Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Nuclear body protein SP140

Gene

SP140

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Component of the nuclear body, also known as nuclear domain 10, PML oncogenic domain, and KR body (PubMed:8910577). May be involved in the pathogenesis of acute promyelocytic leukemia and viral infection (PubMed:8910577). May play a role in chromatin-mediated regulation of gene expression although it does not bind to histone H3 tails (PubMed:24267382).1 Publication2 Publications

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri690 – 73647PHD-typePROSITE-ProRule annotationAdd
BLAST

GO - Molecular functioni

  1. chromatin binding Source: GO_Central
  2. DNA binding Source: UniProtKB-KW
  3. sequence-specific DNA binding transcription factor activity Source: ProtInc
  4. zinc ion binding Source: InterPro

GO - Biological processi

  1. chromatin remodeling Source: GO_Central
  2. defense response Source: ProtInc
  3. regulation of transcription, DNA-templated Source: GO_Central
Complete GO annotation...

Keywords - Ligandi

DNA-binding, Metal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
Nuclear body protein SP140Imported
Alternative name(s):
Lymphoid-restricted homolog of Sp1001 Publication
Short name:
LYSp1001 Publication
Nuclear autoantigen Sp-1401 Publication
Speckled 140 kDa1 Publication
Gene namesi
Name:SP140Imported
Synonyms:LYSP1001 Publication
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640 Componenti: Chromosome 2

Organism-specific databases

HGNCiHGNC:17133. SP140.

Subcellular locationi

  1. Nucleus 2 Publications
  2. NucleusPML body 2 Publications
  3. Cytoplasm 1 Publication

  4. Note: Localized to nuclear structures termed LANDS, for LYSp100-associated nuclear domains. LANDS are globular, electron-dense structures most often found in the nucleoplasm, but also found at the nuclear membrane and in the cytoplasm, suggesting that these structures may traffic between the cytoplasm and the nucleus (PubMed:8695863). Also colocalizes with PML in a subset of PML nuclear bodies (PubMed:8910577).2 Publications

GO - Cellular componenti

  1. cytoplasm Source: UniProtKB-SubCell
  2. nuclear envelope Source: ProtInc
  3. nucleoplasm Source: ProtInc
  4. nucleus Source: GO_Central
  5. PML body Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA38205.

Polymorphism and mutation databases

BioMutaiSP140.
DMDMi218511671.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 867867Nuclear body protein SP140PRO_0000211206Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei726 – 7261Phosphothreonine1 Publication

Post-translational modificationi

Phosphorylation at Thr-726 promotes binding of PIN1 and subsequent isomerization of Pro-727.1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ13342.
PaxDbiQ13342.
PRIDEiQ13342.

PTM databases

PhosphoSiteiQ13342.

Expressioni

Tissue specificityi

High levels in spleen and peripheral blood leukocytes, much lower levels in tonsils, thymus, prostate, ovary, small intestine, and colon (PubMed:8695863, PubMed:8910577.) Very low levels in heart, brain, placenta, lung, liver, skeletal muscle, kidney, and pancreas (PubMed:8910577). Not detected in brain, liver and muscle (PubMed:8695863).2 Publications

Inductioni

By gamma-interferon.1 Publication

Gene expression databases

BgeeiQ13342.
CleanExiHS_SP140.
ExpressionAtlasiQ13342. baseline and differential.
GenevestigatoriQ13342.

Organism-specific databases

HPAiHPA006162.

Interactioni

Subunit structurei

Interacts with PIN1.1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
PIN1Q135264EBI-2865100,EBI-714158

Protein-protein interaction databases

BioGridi116422. 2 interactions.
IntActiQ13342. 3 interactions.
MINTiMINT-6631209.
STRINGi9606.ENSP00000375899.

Structurei

Secondary structure

1
867
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Helixi694 – 6974Combined sources
Helixi706 – 7127Combined sources
Helixi715 – 7173Combined sources
Beta strandi722 – 7243Combined sources
Helixi731 – 7355Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2MD7NMR-B687-738[»]
2MD8NMR-C687-738[»]
ProteinModelPortaliQ13342.
SMRiQ13342. Positions 580-669, 687-864.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini22 – 138117HSRPROSITE-ProRule annotationAdd
BLAST
Domaini580 – 66182SANDPROSITE-ProRule annotationAdd
BLAST
Domaini796 – 82934BromoPROSITE-ProRule annotationAdd
BLAST

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi495 – 51420Nuclear localization signalSequence AnalysisAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi784 – 7874Poly-Tyr

