Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q13342

- SP140_HUMAN

UniProt

Q13342 - SP140_HUMAN

Protein

Nuclear body protein SP140

Gene

SP140

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 133 (01 Oct 2014)
      Sequence version 2 (16 Dec 2008)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Component of the nuclear body, also known as nuclear domain 10, PML oncogenic domain, and KR body. May be involved in the pathogenesis of acute promyelocytic leukemia and viral infection. May play a role in chromatin-mediated regulation of gene expression although it doesn't bind to histone H3 tails.1 Publication

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Zinc fingeri690 – 73647PHD-typePROSITE-ProRule annotationAdd
    BLAST

    GO - Molecular functioni

    1. DNA binding Source: UniProtKB-KW
    2. protein binding Source: IntAct
    3. sequence-specific DNA binding transcription factor activity Source: ProtInc
    4. zinc ion binding Source: InterPro

    GO - Biological processi

    1. defense response Source: ProtInc
    2. regulation of transcription, DNA-templated Source: GOC

    Keywords - Ligandi

    DNA-binding, Metal-binding, Zinc

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Nuclear body protein SP140
    Alternative name(s):
    Lymphoid-restricted homolog of Sp100
    Short name:
    LYSp100
    Nuclear autoantigen Sp-140
    Speckled 140 kDa
    Gene namesi
    Name:SP140
    Synonyms:LYSP100
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 2

    Organism-specific databases

    HGNCiHGNC:17133. SP140.

    Subcellular locationi

    Nucleus. Cytoplasm
    Note: Localized to nuclear structures termed LANDS, for LYSp100-associated nuclear domains. LANDS are globular, electron-dense structures most often found in the nucleoplasm, but also found at the nuclear membrane and in the cytoplasm, suggesting that these structures may traffic between the cytoplasm and the nucleus.

    GO - Cellular componenti

    1. cytoplasm Source: UniProtKB-SubCell
    2. nuclear envelope Source: ProtInc
    3. nucleoplasm Source: ProtInc
    4. nucleus Source: ProtInc

    Keywords - Cellular componenti

    Cytoplasm, Nucleus

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA38205.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 867867Nuclear body protein SP140PRO_0000211206Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei726 – 7261Phosphothreonine1 Publication

    Post-translational modificationi

    Phosphorylation at Thr-726 promotes binding of PIN1 and subsequent isomerization of Pro-727.1 Publication

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    MaxQBiQ13342.
    PaxDbiQ13342.
    PRIDEiQ13342.

    PTM databases

    PhosphoSiteiQ13342.

    Expressioni

    Tissue specificityi

    High levels in spleen and peripheral blood leukocytes, much lower levels in thymus, prostate, ovary, small intestine, and colon. Very low levels in heart, brain, placenta, lung, liver, skeletal muscle, kidney, and pancreas.

    Inductioni

    By interferons.

    Gene expression databases

    ArrayExpressiQ13342.
    BgeeiQ13342.
    CleanExiHS_SP140.
    GenevestigatoriQ13342.

    Organism-specific databases

    HPAiHPA006162.

    Interactioni

    Subunit structurei

    Interacts with PIN1.1 Publication

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    PIN1Q135264EBI-2865100,EBI-714158

    Protein-protein interaction databases

    BioGridi116422. 2 interactions.
    IntActiQ13342. 3 interactions.
    MINTiMINT-6631209.
    STRINGi9606.ENSP00000375899.

    Structurei

    Secondary structure

    1
    867
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Helixi694 – 6974
    Helixi706 – 7127
    Helixi715 – 7173
    Beta strandi722 – 7243
    Helixi731 – 7355

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    2MD7NMR-B687-738[»]
    2MD8NMR-C687-738[»]
    ProteinModelPortaliQ13342.
    SMRiQ13342. Positions 580-669, 687-858.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini22 – 138117HSRPROSITE-ProRule annotationAdd
    BLAST
    Domaini580 – 66182SANDPROSITE-ProRule annotationAdd
    BLAST
    Domaini796 – 82934BromoPROSITE-ProRule annotationAdd
    BLAST

    Motif

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Motifi495 – 51420Nuclear localization signalSequence AnalysisAdd
    BLAST

