Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Nuclear body protein SP140

Gene

SP140

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Component of the nuclear body, also known as nuclear domain 10, PML oncogenic domain, and KR body (PubMed:8910577). May be involved in the pathogenesis of acute promyelocytic leukemia and viral infection (PubMed:8910577). May play a role in chromatin-mediated regulation of gene expression although it does not bind to histone H3 tails (PubMed:24267382).1 Publication2 Publications

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri690 – 736PHD-typePROSITE-ProRule annotationAdd BLAST47

GO - Molecular functioni

  • DNA binding Source: UniProtKB-KW
  • transcription factor activity, sequence-specific DNA binding Source: ProtInc
  • zinc ion binding Source: InterPro

GO - Biological processi

  • defense response Source: ProtInc
Complete GO annotation...

Keywords - Ligandi

DNA-binding, Metal-binding, Zinc

Enzyme and pathway databases

BioCyciZFISH:ENSG00000079263-MONOMER.

Names & Taxonomyi

Protein namesi
Recommended name:
Nuclear body protein SP140Imported
Alternative name(s):
Lymphoid-restricted homolog of Sp1001 Publication
Short name:
LYSp1001 Publication
Nuclear autoantigen Sp-1401 Publication
Speckled 140 kDa1 Publication
Gene namesi
Name:SP140Imported
Synonyms:LYSP1001 Publication
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 2

Organism-specific databases

HGNCiHGNC:17133. SP140.

Subcellular locationi

  • Nucleus 2 Publications
  • NucleusPML body 2 Publications
  • Cytoplasm 1 Publication

  • Note: Localized to nuclear structures termed LANDS, for LYSp100-associated nuclear domains. LANDS are globular, electron-dense structures most often found in the nucleoplasm, but also found at the nuclear membrane and in the cytoplasm, suggesting that these structures may traffic between the cytoplasm and the nucleus (PubMed:8695863). Also colocalizes with PML in a subset of PML nuclear bodies (PubMed:8910577).2 Publications

GO - Cellular componenti

  • mitochondrion Source: HPA
  • nuclear envelope Source: ProtInc
  • nucleolus Source: HPA
  • nucleoplasm Source: ProtInc
  • nucleus Source: ProtInc
  • PML body Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi11262.
OpenTargetsiENSG00000079263.
PharmGKBiPA38205.

Chemistry databases

ChEMBLiCHEMBL3108643.

Polymorphism and mutation databases

BioMutaiSP140.
DMDMi218511671.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002112061 – 867Nuclear body protein SP140Add BLAST867

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei726Phosphothreonine1 Publication1

Post-translational modificationi

Phosphorylation at Thr-726 promotes binding of PIN1 and subsequent isomerization of Pro-727.1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ13342.
MaxQBiQ13342.
PaxDbiQ13342.
PeptideAtlasiQ13342.
PRIDEiQ13342.

PTM databases

iPTMnetiQ13342.
PhosphoSitePlusiQ13342.

Expressioni

Tissue specificityi

High levels in spleen and peripheral blood leukocytes, much lower levels in tonsils, thymus, prostate, ovary, small intestine, and colon (PubMed:8695863, PubMed:8910577.) Very low levels in heart, brain, placenta, lung, liver, skeletal muscle, kidney, and pancreas (PubMed:8910577). Not detected in brain, liver and muscle (PubMed:8695863).2 Publications

Inductioni

By gamma-interferon.1 Publication

Gene expression databases

BgeeiENSG00000079263.
CleanExiHS_SP140.
ExpressionAtlasiQ13342. baseline and differential.
GenevisibleiQ13342. HS.

Organism-specific databases

HPAiHPA006162.
HPA067493.

Interactioni

Subunit structurei

Interacts with PIN1.1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
PIN1Q135264EBI-2865100,EBI-714158

Protein-protein interaction databases

BioGridi116422. 1 interactor.
IntActiQ13342. 3 interactors.
MINTiMINT-6631209.
STRINGi9606.ENSP00000375899.