Sequence similaritiesi

Contains 1 bromo domain.PROSITE-ProRule annotation
Contains 1 HSR domain.PROSITE-ProRule annotation
Contains 1 PHD-type zinc finger.PROSITE-ProRule annotation
Contains 1 SAND domain.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri690 – 73647PHD-typePROSITE-ProRule annotationAdd
BLAST

Keywords - Domaini

Bromodomain, Zinc-finger

Phylogenomic databases

eggNOGiNOG300534.
GeneTreeiENSGT00510000046835.
HOGENOMiHOG000089984.
HOVERGENiHBG006294.
InParanoidiQ13342.
OMAiGILVKCI.
OrthoDBiEOG7G1V5G.
PhylomeDBiQ13342.
TreeFamiTF335091.

Family and domain databases

Gene3Di1.20.920.10. 1 hit.
3.10.390.10. 1 hit.
3.30.40.10. 1 hit.
InterProiIPR001487. Bromodomain.
IPR004865. HSR_dom.
IPR000770. SAND_dom.
IPR010919. SAND_dom-like.
IPR030411. SP140.
IPR019786. Zinc_finger_PHD-type_CS.
IPR011011. Znf_FYVE_PHD.
IPR001965. Znf_PHD.
IPR019787. Znf_PHD-finger.
IPR013083. Znf_RING/FYVE/PHD.
[Graphical view]
PANTHERiPTHR13711:SF1. PTHR13711:SF1. 1 hit.
PfamiPF00439. Bromodomain. 1 hit.
PF00628. PHD. 1 hit.
PF01342. SAND. 1 hit.
PF03172. Sp100. 1 hit.
[Graphical view]
SMARTiSM00297. BROMO. 1 hit.
SM00249. PHD. 1 hit.
SM00258. SAND. 1 hit.
[Graphical view]
SUPFAMiSSF47370. SSF47370. 1 hit.
SSF57903. SSF57903. 1 hit.
SSF63763. SSF63763. 1 hit.
PROSITEiPS50014. BROMODOMAIN_2. 1 hit.
PS51414. HSR. 1 hit.
PS50864. SAND. 1 hit.
PS01359. ZF_PHD_1. 1 hit.
PS50016. ZF_PHD_2. 1 hit.
[Graphical view]

Sequences (6)i

Sequence statusi: Complete.

This entry describes 6 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform LYSp100-B1 Publication (identifier: Q13342-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAQQGQQGQM ASGDSNLNFR MVAEIQNVEG QNLQEQVCPE PIFRFFRENK
60 70 80 90 100
VEIASAITRP FPFLMGLRDR SFISEQMYEH FQEAFRNLVP VTRVMYCVLS
110 120 130 140 150
ELEKTFGWSH LEALFSRINL MAYPDLNEIY RSFQNVCYEH SPLQMNNVND
160 170 180 190 200
LEDRPRLLPY GKQENSNACH EMDDIAVPQE ALSSSPRCEP GFSSESCEQL
210 220 230 240 250
ALPKAGGGDA EDAPSLLPGG GVSCKLAIQI DEGESEEMPK LLPYDTEVLE
260 270 280 290 300
SNGMIDAART YSTAPGEKQG EEEGRNSPRK RNQDKEKYQE SPEGRDKETF
310 320 330 340 350
DLKTPQVTNE GEPEKGLCLL PGEGEEGSDD CSEMCDGEEP QEASSSLARC
360 370 380 390 400
GSVSCLSAET FDLKTPQVTN EGEPEKELSL LPGEGEEGSD DCSEMCDGEE
410 420 430 440 450
RQEASSSLAR RGSVSSELEN HPMNEEGESE ELASSLLYDN VPGAEQSAYE
460 470 480 490 500
NEKCSCVMCF SEEVPGSPEA RTESDQACGT MDTVDIANNS TLGKPKRKRR
510 520 530 540 550
KKRGHGWSRM RMRRQENSQQ NDNSKADGQV VSSEKKANVN LKDLSKIRGR
560 570 580 590 600
KRGKPGTRFT QSDRAAQKRV RSRASRKHKD ETVDFKAPLL PVTCGGVKGI
610 620 630 640 650
LHKKKLQQGI LVKCIQTEDG KWFTPTEFEI KGGHARSKNW RLSVRCGGWP
660 670 680 690 700
LRWLMENGFL PDPPRIRYRK KKRILKSQNN SSVDPCMRNL DECEVCRDGG
710 720 730 740 750
ELFCCDTCSR VFHEDCHIPP VEAERTPWNC IFCRMKESPG SQQCCQESEV
760 770 780 790 800
LERQMCPEEQ LKCEFLLLKV YCCSESSFFA KIPYYYYIRE ACQGLKEPMW
810 820 830 840 850
LDKIKKRLNE HGYPQVEGFV QDMRLIFQNH RASYKYKDFG QMGFRLEAEF
860
EKNFKEVFAI QETNGNN
Length:867
Mass (Da):98,223
Last modified:December 16, 2008 - v2
Checksum:i355601D1D4689A74
GO
Isoform LYSp100-A1 Publication (identifier: Q13342-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     353-386: Missing.
     405-446: SSSLARRGSV...LYDNVPGAEQ → QKQGRKVIKR...EKRGGMAGAE
     447-867: Missing.

Show »
Length:412
Mass (Da):46,151
Checksum:i093D90128FEBE1EE
GO
Isoform Sp1401 Publication (identifier: Q13342-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     219-221: Missing.
     248-297: Missing.
     326-386: Missing.

Show »
Length:753
Mass (Da):86,010
Checksum:iEAA28FD5FCA8056A
GO
Isoform 4 (identifier: Q13342-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     136-172: VCYEHSPLQMNNVNDLEDRPRLLPYGKQENSNACHEM → ENLSSSAVLCQLVSPNKDWRSHEESLAHTGTLRRSCM
     173-867: Missing.

Note: No experimental confirmation available.

Show »
Length:172
Mass (Da):19,965
Checksum:i653BE8A523DFF473
GO
Isoform 5 (identifier: Q13342-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     387-413: Missing.

Note: No experimental confirmation available.

Show »
Length:840
Mass (Da):95,349
Checksum:i7221064EAA37283D
GO
Isoform 6 (identifier: Q13342-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     222-247: Missing.
     353-386: Missing.

Note: No experimental confirmation available.

Show »
Length:807
Mass (Da):91,673
Checksum:i7203F0807D7373B3
GO

Sequence cautioni

The sequence AAB18617.1 differs from that shown. Reason: Frameshift at position 862. Curated
The sequence AAX93282.1 differs from that shown. Reason: Erroneous gene model prediction. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti186 – 1861P → A in AAB18616 (PubMed:8695863).Curated
Sequence conflicti186 – 1861P → A in AAB18617 (PubMed:8695863).Curated
Sequence conflicti186 – 1861P → A in AAC50817 (PubMed:8910577).Curated
Sequence conflicti356 – 3583LSA → FST in AAB18617 (PubMed:8695863).Curated
Sequence conflicti457 – 4571V → D in AAI05744 (PubMed:15489334).Curated
Sequence conflicti838 – 8381D → G in AAB18617 (PubMed:8695863).Curated
Sequence conflicti862 – 8621E → G in AAB18617 (PubMed:8695863).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti356 – 3561L → F.
Corresponds to variant rs3820975 [ dbSNP | Ensembl ].
VAR_055555
Natural varianti512 – 5121M → T.
Corresponds to variant rs4972945 [ dbSNP | Ensembl ].
VAR_055556
Natural varianti516 – 5161E → K.2 Publications
Corresponds to variant rs4972946 [ dbSNP | Ensembl ].
VAR_055557
Natural varianti558 – 5581R → C.
Corresponds to variant rs11887179 [ dbSNP | Ensembl ].
VAR_055558

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei136 – 17237VCYEH…ACHEM → ENLSSSAVLCQLVSPNKDWR SHEESLAHTGTLRRSCM in isoform 4. 1 PublicationVSP_043235Add
BLAST
Alternative sequencei173 – 867695Missing in isoform 4. 1 PublicationVSP_043236Add
BLAST
Alternative sequencei219 – 2213Missing in isoform Sp140. 1 PublicationVSP_055922
Alternative sequencei222 – 24726Missing in isoform 6. 1 PublicationVSP_055923Add
BLAST
Alternative sequencei248 – 29750Missing in isoform Sp140. 1 PublicationVSP_000558Add
BLAST
Alternative sequencei326 – 38661Missing in isoform Sp140. 1 PublicationVSP_000559Add
BLAST
Alternative sequencei353 – 38634Missing in isoform LYSp100-A and isoform 6. 2 PublicationsVSP_000560Add
BLAST
Alternative sequencei387 – 41327Missing in isoform 5. 1 PublicationVSP_055924Add
BLAST
Alternative sequencei405 – 44642SSSLA…PGAEQ → QKQGRKVIKRVAQWILWILQ TTPLWENPRGKEEKRGGMAG AE in isoform LYSp100-A. 1 PublicationVSP_000561Add
BLAST
Alternative sequencei447 – 867421Missing in isoform LYSp100-A. 1 PublicationVSP_000562Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U36499 mRNA. Translation: AAB18616.1.
U36500 mRNA. Translation: AAB18617.1. Frameshift.
U63420 mRNA. Translation: AAC50817.1.
AC009949 Genomic DNA. Translation: AAX88868.1.
AC009950 Genomic DNA. Translation: AAX93282.1. Sequence problems.
CH471063 Genomic DNA. Translation: EAW70922.1.
BC105743 mRNA. Translation: AAI05744.1.
BC105960 mRNA. Translation: AAI05961.1.
BC070160 mRNA. Translation: AAH70160.1.
CCDSiCCDS33392.1. [Q13342-4]
CCDS42831.1. [Q13342-1]
CCDS63149.1. [Q13342-3]
CCDS63150.1. [Q13342-5]
CCDS63151.1. [Q13342-6]
PIRiG02099.
RefSeqiNP_001005176.1. NM_001005176.2. [Q13342-4]
NP_001265380.1. NM_001278451.1. [Q13342-5]
NP_001265381.1. NM_001278452.1. [Q13342-6]
NP_001265382.1. NM_001278453.1. [Q13342-3]
NP_009168.4. NM_007237.4. [Q13342-1]
UniGeneiHs.632549.

Genome annotation databases

EnsembliENST00000343805; ENSP00000342096; ENSG00000079263. [Q13342-6]
ENST00000373645; ENSP00000362749; ENSG00000079263. [Q13342-4]
ENST00000392045; ENSP00000375899; ENSG00000079263. [Q13342-1]
ENST00000417495; ENSP00000393618; ENSG00000079263. [Q13342-3]
ENST00000420434; ENSP00000398210; ENSG00000079263. [Q13342-5]
GeneIDi11262.
KEGGihsa:11262.
UCSCiuc002vqk.2. human. [Q13342-2]
uc002vql.3. human. [Q13342-1]
uc002vqn.3. human. [Q13342-3]

Polymorphism and mutation databases

BioMutaiSP140.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U36499 mRNA. Translation: AAB18616.1.
U36500 mRNA. Translation: AAB18617.1. Frameshift.
U63420 mRNA. Translation: AAC50817.1.
AC009949 Genomic DNA. Translation: AAX88868.1.
AC009950 Genomic DNA. Translation: AAX93282.1. Sequence problems.
CH471063 Genomic DNA. Translation: EAW70922.1.
BC105743 mRNA. Translation: AAI05744.1.
BC105960 mRNA. Translation: AAI05961.1.
BC070160 mRNA. Translation: AAH70160.1.
CCDSiCCDS33392.1. [Q13342-4]
CCDS42831.1. [Q13342-1]
CCDS63149.1. [Q13342-3]
CCDS63150.1. [Q13342-5]
CCDS63151.1. [Q13342-6]
PIRiG02099.
RefSeqiNP_001005176.1. NM_001005176.2. [Q13342-4]
NP_001265380.1. NM_001278451.1. [Q13342-5]
NP_001265381.1. NM_001278452.1. [Q13342-6]
NP_001265382.1. NM_001278453.1. [Q13342-3]
NP_009168.4. NM_007237.4. [Q13342-1]
UniGeneiHs.632549.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2MD7NMR-B687-738[»]
2MD8NMR-C687-738[»]
ProteinModelPortaliQ13342.
SMRiQ13342. Positions 580-669, 687-864.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi116422. 2 interactions.
IntActiQ13342. 3 interactions.
MINTiMINT-6631209.
STRINGi9606.ENSP00000375899.

Chemistry

ChEMBLiCHEMBL3108643.

PTM databases

PhosphoSiteiQ13342.

Polymorphism and mutation databases

BioMutaiSP140.
DMDMi218511671.

Proteomic databases

MaxQBiQ13342.
PaxDbiQ13342.
PRIDEiQ13342.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000343805; ENSP00000342096; ENSG00000079263. [Q13342-6]
ENST00000373645; ENSP00000362749; ENSG00000079263. [Q13342-4]
ENST00000392045; ENSP00000375899; ENSG00000079263. [Q13342-1]
ENST00000417495; ENSP00000393618; ENSG00000079263. [Q13342-3]
ENST00000420434; ENSP00000398210; ENSG00000079263. [Q13342-5]
GeneIDi11262.
KEGGihsa:11262.
UCSCiuc002vqk.2. human. [Q13342-2]
uc002vql.3. human. [Q13342-1]
uc002vqn.3. human. [Q13342-3]

Organism-specific databases

CTDi11262.
GeneCardsiGC02P231090.
HGNCiHGNC:17133. SP140.
HPAiHPA006162.
MIMi608602. gene.
neXtProtiNX_Q13342.
PharmGKBiPA38205.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiNOG300534.
GeneTreeiENSGT00510000046835.
HOGENOMiHOG000089984.
HOVERGENiHBG006294.
InParanoidiQ13342.
OMAiGILVKCI.
OrthoDBiEOG7G1V5G.
PhylomeDBiQ13342.
TreeFamiTF335091.

Miscellaneous databases

ChiTaRSiSP140. human.
GenomeRNAii11262.
NextBioi35500193.
PROiQ13342.
SOURCEiSearch...

Gene expression databases

BgeeiQ13342.
CleanExiHS_SP140.
ExpressionAtlasiQ13342. baseline and differential.
GenevestigatoriQ13342.

Family and domain databases

Gene3Di1.20.920.10. 1 hit.
3.10.390.10. 1 hit.
3.30.40.10. 1 hit.
InterProiIPR001487. Bromodomain.
IPR004865. HSR_dom.
IPR000770. SAND_dom.
IPR010919. SAND_dom-like.
IPR030411. SP140.
IPR019786. Zinc_finger_PHD-type_CS.
IPR011011. Znf_FYVE_PHD.
IPR001965. Znf_PHD.
IPR019787. Znf_PHD-finger.
IPR013083. Znf_RING/FYVE/PHD.
[Graphical view]
PANTHERiPTHR13711:SF1. PTHR13711:SF1. 1 hit.
PfamiPF00439. Bromodomain. 1 hit.
PF00628. PHD. 1 hit.
PF01342. SAND. 1 hit.
PF03172. Sp100. 1 hit.
[Graphical view]
SMARTiSM00297. BROMO. 1 hit.
SM00249. PHD. 1 hit.
SM00258. SAND. 1 hit.
[Graphical view]
SUPFAMiSSF47370. SSF47370. 1 hit.
SSF57903. SSF57903. 1 hit.
SSF63763. SSF63763. 1 hit.
PROSITEiPS50014. BROMODOMAIN_2. 1 hit.
PS51414. HSR. 1 hit.
PS50864. SAND. 1 hit.
PS01359. ZF_PHD_1. 1 hit.
PS50016. ZF_PHD_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "LYSP100-associated nuclear domains (LANDs): description of a new class of subnuclear structures and their relationship to PML nuclear bodies."
    Dent A.L., Yewdell J., Puvion-Dutilleul F., Koken M.H.M., de The H., Staudt L.M.
    Blood 88:1423-1426(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS LYSP100-A AND LYSP100-B), SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
  2. "Identification and characterization of a leukocyte-specific component of the nuclear body."
    Bloch D.B., de la Monte S.M., Guigaouri P., Filippov A., Bloch K.D.
    J. Biol. Chem. 271:29198-29204(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM SP140), VARIANT LYS-516, FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY, INDUCTION BY INTERFERON.
    Tissue: Placenta.
  3. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
    Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
    , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
    Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 4; 5 AND 6), VARIANT LYS-516.
  6. "Structure of human Sp140 PHD finger: an atypical fold interacting with Pin1."
    Zucchelli C., Tamburri S., Quilici G., Palagano E., Berardi A., Saare M., Peterson P., Bachi A., Musco G.
    FEBS J. 281:216-231(2014) [PubMed] [Europe PMC] [Abstract]
    Cited for: STRUCTURE BY NMR OF 687-738, FUNCTION, PHOSPHORYLATION AT THR-726, INTERACTION WITH PIN1.

Entry informationi

Entry nameiSP140_HUMAN
AccessioniPrimary (citable) accession number: Q13342
Secondary accession number(s): E7ESH9
, E7EUR5, E9PFJ6, Q0VGE5, Q13341, Q3KR17, Q4ZG66, Q53TG1, Q6NSG4, Q92881, Q96TG3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 15, 1999
Last sequence update: December 16, 2008
Last modified: April 29, 2015
This is version 139 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Miscellaneous

This antigen is recognized by autoantibodies from patients with primary biliary cirrhosis.1 Publication

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.