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi784 – 7874Poly-Tyr

    Sequence similaritiesi

    Contains 1 bromo domain.PROSITE-ProRule annotation
    Contains 1 HSR domain.PROSITE-ProRule annotation
    Contains 1 PHD-type zinc finger.PROSITE-ProRule annotation
    Contains 1 SAND domain.PROSITE-ProRule annotation

    Zinc finger

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Zinc fingeri690 – 73647PHD-typePROSITE-ProRule annotationAdd
    BLAST

    Keywords - Domaini

    Bromodomain, Zinc-finger

    Phylogenomic databases

    eggNOGiNOG300534.
    HOGENOMiHOG000089984.
    HOVERGENiHBG006294.
    InParanoidiQ13342.
    OMAiGILVKCI.
    OrthoDBiEOG7G1V5G.
    PhylomeDBiQ13342.
    TreeFamiTF335091.

    Family and domain databases

    Gene3Di1.20.920.10. 1 hit.
    3.10.390.10. 1 hit.
    3.30.40.10. 1 hit.
    InterProiIPR001487. Bromodomain.
    IPR000770. SAND_dom.
    IPR010919. SAND_dom-like.
    IPR004865. Sp100.
    IPR019786. Zinc_finger_PHD-type_CS.
    IPR011011. Znf_FYVE_PHD.
    IPR001965. Znf_PHD.
    IPR019787. Znf_PHD-finger.
    IPR013083. Znf_RING/FYVE/PHD.
    [Graphical view]
    PfamiPF00439. Bromodomain. 1 hit.
    PF00628. PHD. 1 hit.
    PF01342. SAND. 1 hit.
    PF03172. Sp100. 1 hit.
    [Graphical view]
    SMARTiSM00297. BROMO. 1 hit.
    SM00249. PHD. 1 hit.
    SM00258. SAND. 1 hit.
    [Graphical view]
    SUPFAMiSSF47370. SSF47370. 1 hit.
    SSF57903. SSF57903. 1 hit.
    SSF63763. SSF63763. 1 hit.
    PROSITEiPS50014. BROMODOMAIN_2. 1 hit.
    PS51414. HSR. 1 hit.
    PS50864. SAND. 1 hit.
    PS01359. ZF_PHD_1. 1 hit.
    PS50016. ZF_PHD_2. 1 hit.
    [Graphical view]

    Sequences (6)i

    Sequence statusi: Complete.

    This entry describes 6 isoformsi produced by alternative splicing. Align

    Isoform LYSp100-B (identifier: Q13342-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MAQQGQQGQM ASGDSNLNFR MVAEIQNVEG QNLQEQVCPE PIFRFFRENK    50
    VEIASAITRP FPFLMGLRDR SFISEQMYEH FQEAFRNLVP VTRVMYCVLS 100
    ELEKTFGWSH LEALFSRINL MAYPDLNEIY RSFQNVCYEH SPLQMNNVND 150
    LEDRPRLLPY GKQENSNACH EMDDIAVPQE ALSSSPRCEP GFSSESCEQL 200
    ALPKAGGGDA EDAPSLLPGG GVSCKLAIQI DEGESEEMPK LLPYDTEVLE 250
    SNGMIDAART YSTAPGEKQG EEEGRNSPRK RNQDKEKYQE SPEGRDKETF 300
    DLKTPQVTNE GEPEKGLCLL PGEGEEGSDD CSEMCDGEEP QEASSSLARC 350
    GSVSCLSAET FDLKTPQVTN EGEPEKELSL LPGEGEEGSD DCSEMCDGEE 400
    RQEASSSLAR RGSVSSELEN HPMNEEGESE ELASSLLYDN VPGAEQSAYE 450
    NEKCSCVMCF SEEVPGSPEA RTESDQACGT MDTVDIANNS TLGKPKRKRR 500
    KKRGHGWSRM RMRRQENSQQ NDNSKADGQV VSSEKKANVN LKDLSKIRGR 550
    KRGKPGTRFT QSDRAAQKRV RSRASRKHKD ETVDFKAPLL PVTCGGVKGI 600
    LHKKKLQQGI LVKCIQTEDG KWFTPTEFEI KGGHARSKNW RLSVRCGGWP 650
    LRWLMENGFL PDPPRIRYRK KKRILKSQNN SSVDPCMRNL DECEVCRDGG 700
    ELFCCDTCSR VFHEDCHIPP VEAERTPWNC IFCRMKESPG SQQCCQESEV 750
    LERQMCPEEQ LKCEFLLLKV YCCSESSFFA KIPYYYYIRE ACQGLKEPMW 800
    LDKIKKRLNE HGYPQVEGFV QDMRLIFQNH RASYKYKDFG QMGFRLEAEF 850
    EKNFKEVFAI QETNGNN 867
    Length:867
    Mass (Da):98,223
    Last modified:December 16, 2008 - v2
    Checksum:i355601D1D4689A74
    GO
    Isoform LYSp100-A (identifier: Q13342-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         353-386: Missing.
         405-446: SSSLARRGSV...LYDNVPGAEQ → QKQGRKVIKR...EKRGGMAGAE
         447-867: Missing.

