SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q13342

- SP140_HUMAN

UniProt

Q13342 - SP140_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Nuclear body protein SP140

Gene
SP140, LYSP100
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Component of the nuclear body, also known as nuclear domain 10, PML oncogenic domain, and KR body. May be involved in the pathogenesis of acute promyelocytic leukemia and viral infection. May play a role in chromatin-mediated regulation of gene expression although it doesn't bind to histone H3 tails.1 Publication

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri690 – 73647PHD-typeAdd
BLAST

GO - Molecular functioni

  1. DNA binding Source: UniProtKB-KW
  2. protein binding Source: IntAct
  3. sequence-specific DNA binding transcription factor activity Source: ProtInc
  4. zinc ion binding Source: InterPro

GO - Biological processi

  1. defense response Source: ProtInc
  2. regulation of transcription, DNA-templated Source: GOC
Complete GO annotation...

Keywords - Ligandi

DNA-binding, Metal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
Nuclear body protein SP140
Alternative name(s):
Lymphoid-restricted homolog of Sp100
Short name:
LYSp100
Nuclear autoantigen Sp-140
Speckled 140 kDa
Gene namesi
Name:SP140
Synonyms:LYSP100
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 2

Organism-specific databases

HGNCiHGNC:17133. SP140.

Subcellular locationi

Nucleus. Cytoplasm
Note: Localized to nuclear structures termed LANDS, for LYSp100-associated nuclear domains. LANDS are globular, electron-dense structures most often found in the nucleoplasm, but also found at the nuclear membrane and in the cytoplasm, suggesting that these structures may traffic between the cytoplasm and the nucleus.

GO - Cellular componenti

  1. cytoplasm Source: UniProtKB-SubCell
  2. nuclear envelope Source: ProtInc
  3. nucleoplasm Source: ProtInc
  4. nucleus Source: ProtInc
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA38205.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 867867Nuclear body protein SP140PRO_0000211206Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei726 – 7261Phosphothreonine1 Publication

Post-translational modificationi

Phosphorylation at Thr-726 promotes binding of PIN1 and subsequent isomerization of Pro-727.

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ13342.
PaxDbiQ13342.
PRIDEiQ13342.

PTM databases

PhosphoSiteiQ13342.

Expressioni

Tissue specificityi

High levels in spleen and peripheral blood leukocytes, much lower levels in thymus, prostate, ovary, small intestine, and colon. Very low levels in heart, brain, placenta, lung, liver, skeletal muscle, kidney, and pancreas.

Inductioni

By interferons.

Gene expression databases

ArrayExpressiQ13342.
BgeeiQ13342.
CleanExiHS_SP140.
GenevestigatoriQ13342.

Organism-specific databases

HPAiHPA006162.

Interactioni

Subunit structurei

Interacts with PIN1.1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
PIN1Q135264EBI-2865100,EBI-714158

Protein-protein interaction databases

BioGridi116422. 2 interactions.
IntActiQ13342. 3 interactions.
MINTiMINT-6631209.
STRINGi9606.ENSP00000375899.

Structurei

Secondary structure

1
867
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Helixi694 – 6974
Helixi706 – 7127
Helixi715 – 7173
Beta strandi722 – 7243
Helixi731 – 7355

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2MD7NMR-B687-738[»]
2MD8NMR-C687-738[»]
ProteinModelPortaliQ13342.
SMRiQ13342. Positions 580-669, 687-858.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini22 – 138117HSRAdd
BLAST
Domaini580 – 66182SANDAdd
BLAST
Domaini796 – 82934BromoAdd
BLAST

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi495 – 51420Nuclear localization signal Reviewed predictionAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi784 – 7874Poly-Tyr

Sequence similaritiesi

Contains 1 bromo domain.
Contains 1 HSR domain.
Contains 1 SAND domain.

Zinc finger

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri690 – 73647PHD-typeAdd
BLAST

Keywords - Domaini

Bromodomain, Zinc-finger

Phylogenomic databases

eggNOGiNOG300534.
HOGENOMiHOG000089984.
HOVERGENiHBG006294.
InParanoidiQ13342.
OMAiGILVKCI.
OrthoDBiEOG7G1V5G.
PhylomeDBiQ13342.
TreeFamiTF335091.