Structurei

Secondary structure

1867
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi694 – 697Combined sources4
Helixi706 – 712Combined sources7
Helixi715 – 717Combined sources3
Beta strandi722 – 724Combined sources3
Helixi731 – 735Combined sources5

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2MD7NMR-B687-738[»]
2MD8NMR-C687-738[»]
ProteinModelPortaliQ13342.
SMRiQ13342.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini22 – 138HSRPROSITE-ProRule annotationAdd BLAST117
Domaini580 – 661SANDPROSITE-ProRule annotationAdd BLAST82
Domaini796 – 829BromoPROSITE-ProRule annotationAdd BLAST34

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi495 – 514Nuclear localization signalSequence analysisAdd BLAST20

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi784 – 787Poly-Tyr4

Sequence similaritiesi

Contains 1 bromo domain.PROSITE-ProRule annotation
Contains 1 HSR domain.PROSITE-ProRule annotation
Contains 1 PHD-type zinc finger.PROSITE-ProRule annotation
Contains 1 SAND domain.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri690 – 736PHD-typePROSITE-ProRule annotationAdd BLAST47

Keywords - Domaini

Bromodomain, Zinc-finger

Phylogenomic databases

eggNOGiKOG2177. Eukaryota.
ENOG4111G04. LUCA.
GeneTreeiENSGT00510000046835.
HOGENOMiHOG000089984.
HOVERGENiHBG006294.
InParanoidiQ13342.
OMAiSSPRCEP.
OrthoDBiEOG091G01MN.
PhylomeDBiQ13342.
TreeFamiTF335091.

Family and domain databases

Gene3Di1.20.920.10. 1 hit.
3.10.390.10. 1 hit.
3.30.40.10. 1 hit.
InterProiIPR001487. Bromodomain.
IPR004865. HSR_dom.
IPR000770. SAND_dom.
IPR010919. SAND_dom-like.
IPR019786. Zinc_finger_PHD-type_CS.
IPR011011. Znf_FYVE_PHD.
IPR001965. Znf_PHD.
IPR019787. Znf_PHD-finger.
IPR013083. Znf_RING/FYVE/PHD.
[Graphical view]
PfamiPF00439. Bromodomain. 1 hit.
PF03172. HSR. 1 hit.
PF01342. SAND. 1 hit.
[Graphical view]
SMARTiSM00297. BROMO. 1 hit.
SM00249. PHD. 1 hit.
SM00258. SAND. 1 hit.
[Graphical view]
SUPFAMiSSF47370. SSF47370. 1 hit.
SSF57903. SSF57903. 1 hit.
SSF63763. SSF63763. 1 hit.
PROSITEiPS50014. BROMODOMAIN_2. 1 hit.
PS51414. HSR. 1 hit.
PS50864. SAND. 1 hit.
PS01359. ZF_PHD_1. 1 hit.
PS50016. ZF_PHD_2. 1 hit.
[Graphical view]

Sequences (6)i

Sequence statusi: Complete.

