Q13342 (LY10_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 120.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Nuclear body protein SP140 Alternative name(s): Lymphoid-restricted homolog of Sp100 Short name=LYSp100 Nuclear autoantigen Sp-140 Speckled 140 kDa | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 867 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | Component of the nuclear body, also known as nuclear domain 10, PML oncogenic domain, and KR body. May be involved in the pathogenesis of acute promyelocytic leukemia and viral infection. |
| Subcellular location | Nucleus. Cytoplasm. Note: Localized to nuclear structures termed LANDS, for LYSp100-associated nuclear domains. LANDS are globular, electron-dense structures most often found in the nucleoplasm, but also found at the nuclear membrane and in the cytoplasm, suggesting that these structures may traffic between the cytoplasm and the nucleus. |
| Tissue specificity | High levels in spleen and peripheral blood leukocytes, much lower levels in thymus, prostate, ovary, small intestine, and colon. Very low levels in heart, brain, placenta, lung, liver, skeletal muscle, kidney, and pancreas. |
| Induction | By interferons. |
| Miscellaneous | This antigen is recognized by autoantibodies from patients with primary biliary cirrhosis. |
| Sequence similarities | Contains 1 bromo domain. Contains 1 HSR domain. Contains 1 PHD-type zinc finger. Contains 1 SAND domain. |
| Sequence caution | The sequence AAB18617.1 differs from that shown. Reason: Frameshift at position 862. The sequence AAX93282.1 differs from that shown. Reason: Erroneous gene model prediction. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cytoplasm Nucleus |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Bromodomain Zinc-finger |
| Ligand | DNA-binding Metal-binding Zinc |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | defense response Traceable author statement Ref.2. Source: ProtInc |
| Cellular_component | cytoplasm Inferred from direct assay. Source: HPA nuclear envelopeTraceable author statement Ref.1. Source: ProtInc nucleolusInferred from direct assay. Source: HPA nucleoplasmTraceable author statement Ref.1. Source: ProtInc |
| Molecular_function | DNA binding Inferred from electronic annotation. Source: UniProtKB-KW sequence-specific DNA binding transcription factor activityTraceable author statement Ref.1. Source: ProtInc zinc ion bindingInferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform LYSp100-B (identifier: Q13342-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform LYSp100-A (identifier: Q13342-2) The sequence of this isoform differs from the canonical sequence as follows: 353-386: Missing. 405-446: SSSLARRGSV...LYDNVPGAEQ → QKQGRKVIKR...EKRGGMAGAE 447-867: Missing. | ||||||
| Isoform Sp140 (identifier: Q13342-3) The sequence of this isoform differs from the canonical sequence as follows: 248-297: Missing. 340-400: Missing. | ||||||
| Isoform 4 (identifier: Q13342-4) The sequence of this isoform differs from the canonical sequence as follows: 136-172: VCYEHSPLQMNNVNDLEDRPRLLPYGKQENSNACHEM → ENLSSSAVLCQLVSPNKDWRSHEESLAHTGTLRRSCM 173-687: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 867 | 867 | Nuclear body protein SP140 | PRO_0000211206 | |||||
Regions | |||||||||
| Domain | 22 – 138 | 117 | HSR | ||||||
| Domain | 580 – 661 | 82 | SAND | ||||||
| Domain | 796 – 829 | 34 | Bromo | ||||||
| Zinc finger | 690 – 736 | 47 | PHD-type | ||||||
| Motif | 495 – 514 | 20 | Nuclear localization signal Potential | ||||||
| Compositional bias | 784 – 787 | 4 | Poly-Tyr | ||||||
Natural variations | |||||||||
| Alternative sequence | 136 – 172 | 37 | VCYEH…ACHEM → ENLSSSAVLCQLVSPNKDWR SHEESLAHTGTLRRSCM in isoform 4. | VSP_043235 | |||||
| Alternative sequence | 173 – 687 | 515 | Missing in isoform 4. | VSP_043236 | |||||
| Alternative sequence | 248 – 297 | 50 | Missing in isoform Sp140. | VSP_000558 | |||||
| Alternative sequence | 340 – 400 | 61 | Missing in isoform Sp140. | VSP_000559 | |||||
| Alternative sequence | 353 – 386 | 34 | Missing in isoform LYSp100-A. | VSP_000560 | |||||
| Alternative sequence | 405 – 446 | 42 | SSSLA…PGAEQ → QKQGRKVIKRVAQWILWILQ TTPLWENPRGKEEKRGGMAG AE in isoform LYSp100-A. | VSP_000561 | |||||
| Alternative sequence | 447 – 867 | 421 | Missing in isoform LYSp100-A. | VSP_000562 | |||||
| Natural variant | 356 | 1 | L → F. Corresponds to variant rs3820975 [ dbSNP | Ensembl ]. | VAR_055555 | |||||
| Natural variant | 512 | 1 | M → T. Corresponds to variant rs4972945 [ dbSNP | Ensembl ]. | VAR_055556 | |||||
| Natural variant | 516 | 1 | E → K. Ref.2 Corresponds to variant rs4972946 [ dbSNP | Ensembl ]. | VAR_055557 | |||||
| Natural variant | 558 | 1 | R → C. Corresponds to variant rs11887179 [ dbSNP | Ensembl ]. | VAR_055558 | |||||
Experimental info | |||||||||
| Sequence conflict | 186 | 1 | P → A in AAB18616. Ref.1 | ||||||
| Sequence conflict | 186 | 1 | P → A in AAB18617. Ref.1 | ||||||
| Sequence conflict | 186 | 1 | P → A in AAC50817. Ref.2 | ||||||
| Sequence conflict | 219 – 221 | 3 | Missing in AAC50817. Ref.2 | ||||||
| Sequence conflict | 356 – 358 | 3 | LSA → FST in AAB18617. Ref.1 | ||||||
| Sequence conflict | 838 | 1 | D → G in AAB18617. Ref.1 | ||||||
| Sequence conflict | 862 | 1 | E → G in AAB18617. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "LYSP100-associated nuclear domains (LANDs): description of a new class of subnuclear structures and their relationship to PML nuclear bodies." Dent A.L., Yewdell J., Puvion-Dutilleul F., Koken M.H.M., de The H., Staudt L.M. Blood 88:1423-1426(1996) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS LYSP100-A AND LYSP100-B). |
| [2] | "Identification and characterization of a leukocyte-specific component of the nuclear body." Bloch D.B., de la Monte S.M., Guigaouri P., Filippov A., Bloch K.D. J. Biol. Chem. 271:29198-29204(1996) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM SP140), VARIANT LYS-516. Tissue: Placenta. |
| [3] | "Generation and annotation of the DNA sequences of human chromosomes 2 and 4." Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. Wilson R.K.Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4). |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | U36499 mRNA. Translation: AAB18616.1. U36500 mRNA. Translation: AAB18617.1. Frameshift. U63420 mRNA. Translation: AAC50817.1. AC009949 Genomic DNA. Translation: AAX88868.1. AC009950 Genomic DNA. Translation: AAX93282.1. Sequence problems. BC070160 mRNA. Translation: AAH70160.1. |
| IPI | IPI00012793. IPI00219535. IPI00219536. IPI00431685. |
| PIR | G02099. |
| RefSeq | NP_001005176.1. NM_001005176.2. NP_009168.4. NM_007237.4. |
| UniGene | Hs.632549. |
3D structure databases | |
| ProteinModelPortal | Q13342. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q13342. 2 interactions. |
| STRING | 9606.ENSP00000375899. |
PTM databases | |
| PhosphoSite | Q13342. |
Polymorphism databases | |
| DMDM | 218511671. |
Proteomic databases | |
| PaxDb | Q13342. |
| PRIDE | Q13342. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000373645; ENSP00000362749; ENSG00000079263. ENST00000392045; ENSP00000375899; ENSG00000079263. |
| GeneID | 11262. |
| KEGG | hsa:11262. |
| UCSC | uc002vql.3. human. uc002vqn.3. human. |
Organism-specific databases | |
| CTD | 11262. |
| GeneCards | GC02P231090. |
| HGNC | HGNC:17133. SP140. |
| HPA | HPA006162. |
| MIM | 608602. gene. |
| neXtProt | NX_Q13342. |
| PharmGKB | PA38205. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG300534. |
| HOGENOM | HOG000089984. |
| HOVERGEN | HBG006294. |
| InParanoid | Q13342. |
| OMA | MCFSEEV. |
| OrthoDB | EOG44QT09. |
Gene expression databases | |
| ArrayExpress | Q13342. |
| Bgee | Q13342. |
| CleanEx | HS_SP140. |
| Genevestigator | Q13342. |
| GermOnline | ENSG00000079263. Homo sapiens. |
Family and domain databases | |
| Gene3D | 1.20.920.10. 1 hit. 3.10.390.10. 1 hit. 3.30.40.10. 1 hit. |
| InterPro | IPR001487. Bromodomain. IPR000770. SAND_dom. IPR010919. SAND_dom-like. IPR004865. Sp100. IPR019786. Zinc_finger_PHD-type_CS. IPR011011. Znf_FYVE_PHD. IPR001965. Znf_PHD. IPR019787. Znf_PHD-finger. IPR013083. Znf_RING/FYVE/PHD. [Graphical view] |
| Pfam | PF00439. Bromodomain. 1 hit. PF00628. PHD. 1 hit. PF01342. SAND. 1 hit. PF03172. Sp100. 1 hit. [Graphical view] |
| SMART | SM00297. BROMO. 1 hit. SM00249. PHD. 1 hit. SM00258. SAND. 1 hit. [Graphical view] |
| SUPFAM | SSF47370. Bromodomain. 1 hit. SSF57903. FYVE_PHD_ZnF. 1 hit. SSF63763. SAND_like. 1 hit. |
| PROSITE | PS00633. BROMODOMAIN_1. False negative. PS50014. BROMODOMAIN_2. 1 hit. PS51414. HSR. 1 hit. PS50864. SAND. 1 hit. PS01359. ZF_PHD_1. 1 hit. PS50016. ZF_PHD_2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | SP140. human. |
| GenomeRNAi | 11262. |
| NextBio | 42859. |
| SOURCE | Search... |
Entry information
| Entry name | LY10_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q13342 Secondary accession number(s): Q13341 Q96TG3 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 2 Human chromosome 2: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