Family and domain databases

Gene3Di1.20.920.10. 1 hit.
3.10.390.10. 1 hit.
3.30.40.10. 1 hit.
InterProiIPR001487. Bromodomain.
IPR000770. SAND_dom.
IPR010919. SAND_dom-like.
IPR004865. Sp100.
IPR019786. Zinc_finger_PHD-type_CS.
IPR011011. Znf_FYVE_PHD.
IPR001965. Znf_PHD.
IPR019787. Znf_PHD-finger.
IPR013083. Znf_RING/FYVE/PHD.
[Graphical view]
PfamiPF00439. Bromodomain. 1 hit.
PF00628. PHD. 1 hit.
PF01342. SAND. 1 hit.
PF03172. Sp100. 1 hit.
[Graphical view]
SMARTiSM00297. BROMO. 1 hit.
SM00249. PHD. 1 hit.
SM00258. SAND. 1 hit.
[Graphical view]
SUPFAMiSSF47370. SSF47370. 1 hit.
SSF57903. SSF57903. 1 hit.
SSF63763. SSF63763. 1 hit.
PROSITEiPS50014. BROMODOMAIN_2. 1 hit.
PS51414. HSR. 1 hit.
PS50864. SAND. 1 hit.
PS01359. ZF_PHD_1. 1 hit.
PS50016. ZF_PHD_2. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. Align

Isoform LYSp100-B (identifier: Q13342-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MAQQGQQGQM ASGDSNLNFR MVAEIQNVEG QNLQEQVCPE PIFRFFRENK    50
VEIASAITRP FPFLMGLRDR SFISEQMYEH FQEAFRNLVP VTRVMYCVLS 100
ELEKTFGWSH LEALFSRINL MAYPDLNEIY RSFQNVCYEH SPLQMNNVND 150
LEDRPRLLPY GKQENSNACH EMDDIAVPQE ALSSSPRCEP GFSSESCEQL 200
ALPKAGGGDA EDAPSLLPGG GVSCKLAIQI DEGESEEMPK LLPYDTEVLE 250
SNGMIDAART YSTAPGEKQG EEEGRNSPRK RNQDKEKYQE SPEGRDKETF 300
DLKTPQVTNE GEPEKGLCLL PGEGEEGSDD CSEMCDGEEP QEASSSLARC 350
GSVSCLSAET FDLKTPQVTN EGEPEKELSL LPGEGEEGSD DCSEMCDGEE 400
RQEASSSLAR RGSVSSELEN HPMNEEGESE ELASSLLYDN VPGAEQSAYE 450
NEKCSCVMCF SEEVPGSPEA RTESDQACGT MDTVDIANNS TLGKPKRKRR 500
KKRGHGWSRM RMRRQENSQQ NDNSKADGQV VSSEKKANVN LKDLSKIRGR 550
KRGKPGTRFT QSDRAAQKRV RSRASRKHKD ETVDFKAPLL PVTCGGVKGI 600
LHKKKLQQGI LVKCIQTEDG KWFTPTEFEI KGGHARSKNW RLSVRCGGWP 650
LRWLMENGFL PDPPRIRYRK KKRILKSQNN SSVDPCMRNL DECEVCRDGG 700
ELFCCDTCSR VFHEDCHIPP VEAERTPWNC IFCRMKESPG SQQCCQESEV 750
LERQMCPEEQ LKCEFLLLKV YCCSESSFFA KIPYYYYIRE ACQGLKEPMW 800
LDKIKKRLNE HGYPQVEGFV QDMRLIFQNH RASYKYKDFG QMGFRLEAEF 850
EKNFKEVFAI QETNGNN 867
Length:867
Mass (Da):98,223
Last modified:December 16, 2008 - v2
Checksum:i355601D1D4689A74
GO
Isoform LYSp100-A (identifier: Q13342-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     353-386: Missing.
     405-446: SSSLARRGSV...LYDNVPGAEQ → QKQGRKVIKR...EKRGGMAGAE
     447-867: Missing.

Show »
Length:412
Mass (Da):46,151
Checksum:i093D90128FEBE1EE
GO
Isoform Sp140 (identifier: Q13342-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     248-297: Missing.
     340-400: Missing.

Show »
Length:756
Mass (Da):86,181
Checksum:i9EA10C9CA02D7239
GO
Isoform 4 (identifier: Q13342-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     136-172: VCYEHSPLQMNNVNDLEDRPRLLPYGKQENSNACHEM → ENLSSSAVLCQLVSPNKDWRSHEESLAHTGTLRRSCM
     173-687: Missing.

Note: No experimental confirmation available.