    Show »
    Length:412
    Mass (Da):46,151
    Checksum:i093D90128FEBE1EE
    GO
    Isoform Sp140 (identifier: Q13342-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         219-221: Missing.
         248-297: Missing.
         326-386: Missing.

    Show »
    Length:753
    Mass (Da):86,010
    Checksum:iEAA28FD5FCA8056A
    GO
    Isoform 4 (identifier: Q13342-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         136-172: VCYEHSPLQMNNVNDLEDRPRLLPYGKQENSNACHEM → ENLSSSAVLCQLVSPNKDWRSHEESLAHTGTLRRSCM
         173-867: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:172
    Mass (Da):19,965
    Checksum:i653BE8A523DFF473
    GO
    Isoform 5 (identifier: Q13342-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         387-413: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:840
    Mass (Da):95,349
    Checksum:i7221064EAA37283D
    GO
    Isoform 6 (identifier: Q13342-6) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         222-247: Missing.
         353-386: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:807
    Mass (Da):91,673
    Checksum:i7203F0807D7373B3
    GO

    Sequence cautioni

    The sequence AAB18617.1 differs from that shown. Reason: Frameshift at position 862.
    The sequence AAX93282.1 differs from that shown. Reason: Erroneous gene model prediction.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti186 – 1861P → A in AAB18616. (PubMed:8695863)Curated
    Sequence conflicti186 – 1861P → A in AAB18617. (PubMed:8695863)Curated
    Sequence conflicti186 – 1861P → A in AAC50817. (PubMed:8910577)Curated
    Sequence conflicti356 – 3583LSA → FST in AAB18617. (PubMed:8695863)Curated
    Sequence conflicti457 – 4571V → D in AAI05744. (PubMed:15489334)Curated
    Sequence conflicti838 – 8381D → G in AAB18617. (PubMed:8695863)Curated
    Sequence conflicti862 – 8621E → G in AAB18617. (PubMed:8695863)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti356 – 3561L → F.
    Corresponds to variant rs3820975 [ dbSNP | Ensembl ].
    VAR_055555
    Natural varianti512 – 5121M → T.
    Corresponds to variant rs4972945 [ dbSNP | Ensembl ].
    VAR_055556
    Natural varianti516 – 5161E → K.2 Publications
    Corresponds to variant rs4972946 [ dbSNP | Ensembl ].
    VAR_055557
    Natural varianti558 – 5581R → C.
    Corresponds to variant rs11887179 [ dbSNP | Ensembl ].
    VAR_055558

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei136 – 17237VCYEH…ACHEM → ENLSSSAVLCQLVSPNKDWR SHEESLAHTGTLRRSCM in isoform 4. 1 PublicationVSP_043235Add
    BLAST
    Alternative sequencei173 – 867695Missing in isoform 4. 1 PublicationVSP_043236Add
    BLAST
    Alternative sequencei219 – 2213Missing in isoform Sp140. 1 PublicationVSP_055922
    Alternative sequencei222 – 24726Missing in isoform 6. 1 PublicationVSP_055923Add
    BLAST
    Alternative sequencei248 – 29750Missing in isoform Sp140. 1 PublicationVSP_000558Add
    BLAST
    Alternative sequencei326 – 38661Missing in isoform Sp140. 1 PublicationVSP_000559Add
    BLAST
    Alternative sequencei353 – 38634Missing in isoform LYSp100-A and isoform 6. 2 PublicationsVSP_000560Add
    BLAST
    Alternative sequencei387 – 41327Missing in isoform 5. 1 PublicationVSP_055924Add
    BLAST
    Alternative sequencei405 – 44642SSSLA…PGAEQ → QKQGRKVIKRVAQWILWILQ TTPLWENPRGKEEKRGGMAG AE in isoform LYSp100-A. 1 PublicationVSP_000561Add
    BLAST
    Alternative sequencei447 – 867421Missing in isoform LYSp100-A. 1 PublicationVSP_000562Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U36499 mRNA. Translation: AAB18616.1.
    U36500 mRNA. Translation: AAB18617.1. Frameshift.
    U63420 mRNA. Translation: AAC50817.1.
    AC009949 Genomic DNA. Translation: AAX88868.1.
    AC009950 Genomic DNA. Translation: AAX93282.1. Sequence problems.
    CH471063 Genomic DNA. Translation: EAW70922.1.
    BC105743 mRNA. Translation: AAI05744.1.
    BC105960 mRNA. Translation: AAI05961.1.
    BC070160 mRNA. Translation: AAH70160.1.
    CCDSiCCDS42831.1. [Q13342-1]
    PIRiG02099.
    RefSeqiNP_001005176.1. NM_001005176.2.
    NP_001265380.1. NM_001278451.1.
    NP_001265381.1. NM_001278452.1.
    NP_001265382.1. NM_001278453.1.
    NP_009168.4. NM_007237.4. [Q13342-1]
    UniGeneiHs.632549.

    Genome annotation databases

    EnsembliENST00000343805; ENSP00000342096; ENSG00000079263.
    ENST00000373645; ENSP00000362749; ENSG00000079263.
    ENST00000392045; ENSP00000375899; ENSG00000079263. [Q13342-1]
    ENST00000417495; ENSP00000393618; ENSG00000079263.
    ENST00000420434; ENSP00000398210; ENSG00000079263.
    GeneIDi11262.
    KEGGihsa:11262.
    UCSCiuc002vqk.2. human. [Q13342-2]
    uc002vql.3. human. [Q13342-1]
    uc002vqm.3. human.
    uc002vqn.3. human. [Q13342-3]
    uc010fxl.3. human.

    Polymorphism databases

    DMDMi218511671.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U36499 mRNA. Translation: AAB18616.1 .
    U36500 mRNA. Translation: AAB18617.1 . Frameshift.
    U63420 mRNA. Translation: AAC50817.1 .
    AC009949 Genomic DNA. Translation: AAX88868.1 .
    AC009950 Genomic DNA. Translation: AAX93282.1 . Sequence problems.
    CH471063 Genomic DNA. Translation: EAW70922.1 .
    BC105743 mRNA. Translation: AAI05744.1 .
    BC105960 mRNA. Translation: AAI05961.1 .
    BC070160 mRNA. Translation: AAH70160.1 .
    CCDSi CCDS42831.1. [Q13342-1 ]
    PIRi G02099.
    RefSeqi NP_001005176.1. NM_001005176.2.
    NP_001265380.1. NM_001278451.1.
    NP_001265381.1. NM_001278452.1.
    NP_001265382.1. NM_001278453.1.
    NP_009168.4. NM_007237.4. [Q13342-1 ]
    UniGenei Hs.632549.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    2MD7 NMR - B 687-738 [» ]
    2MD8 NMR - C 687-738 [» ]
    ProteinModelPortali Q13342.
    SMRi Q13342. Positions 580-669, 687-858.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 116422. 2 interactions.
    IntActi Q13342. 3 interactions.
    MINTi MINT-6631209.
    STRINGi 9606.ENSP00000375899.

    PTM databases

    PhosphoSitei Q13342.

    Polymorphism databases

    DMDMi 218511671.

    Proteomic databases

    MaxQBi Q13342.
    PaxDbi Q13342.
    PRIDEi Q13342.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000343805 ; ENSP00000342096 ; ENSG00000079263 .
    ENST00000373645 ; ENSP00000362749 ; ENSG00000079263 .
    ENST00000392045 ; ENSP00000375899 ; ENSG00000079263 . [Q13342-1 ]
    ENST00000417495 ; ENSP00000393618 ; ENSG00000079263 .
    ENST00000420434 ; ENSP00000398210 ; ENSG00000079263 .
    GeneIDi 11262.
    KEGGi hsa:11262.
    UCSCi uc002vqk.2. human. [Q13342-2 ]
    uc002vql.3. human. [Q13342-1 ]
    uc002vqm.3. human.
    uc002vqn.3. human. [Q13342-3 ]
    uc010fxl.3. human.

    Organism-specific databases

    CTDi 11262.
    GeneCardsi GC02P231090.
    HGNCi HGNC:17133. SP140.
    HPAi HPA006162.
    MIMi 608602. gene.
    neXtProti NX_Q13342.
    PharmGKBi PA38205.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG300534.
    HOGENOMi HOG000089984.
    HOVERGENi HBG006294.
    InParanoidi Q13342.
    OMAi GILVKCI.
    OrthoDBi EOG7G1V5G.
    PhylomeDBi Q13342.
    TreeFami TF335091.

    Miscellaneous databases

    ChiTaRSi SP140. human.
    GenomeRNAii 11262.
    NextBioi 42859.
    PROi Q13342.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q13342.
    Bgeei Q13342.
    CleanExi HS_SP140.
    Genevestigatori Q13342.

    Family and domain databases

    Gene3Di 1.20.920.10. 1 hit.
    3.10.390.10. 1 hit.
    3.30.40.10. 1 hit.
    InterProi IPR001487. Bromodomain.
    IPR000770. SAND_dom.
    IPR010919. SAND_dom-like.
    IPR004865. Sp100.
    IPR019786. Zinc_finger_PHD-type_CS.
    IPR011011. Znf_FYVE_PHD.
    IPR001965. Znf_PHD.
    IPR019787. Znf_PHD-finger.
    IPR013083. Znf_RING/FYVE/PHD.
    [Graphical view ]
    Pfami PF00439. Bromodomain. 1 hit.
    PF00628. PHD. 1 hit.
    PF01342. SAND. 1 hit.
    PF03172. Sp100. 1 hit.
    [Graphical view ]
    SMARTi SM00297. BROMO. 1 hit.
    SM00249. PHD. 1 hit.
    SM00258. SAND. 1 hit.
    [Graphical view ]
    SUPFAMi SSF47370. SSF47370. 1 hit.
    SSF57903. SSF57903. 1 hit.
    SSF63763. SSF63763. 1 hit.
    PROSITEi PS50014. BROMODOMAIN_2. 1 hit.
    PS51414. HSR. 1 hit.
    PS50864. SAND. 1 hit.
    PS01359. ZF_PHD_1. 1 hit.
    PS50016. ZF_PHD_2. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "LYSP100-associated nuclear domains (LANDs): description of a new class of subnuclear structures and their relationship to PML nuclear bodies."
      Dent A.L., Yewdell J., Puvion-Dutilleul F., Koken M.H.M., de The H., Staudt L.M.
      Blood 88:1423-1426(1996) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS LYSP100-A AND LYSP100-B).
    2. "Identification and characterization of a leukocyte-specific component of the nuclear body."
      Bloch D.B., de la Monte S.M., Guigaouri P., Filippov A., Bloch K.D.
      J. Biol. Chem. 271:29198-29204(1996) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM SP140), VARIANT LYS-516.
      Tissue: Placenta.
    3. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
      Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
      , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
      Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 4; 5 AND 6), VARIANT LYS-516.
    6. "Structure of human Sp140 PHD finger: an atypical fold interacting with Pin1."
      Zucchelli C., Tamburri S., Quilici G., Palagano E., Berardi A., Saare M., Peterson P., Bachi A., Musco G.
      FEBS J. 281:216-231(2014) [PubMed] [Europe PMC] [Abstract]
      Cited for: STRUCTURE BY NMR OF 687-738, FUNCTION, PHOSPHORYLATION AT THR-726, INTERACTION WITH PIN1.

    Entry informationi

    Entry nameiSP140_HUMAN
    AccessioniPrimary (citable) accession number: Q13342
    Secondary accession number(s): E7ESH9
    , E7EUR5, E9PFJ6, Q0VGE5, Q13341, Q3KR17, Q4ZG66, Q53TG1, Q6NSG4, Q92881, Q96TG3
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: July 15, 1999
    Last sequence update: December 16, 2008
    Last modified: October 1, 2014
    This is version 133 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Miscellaneous

    This antigen is recognized by autoantibodies from patients with primary biliary cirrhosis.

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. Human chromosome 2
      Human chromosome 2: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    6. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3