RDC93EBI-10175826,EBI-10175830
ARFIP2P533654EBI-712105,EBI-638194
COL4A3BPQ9Y5P44EBI-712105,EBI-739994
KIFC3Q9BVG83EBI-712105,EBI-2125614
PIH1D2Q8WWB53EBI-10175826,EBI-10232538

GO - Molecular functioni

  • protein C-terminus binding Source: ProtInc

Protein-protein interaction databases

BioGridi116992. 46 interactors.
IntActiQ13352. 58 interactors.
MINTiMINT-1378371.
STRINGi9606.ENSP00000360133.

Structurei

3D structure databases

ProteinModelPortaliQ13352.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni20 – 50DD1Add BLAST31

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili83 – 113Sequence analysisAdd BLAST31

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi9 – 13LXXLL motif5
Motifi63 – 66Nuclear localization signal4
Motifi172 – 176LXXIL motif5

Domaini

The DD1 domain (also called RepD1 domain) mediates the corepressor function and is essential in the triggering of apoptosis.1 Publication
Contains one Leu-Xaa-Xaa-Leu-Leu (LXXLL) motif, a motif known to be important for the association with nuclear receptors. Such motif, which is required for an efficient association with nuclear receptors, is however not essential.1 Publication
Contains one Leu-Xaa-Xaa-Ile-Leu (LXXIL) motif, which is essential for the association with nuclear receptors.1 Publication

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiENOG410J05S. Eukaryota.
ENOG410Z43R. LUCA.
GeneTreeiENSGT00390000004336.
HOVERGENiHBG080553.
InParanoidiQ13352.
KOiK11510.
OMAiCHLDSYE.
OrthoDBiEOG091G180Q.
PhylomeDBiQ13352.
TreeFamiTF336291.

Family and domain databases

InterProiIPR009601. CENP-R.
[Graphical view]
PANTHERiPTHR15581. PTHR15581. 1 hit.
PfamiPF06729. CENP-R. 1 hit.
[Graphical view]
PIRSFiPIRSF011860. NRIF3_coact_rcpt. 1 hit.

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q13352-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MPVKRSLKLD GLLEENSFDP SKITRKKSVI TYSPTTGTCQ MSLFASPTSS
60 70 80 90 100
EEQKHRNGLS NEKRKKLNHP SLTESKESTT KDNDEFMMLL SKVEKLSEEI
110 120 130 140 150
MEIMQNLSSI QALEGSRELE NLIGISCASH FLKREMQKTK ELMTKVNKQK
160 170
LFEKSTGLPH KASRHLDSYE FLKAILN
Length:177
Mass (Da):20,194
Last modified:July 19, 2004 - v2
Checksum:iC0A6FD5A56E98D43
GO
Isoform 2 (identifier: Q13352-2) [UniParc]FASTAAdd to basket
Also known as: Long, EnL, En-L

The sequence of this isoform differs from the canonical sequence as follows:
     162-177: ASRHLDSYEFLKAILN → GQPQMSQPL

Show »
Length:170
Mass (Da):19,302
Checksum:i227EE95365D0AB5C
GO
Isoform 3 (identifier: Q13352-3) [UniParc]FASTAAdd to basket
Also known as: Short, EnS, En-S

The sequence of this isoform differs from the canonical sequence as follows:
     112-177: Missing.

Show »
Length:111
Mass (Da):12,624
Checksum:i790E4D07D5CC09AF
GO
Isoform 4 (identifier: Q13352-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     63-177: Missing.

Show »
Length:62
Mass (Da):6,902
Checksum:iDB8074B62E359160
GO
Isoform 5 (identifier: Q13352-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-2: MP → MPFAPVAQARVQWHDFRSLQHLLPAFKRFSCLSLGSSWDYS

Note: No experimental confirmation available.
Show »
Length:216
Mass (Da):24,729
Checksum:i1D131D450750DCF4
GO

Sequence cautioni

The sequence AAH14385 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_04869130I → V.Corresponds to variant rs1058057dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0108311 – 2MP → MPFAPVAQARVQWHDFRSLQ HLLPAFKRFSCLSLGSSWDY S in isoform 5. 1 Publication2
Alternative sequenceiVSP_01083263 – 177Missing in isoform 4. CuratedAdd BLAST115
Alternative sequenceiVSP_010833112 – 177Missing in isoform 3. 1 PublicationAdd BLAST66
Alternative sequenceiVSP_010834162 – 177ASRHL…KAILN → GQPQMSQPL in isoform 2. 1 PublicationAdd BLAST16

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U37139 mRNA. Translation: AAC50295.1.
U37139 mRNA. Translation: AAC50294.1.
AF175306 mRNA. Translation: AAF00239.1.
AK312944 mRNA. Translation: BAG35785.1.
BX004807, AL592218 Genomic DNA. Translation: CAI15771.1.
BX004807, AL592218 Genomic DNA. Translation: CAI15772.1.
AL592218, BX004807 Genomic DNA. Translation: CAI18958.1.
AL592218, BX004807 Genomic DNA. Translation: CAI18959.1.
BC009929 mRNA. Translation: AAH09929.1.
BC014385 mRNA. Translation: AAH14385.1. Different initiation.
CCDSiCCDS30736.1. [Q13352-1]
CCDS55603.1. [Q13352-5]
PIRiA57277.
RefSeqiNP_001193668.1. NM_001206739.1. [Q13352-5]
NP_055103.3. NM_014288.4. [Q13352-1]
UniGeneiHs.166539.

Genome annotation databases

EnsembliENST00000271002; ENSP00000271002; ENSG00000142856. [Q13352-1]
ENST00000371092; ENSP00000360133; ENSG00000142856. [Q13352-5]
ENST00000489099; ENSP00000432904; ENSG00000142856. [Q13352-2]
GeneIDi23421.
KEGGihsa:23421.
UCSCiuc001dba.3. human. [Q13352-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U37139 mRNA. Translation: AAC50295.1.
U37139 mRNA. Translation: AAC50294.1.
AF175306 mRNA. Translation: AAF00239.1.
AK312944 mRNA. Translation: BAG35785.1.
BX004807, AL592218 Genomic DNA. Translation: CAI15771.1.
BX004807, AL592218 Genomic DNA. Translation: CAI15772.1.
AL592218, BX004807 Genomic DNA. Translation: CAI18958.1.
AL592218, BX004807 Genomic DNA. Translation: CAI18959.1.
BC009929 mRNA. Translation: AAH09929.1.
BC014385 mRNA. Translation: AAH14385.1. Different initiation.
CCDSiCCDS30736.1. [Q13352-1]
CCDS55603.1. [Q13352-5]
PIRiA57277.
RefSeqiNP_001193668.1. NM_001206739.1. [Q13352-5]
NP_055103.3. NM_014288.4. [Q13352-1]
UniGeneiHs.166539.

3D structure databases

ProteinModelPortaliQ13352.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi116992. 46 interactors.
IntActiQ13352. 58 interactors.
MINTiMINT-1378371.
STRINGi9606.ENSP00000360133.

PTM databases

iPTMnetiQ13352.
PhosphoSitePlusiQ13352.

Polymorphism and mutation databases

BioMutaiITGB3BP.
DMDMi50400855.

Proteomic databases

MaxQBiQ13352.
PaxDbiQ13352.
PeptideAtlasiQ13352.
PRIDEiQ13352.
TopDownProteomicsiQ13352-1. [Q13352-1]

Protocols and materials databases

DNASUi23421.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000271002; ENSP00000271002; ENSG00000142856. [Q13352-1]
ENST00000371092; ENSP00000360133; ENSG00000142856. [Q13352-5]
ENST00000489099; ENSP00000432904; ENSG00000142856. [Q13352-2]
GeneIDi23421.
KEGGihsa:23421.
UCSCiuc001dba.3. human. [Q13352-1]

Organism-specific databases

CTDi23421.
DisGeNETi23421.
GeneCardsiITGB3BP.
H-InvDBHIX0019635.
HGNCiHGNC:6157. ITGB3BP.
HPAiHPA028463.
MIMi605494. gene.
neXtProtiNX_Q13352.
OpenTargetsiENSG00000142856.
PharmGKBiPA29956.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410J05S. Eukaryota.
ENOG410Z43R. LUCA.
GeneTreeiENSGT00390000004336.
HOVERGENiHBG080553.
InParanoidiQ13352.
KOiK11510.
OMAiCHLDSYE.
OrthoDBiEOG091G180Q.
PhylomeDBiQ13352.
TreeFamiTF336291.

Enzyme and pathway databases

ReactomeiR-HSA-205043. NRIF signals cell death from the nucleus.
R-HSA-2467813. Separation of Sister Chromatids.
R-HSA-2500257. Resolution of Sister Chromatid Cohesion.
R-HSA-5663220. RHO GTPases Activate Formins.
R-HSA-606279. Deposition of new CENPA-containing nucleosomes at the centromere.
R-HSA-68877. Mitotic Prometaphase.
SIGNORiQ13352.

Miscellaneous databases

ChiTaRSiITGB3BP. human.
GeneWikiiITGB3BP.
GenomeRNAii23421.
PROiQ13352.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000142856.
GenevisibleiQ13352. HS.

Family and domain databases

InterProiIPR009601. CENP-R.
[Graphical view]
PANTHERiPTHR15581. PTHR15581. 1 hit.
PfamiPF06729. CENP-R. 1 hit.
[Graphical view]
PIRSFiPIRSF011860. NRIF3_coact_rcpt. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiCENPR_HUMAN
AccessioniPrimary (citable) accession number: Q13352
Secondary accession number(s): B2R7D8
, Q13353, Q5RJ42, Q5RJ44, Q5RJ45, Q7KYX2, Q96CD5, Q9UKB6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 19, 2004
Last sequence update: July 19, 2004
Last modified: November 30, 2016
This is version 133 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.