Show »
Length:352
Mass (Da):41,321
Checksum:i7EE207925684DB3A
GO

Sequence cautioni

The sequence AAB18617.1 differs from that shown. Reason: Frameshift at position 862.
The sequence AAX93282.1 differs from that shown. Reason: Erroneous gene model prediction.

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti356 – 3561L → F.
Corresponds to variant rs3820975 [ dbSNP | Ensembl ].
VAR_055555
Natural varianti512 – 5121M → T.
Corresponds to variant rs4972945 [ dbSNP | Ensembl ].
VAR_055556
Natural varianti516 – 5161E → K.1 Publication
Corresponds to variant rs4972946 [ dbSNP | Ensembl ].
VAR_055557
Natural varianti558 – 5581R → C.
Corresponds to variant rs11887179 [ dbSNP | Ensembl ].
VAR_055558

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei136 – 17237VCYEH…ACHEM → ENLSSSAVLCQLVSPNKDWR SHEESLAHTGTLRRSCM in isoform 4. VSP_043235Add
BLAST
Alternative sequencei173 – 687515Missing in isoform 4. VSP_043236Add
BLAST
Alternative sequencei248 – 29750Missing in isoform Sp140. VSP_000558Add
BLAST
Alternative sequencei340 – 40061Missing in isoform Sp140. VSP_000559Add
BLAST
Alternative sequencei353 – 38634Missing in isoform LYSp100-A. VSP_000560Add
BLAST
Alternative sequencei405 – 44642SSSLA…PGAEQ → QKQGRKVIKRVAQWILWILQ TTPLWENPRGKEEKRGGMAG AE in isoform LYSp100-A. VSP_000561Add
BLAST
Alternative sequencei447 – 867421Missing in isoform LYSp100-A. VSP_000562Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti186 – 1861P → A in AAB18616. 1 Publication
Sequence conflicti186 – 1861P → A in AAB18617. 1 Publication
Sequence conflicti186 – 1861P → A in AAC50817. 1 Publication
Sequence conflicti219 – 2213Missing in AAC50817. 1 Publication
Sequence conflicti356 – 3583LSA → FST in AAB18617. 1 Publication
Sequence conflicti838 – 8381D → G in AAB18617. 1 Publication
Sequence conflicti862 – 8621E → G in AAB18617. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U36499 mRNA. Translation: AAB18616.1.
U36500 mRNA. Translation: AAB18617.1. Frameshift.
U63420 mRNA. Translation: AAC50817.1.
AC009949 Genomic DNA. Translation: AAX88868.1.
AC009950 Genomic DNA. Translation: AAX93282.1. Sequence problems.
BC070160 mRNA. Translation: AAH70160.1.
CCDSiCCDS42831.1. [Q13342-1]
PIRiG02099.
RefSeqiNP_001005176.1. NM_001005176.2.
NP_001265380.1. NM_001278451.1.
NP_001265381.1. NM_001278452.1.
NP_001265382.1. NM_001278453.1.
NP_009168.4. NM_007237.4. [Q13342-1]
UniGeneiHs.632549.

Genome annotation databases

EnsembliENST00000373645; ENSP00000362749; ENSG00000079263.
ENST00000392045; ENSP00000375899; ENSG00000079263. [Q13342-1]
GeneIDi11262.
KEGGihsa:11262.
UCSCiuc002vqk.2. human. [Q13342-2]
uc002vql.3. human. [Q13342-1]
uc002vqn.3. human. [Q13342-3]

Polymorphism databases

DMDMi218511671.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U36499 mRNA. Translation: AAB18616.1 .
U36500 mRNA. Translation: AAB18617.1 . Frameshift.
U63420 mRNA. Translation: AAC50817.1 .
AC009949 Genomic DNA. Translation: AAX88868.1 .
AC009950 Genomic DNA. Translation: AAX93282.1 . Sequence problems.
BC070160 mRNA. Translation: AAH70160.1 .
CCDSi CCDS42831.1. [Q13342-1 ]
PIRi G02099.
RefSeqi NP_001005176.1. NM_001005176.2.
NP_001265380.1. NM_001278451.1.
NP_001265381.1. NM_001278452.1.
NP_001265382.1. NM_001278453.1.
NP_009168.4. NM_007237.4. [Q13342-1 ]
UniGenei Hs.632549.

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
2MD7 NMR - B 687-738 [» ]
2MD8 NMR - C 687-738 [» ]
ProteinModelPortali Q13342.
SMRi Q13342. Positions 580-669, 687-858.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 116422. 2 interactions.
IntActi Q13342. 3 interactions.
MINTi MINT-6631209.
STRINGi 9606.ENSP00000375899.