This entry describes 6 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform LYSp100-B1 Publication (identifier: Q13342-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAQQGQQGQM ASGDSNLNFR MVAEIQNVEG QNLQEQVCPE PIFRFFRENK
60 70 80 90 100
VEIASAITRP FPFLMGLRDR SFISEQMYEH FQEAFRNLVP VTRVMYCVLS
110 120 130 140 150
ELEKTFGWSH LEALFSRINL MAYPDLNEIY RSFQNVCYEH SPLQMNNVND
160 170 180 190 200
LEDRPRLLPY GKQENSNACH EMDDIAVPQE ALSSSPRCEP GFSSESCEQL
210 220 230 240 250
ALPKAGGGDA EDAPSLLPGG GVSCKLAIQI DEGESEEMPK LLPYDTEVLE
260 270 280 290 300
SNGMIDAART YSTAPGEKQG EEEGRNSPRK RNQDKEKYQE SPEGRDKETF
310 320 330 340 350
DLKTPQVTNE GEPEKGLCLL PGEGEEGSDD CSEMCDGEEP QEASSSLARC
360 370 380 390 400
GSVSCLSAET FDLKTPQVTN EGEPEKELSL LPGEGEEGSD DCSEMCDGEE
410 420 430 440 450
RQEASSSLAR RGSVSSELEN HPMNEEGESE ELASSLLYDN VPGAEQSAYE
460 470 480 490 500
NEKCSCVMCF SEEVPGSPEA RTESDQACGT MDTVDIANNS TLGKPKRKRR
510 520 530 540 550
KKRGHGWSRM RMRRQENSQQ NDNSKADGQV VSSEKKANVN LKDLSKIRGR
560 570 580 590 600
KRGKPGTRFT QSDRAAQKRV RSRASRKHKD ETVDFKAPLL PVTCGGVKGI
610 620 630 640 650
LHKKKLQQGI LVKCIQTEDG KWFTPTEFEI KGGHARSKNW RLSVRCGGWP
660 670 680 690 700
LRWLMENGFL PDPPRIRYRK KKRILKSQNN SSVDPCMRNL DECEVCRDGG
710 720 730 740 750
ELFCCDTCSR VFHEDCHIPP VEAERTPWNC IFCRMKESPG SQQCCQESEV
760 770 780 790 800
LERQMCPEEQ LKCEFLLLKV YCCSESSFFA KIPYYYYIRE ACQGLKEPMW
810 820 830 840 850
LDKIKKRLNE HGYPQVEGFV QDMRLIFQNH RASYKYKDFG QMGFRLEAEF
860
EKNFKEVFAI QETNGNN
Length:867
Mass (Da):98,223
Last modified:December 16, 2008 - v2
Checksum:i355601D1D4689A74
GO
Isoform LYSp100-A1 Publication (identifier: Q13342-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     353-386: Missing.
     405-446: SSSLARRGSV...LYDNVPGAEQ → QKQGRKVIKR...EKRGGMAGAE
     447-867: Missing.

Show »
Length:412
Mass (Da):46,151
Checksum:i093D90128FEBE1EE
GO
Isoform Sp1401 Publication (identifier: Q13342-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     219-221: Missing.
     248-297: Missing.
     326-386: Missing.

Show »
Length:753
Mass (Da):86,010
Checksum:iEAA28FD5FCA8056A
GO
Isoform 4 (identifier: Q13342-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     136-172: VCYEHSPLQMNNVNDLEDRPRLLPYGKQENSNACHEM → ENLSSSAVLCQLVSPNKDWRSHEESLAHTGTLRRSCM
     173-867: Missing.

Note: No experimental confirmation available.
Show »
Length:172
Mass (Da):19,965
Checksum:i653BE8A523DFF473
GO
Isoform 5 (identifier: Q13342-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     387-413: Missing.

Note: No experimental confirmation available.
Show »
Length:840
Mass (Da):95,349
Checksum:i7221064EAA37283D
GO
Isoform 6 (identifier: Q13342-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     222-247: Missing.
     353-386: Missing.

Note: No experimental confirmation available.
Show »
Length:807
Mass (Da):91,673
Checksum:i7203F0807D7373B3
GO

Sequence cautioni

The sequence AAB18617 differs from that shown. Reason: Frameshift at position 862.Curated
The sequence AAX93282 differs from that shown. Reason: Erroneous gene model prediction.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti186P → A in AAB18616 (PubMed:8695863).Curated1
Sequence conflicti186P → A in AAB18617 (PubMed:8695863).Curated1
Sequence conflicti186P → A in AAC50817 (PubMed:8910577).Curated1
Sequence conflicti356 – 358LSA → FST in AAB18617 (PubMed:8695863).Curated3
Sequence conflicti457V → D in AAI05744 (PubMed:15489334).Curated1
Sequence conflicti838D → G in AAB18617 (PubMed:8695863).Curated1
Sequence conflicti862E → G in AAB18617 (PubMed:8695863).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_055555356L → F.Corresponds to variant rs3820975dbSNPEnsembl.1
Natural variantiVAR_055556512M → T.Corresponds to variant rs4972945dbSNPEnsembl.1
Natural variantiVAR_055557516E → K.2 PublicationsCorresponds to variant rs4972946dbSNPEnsembl.1
Natural variantiVAR_055558558R → C.Corresponds to variant rs11887179dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_043235136 – 172VCYEH…ACHEM → ENLSSSAVLCQLVSPNKDWR SHEESLAHTGTLRRSCM in isoform 4. 1 PublicationAdd BLAST37
Alternative sequenceiVSP_043236173 – 867Missing in isoform 4. 1 PublicationAdd BLAST695
Alternative sequenceiVSP_055922219 – 221Missing in isoform Sp140. 1 Publication3
Alternative sequenceiVSP_055923222 – 247Missing in isoform 6. 1 PublicationAdd BLAST26
Alternative sequenceiVSP_000558248 – 297Missing in isoform Sp140. 1 PublicationAdd BLAST50
Alternative sequenceiVSP_000559326 – 386Missing in isoform Sp140. 1 PublicationAdd BLAST61
Alternative sequenceiVSP_000560353 – 386Missing in isoform LYSp100-A and isoform 6. 2 PublicationsAdd BLAST34
Alternative sequenceiVSP_055924387 – 413Missing in isoform 5. 1 PublicationAdd BLAST27
Alternative sequenceiVSP_000561405 – 446SSSLA…PGAEQ → QKQGRKVIKRVAQWILWILQ TTPLWENPRGKEEKRGGMAG AE in isoform LYSp100-A. 1 PublicationAdd BLAST42
Alternative sequenceiVSP_000562447 – 867Missing in isoform LYSp100-A. 1 PublicationAdd BLAST421

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U36499 mRNA. Translation: AAB18616.1.
U36500 mRNA. Translation: AAB18617.1. Frameshift.
U63420 mRNA. Translation: AAC50817.1.
AC009949 Genomic DNA. Translation: AAX88868.1.
AC009950 Genomic DNA. Translation: AAX93282.1. Sequence problems.
CH471063 Genomic DNA. Translation: EAW70922.1.
BC105743 mRNA. Translation: AAI05744.1.
BC105960 mRNA. Translation: AAI05961.1.
BC070160 mRNA. Translation: AAH70160.1.
CCDSiCCDS33392.1. [Q13342-4]
CCDS42831.1. [Q13342-1]
CCDS63149.1. [Q13342-3]
CCDS63150.1. [Q13342-5]
CCDS63151.1. [Q13342-6]
PIRiG02099.
RefSeqiNP_001005176.1. NM_001005176.2. [Q13342-4]
NP_001265380.1. NM_001278451.1. [Q13342-5]
NP_001265381.1. NM_001278452.1. [Q13342-6]
NP_001265382.1. NM_001278453.1. [Q13342-3]
NP_009168.4. NM_007237.4. [Q13342-1]
UniGeneiHs.632549.

Genome annotation databases

EnsembliENST00000343805; ENSP00000342096; ENSG00000079263. [Q13342-6]
ENST00000373645; ENSP00000362749; ENSG00000079263. [Q13342-4]
ENST00000392045; ENSP00000375899; ENSG00000079263. [Q13342-1]
ENST00000417495; ENSP00000393618; ENSG00000079263. [Q13342-3]
ENST00000420434; ENSP00000398210; ENSG00000079263. [Q13342-5]
GeneIDi11262.
KEGGihsa:11262.
UCSCiuc002vqj.4. human. [Q13342-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U36499 mRNA. Translation: AAB18616.1.
U36500 mRNA. Translation: AAB18617.1. Frameshift.
U63420 mRNA. Translation: AAC50817.1.
AC009949 Genomic DNA. Translation: AAX88868.1.
AC009950 Genomic DNA. Translation: AAX93282.1. Sequence problems.
CH471063 Genomic DNA. Translation: EAW70922.1.
BC105743 mRNA. Translation: AAI05744.1.
BC105960 mRNA. Translation: AAI05961.1.
BC070160 mRNA. Translation: AAH70160.1.
CCDSiCCDS33392.1. [Q13342-4]
CCDS42831.1. [Q13342-1]
CCDS63149.1. [Q13342-3]
CCDS63150.1. [Q13342-5]
CCDS63151.1. [Q13342-6]
PIRiG02099.
RefSeqiNP_001005176.1. NM_001005176.2. [Q13342-4]
NP_001265380.1. NM_001278451.1. [Q13342-5]
NP_001265381.1. NM_001278452.1. [Q13342-6]
NP_001265382.1. NM_001278453.1. [Q13342-3]
NP_009168.4. NM_007237.4. [Q13342-1]
UniGeneiHs.632549.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2MD7NMR-B687-738[»]
2MD8NMR-C687-738[»]
ProteinModelPortaliQ13342.
SMRiQ13342.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi116422. 1 interactor.
IntActiQ13342. 3 interactors.
MINTiMINT-6631209.
STRINGi9606.ENSP00000375899.

Chemistry databases

ChEMBLiCHEMBL3108643.

PTM databases

iPTMnetiQ13342.
PhosphoSitePlusiQ13342.

Polymorphism and mutation databases

BioMutaiSP140.
DMDMi218511671.

Proteomic databases

EPDiQ13342.
MaxQBiQ13342.
PaxDbiQ13342.
PeptideAtlasiQ13342.
PRIDEiQ13342.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000343805; ENSP00000342096; ENSG00000079263. [Q13342-6]
ENST00000373645; ENSP00000362749; ENSG00000079263. [Q13342-4]
ENST00000392045; ENSP00000375899; ENSG00000079263. [Q13342-1]
ENST00000417495; ENSP00000393618; ENSG00000079263. [Q13342-3]
ENST00000420434; ENSP00000398210; ENSG00000079263. [Q13342-5]
GeneIDi11262.
KEGGihsa:11262.
UCSCiuc002vqj.4. human. [Q13342-1]

Organism-specific databases

CTDi11262.
DisGeNETi11262.
GeneCardsiSP140.
HGNCiHGNC:17133. SP140.
HPAiHPA006162.
HPA067493.
MIMi608602. gene.
neXtProtiNX_Q13342.
OpenTargetsiENSG00000079263.
PharmGKBiPA38205.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG2177. Eukaryota.
ENOG4111G04. LUCA.
GeneTreeiENSGT00510000046835.
HOGENOMiHOG000089984.
HOVERGENiHBG006294.
InParanoidiQ13342.
OMAiSSPRCEP.
OrthoDBiEOG091G01MN.
PhylomeDBiQ13342.
TreeFamiTF335091.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000079263-MONOMER.

Miscellaneous databases

ChiTaRSiSP140. human.
GenomeRNAii11262.
PROiQ13342.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000079263.
CleanExiHS_SP140.
ExpressionAtlasiQ13342. baseline and differential.
GenevisibleiQ13342. HS.

Family and domain databases

Gene3Di1.20.920.10. 1 hit.
3.10.390.10. 1 hit.
3.30.40.10. 1 hit.
InterProiIPR001487. Bromodomain.
IPR004865. HSR_dom.
IPR000770. SAND_dom.
IPR010919. SAND_dom-like.
IPR019786. Zinc_finger_PHD-type_CS.
IPR011011. Znf_FYVE_PHD.
IPR001965. Znf_PHD.
IPR019787. Znf_PHD-finger.
IPR013083. Znf_RING/FYVE/PHD.
[Graphical view]
PfamiPF00439. Bromodomain. 1 hit.
PF03172. HSR. 1 hit.
PF01342. SAND. 1 hit.
[Graphical view]
SMARTiSM00297. BROMO. 1 hit.
SM00249. PHD. 1 hit.
SM00258. SAND. 1 hit.
[Graphical view]
SUPFAMiSSF47370. SSF47370. 1 hit.
SSF57903. SSF57903. 1 hit.
SSF63763. SSF63763. 1 hit.
PROSITEiPS50014. BROMODOMAIN_2. 1 hit.
PS51414. HSR. 1 hit.
PS50864. SAND. 1 hit.
PS01359. ZF_PHD_1. 1 hit.
PS50016. ZF_PHD_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiSP140_HUMAN
AccessioniPrimary (citable) accession number: Q13342
Secondary accession number(s): E7ESH9
, E7EUR5, E9PFJ6, Q0VGE5, Q13341, Q3KR17, Q4ZG66, Q53TG1, Q6NSG4, Q92881, Q96TG3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 15, 1999
Last sequence update: December 16, 2008
Last modified: November 2, 2016
This is version 153 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Miscellaneous

This antigen is recognized by autoantibodies from patients with primary biliary cirrhosis.1 Publication

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.