PTM databases

PhosphoSitei Q13342.

Polymorphism databases

DMDMi 218511671.

Proteomic databases

MaxQBi Q13342.
PaxDbi Q13342.
PRIDEi Q13342.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000373645 ; ENSP00000362749 ; ENSG00000079263 .
ENST00000392045 ; ENSP00000375899 ; ENSG00000079263 . [Q13342-1 ]
GeneIDi 11262.
KEGGi hsa:11262.
UCSCi uc002vqk.2. human. [Q13342-2 ]
uc002vql.3. human. [Q13342-1 ]
uc002vqn.3. human. [Q13342-3 ]

Organism-specific databases

CTDi 11262.
GeneCardsi GC02P231090.
HGNCi HGNC:17133. SP140.
HPAi HPA006162.
MIMi 608602. gene.
neXtProti NX_Q13342.
PharmGKBi PA38205.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG300534.
HOGENOMi HOG000089984.
HOVERGENi HBG006294.
InParanoidi Q13342.
OMAi GILVKCI.
OrthoDBi EOG7G1V5G.
PhylomeDBi Q13342.
TreeFami TF335091.

Miscellaneous databases

ChiTaRSi SP140. human.
GenomeRNAii 11262.
NextBioi 42859.
PROi Q13342.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q13342.
Bgeei Q13342.
CleanExi HS_SP140.
Genevestigatori Q13342.

Family and domain databases

Gene3Di 1.20.920.10. 1 hit.
3.10.390.10. 1 hit.
3.30.40.10. 1 hit.
InterProi IPR001487. Bromodomain.
IPR000770. SAND_dom.
IPR010919. SAND_dom-like.
IPR004865. Sp100.
IPR019786. Zinc_finger_PHD-type_CS.
IPR011011. Znf_FYVE_PHD.
IPR001965. Znf_PHD.
IPR019787. Znf_PHD-finger.
IPR013083. Znf_RING/FYVE/PHD.
[Graphical view ]
Pfami PF00439. Bromodomain. 1 hit.
PF00628. PHD. 1 hit.
PF01342. SAND. 1 hit.
PF03172. Sp100. 1 hit.
[Graphical view ]
SMARTi SM00297. BROMO. 1 hit.
SM00249. PHD. 1 hit.
SM00258. SAND. 1 hit.
[Graphical view ]
SUPFAMi SSF47370. SSF47370. 1 hit.
SSF57903. SSF57903. 1 hit.
SSF63763. SSF63763. 1 hit.
PROSITEi PS50014. BROMODOMAIN_2. 1 hit.
PS51414. HSR. 1 hit.
PS50864. SAND. 1 hit.
PS01359. ZF_PHD_1. 1 hit.
PS50016. ZF_PHD_2. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "LYSP100-associated nuclear domains (LANDs): description of a new class of subnuclear structures and their relationship to PML nuclear bodies."
    Dent A.L., Yewdell J., Puvion-Dutilleul F., Koken M.H.M., de The H., Staudt L.M.
    Blood 88:1423-1426(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS LYSP100-A AND LYSP100-B).
  2. "Identification and characterization of a leukocyte-specific component of the nuclear body."
    Bloch D.B., de la Monte S.M., Guigaouri P., Filippov A., Bloch K.D.
    J. Biol. Chem. 271:29198-29204(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM SP140), VARIANT LYS-516.
    Tissue: Placenta.
  3. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
    Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
    , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
    Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
  5. "Structure of human Sp140 PHD finger: an atypical fold interacting with Pin1."
    Zucchelli C., Tamburri S., Quilici G., Palagano E., Berardi A., Saare M., Peterson P., Bachi A., Musco G.
    FEBS J. 281:216-231(2014) [PubMed] [Europe PMC] [Abstract]
    Cited for: STRUCTURE BY NMR OF 687-738, FUNCTION, PHOSPHORYLATION AT THR-726, INTERACTION WITH PIN1.

Entry informationi

Entry nameiSP140_HUMAN
AccessioniPrimary (citable) accession number: Q13342
Secondary accession number(s): Q13341
, Q4ZG66, Q53TG1, Q6NSG4, Q92881, Q96TG3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 15, 1999
Last sequence update: December 16, 2008
Last modified: July 9, 2014
This is version 132 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Miscellaneous

This antigen is recognized by autoantibodies from patients with primary biliary cirrhosis.

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi