Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q13336

- UT1_HUMAN

UniProt

Q13336 - UT1_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Urea transporter 1

Gene

SLC14A1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Urea channel that facilitates transmembrane urea transport down a concentration gradient. A constriction of the transmembrane channel functions as selectivity filter through which urea is expected to pass in dehydrated form. The rate of urea conduction is increased by hypotonic stress. Plays an important role in the kidney medulla collecting ducts, where it allows rapid equilibration between the lumen of the collecting ducts and the interstitium, and thereby prevents water loss driven by the high concentration of urea in the urine. Facilitates urea transport across erythrocyte membranes. May also play a role in transmembrane water transport, possibly by indirect means.

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sitei339 – 3391Important for channel permeabilityBy similarity

GO - Molecular functioni

  1. urea channel activity Source: UniProtKB
  2. urea transmembrane transporter activity Source: ProtInc
  3. water transmembrane transporter activity Source: Ensembl

GO - Biological processi

  1. transmembrane transport Source: Reactome
  2. urea transmembrane transport Source: UniProtKB
  3. urea transport Source: ProtInc
Complete GO annotation...

Keywords - Molecular functioni

Blood group antigen

Keywords - Biological processi

Transport

Enzyme and pathway databases

ReactomeiREACT_19305. Transport of glucose and other sugars, bile salts and organic acids, metal ions and amine compounds.

Protein family/group databases

TCDBi1.A.28.1.5. the urea transporter (ut) family.

Names & Taxonomyi

Protein namesi
Recommended name:
Urea transporter 1
Alternative name(s):
Solute carrier family 14 member 1
Urea transporter, erythrocyte
Gene namesi
Name:SLC14A1
Synonyms:HUT11, JK, RACH1, UT1, UTE
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 18

Organism-specific databases

HGNCiHGNC:10918. SLC14A1.

Subcellular locationi

Cell membrane 1 Publication; Multi-pass membrane protein 1 Publication. Basolateral cell membrane By similarity; Multi-pass membrane protein By similarity
Note: Restricted to the basolateral membrane in various portions of the urothelium.By similarity

GO - Cellular componenti

  1. integral component of plasma membrane Source: UniProtKB
  2. plasma membrane Source: Reactome
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

MIMi111000. phenotype.
PharmGKBiPA35810.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 389389Urea transporter 1PRO_0000065737Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi211 – 2111N-linked (GlcNAc...)Sequence Analysis

Keywords - PTMi

Glycoprotein

Proteomic databases

PaxDbiQ13336.
PRIDEiQ13336.

Expressioni

Tissue specificityi

Detected in erythrocytes (at protein level). Erythrocytes.1 Publication

Gene expression databases

BgeeiQ13336.
CleanExiHS_SLC14A1.
ExpressionAtlasiQ13336. baseline and differential.
GenevestigatoriQ13336.

Organism-specific databases

HPAiHPA059570.

Interactioni

Subunit structurei

Homotrimer; each subunit contains a pore through which urea permeates. Identified in a complex with STOM By similarity.By similarity

Protein-protein interaction databases

DIPiDIP-60049N.
STRINGi9606.ENSP00000412309.

Structurei

3D structure databases

ProteinModelPortaliQ13336.
SMRiQ13336. Positions 36-381.
ModBaseiSearch...
MobiDBiSearch...

Intramembrane

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Intramembranei52 – 6918HelicalBy similarityAdd
BLAST
Intramembranei73 – 8816HelicalBy similarityAdd
BLAST
Intramembranei220 – 23415HelicalBy similarityAdd
BLAST
Intramembranei239 – 25012HelicalBy similarityAdd
BLAST

Transmembrane

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei91 – 11020HelicalBy similarityAdd
BLAST
Transmembranei115 – 13723HelicalBy similarityAdd
BLAST
Transmembranei144 – 16825HelicalBy similarityAdd
BLAST
Transmembranei173 – 19321HelicalBy similarityAdd
BLAST
Transmembranei255 – 27420HelicalBy similarityAdd
BLAST
Transmembranei284 – 30421HelicalBy similarityAdd
BLAST
Transmembranei309 – 33022HelicalBy similarityAdd
BLAST
Transmembranei333 – 35321HelicalBy similarityAdd
BLAST

Family & Domainsi

Sequence similaritiesi

Belongs to the urea transporter family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiCOG4413.
GeneTreeiENSGT00390000018729.
HOGENOMiHOG000065705.
HOVERGENiHBG000540.
InParanoidiQ13336.
KOiK08716.
OMAiPNIYKMP.
OrthoDBiEOG7GBFX8.
PhylomeDBiQ13336.
TreeFamiTF332858.

Family and domain databases

Gene3Di1.10.3430.10. 1 hit.
InterProiIPR029020. Ammonium/urea_transptr.
IPR004937. Urea_transporter.
[Graphical view]
PANTHERiPTHR10464. PTHR10464. 1 hit.
PfamiPF03253. UT. 1 hit.
[Graphical view]
PIRSFiPIRSF016502. Urea_transporter. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q13336-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEDSPTMVRV DSPTMVRGEN QVSPCQGRRC FPKALGYVTG DMKELANQLK
60 70 80 90 100
DKPVVLQFID WILRGISQVV FVNNPVSGIL ILVGLLVQNP WWALTGWLGT
110 120 130 140 150
VVSTLMALLL SQDRSLIASG LYGYNATLVG VLMAVFSDKG DYFWWLLLPV
160 170 180 190 200
CAMSMTCPIF SSALNSMLSK WDLPVFTLPF NMALSMYLSA TGHYNPFFPA
210 220 230 240 250
KLVIPITTAP NISWSDLSAL ELLKSIPVGV GQIYGCDNPW TGGIFLGAIL
260 270 280 290 300
LSSPLMCLHA AIGSLLGIAA GLSLSAPFED IYFGLWGFNS SLACIAMGGM
310 320 330 340 350
FMALTWQTHL LALGCALFTA YLGVGMANFM AEVGLPACTW PFCLATLLFL
360 370 380
IMTTKNSNIY KMPLSKVTYP EENRIFYLQA KKRMVESPL
Length:389
Mass (Da):42,528
Last modified:December 15, 1998 - v2
Checksum:i08625B8B66C310F2
GO
Isoform 2 (identifier: Q13336-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MNGRSLIGGAGDARHGPVWKDPFGTKAGDAARRGIARLSLALADGSQEQEPEEEIAM

Show »
Length:445
Mass (Da):48,342
Checksum:iCDCB118E22A2D01E
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti49 – 491L → M in BAF82297. (PubMed:14702039)Curated
Sequence conflicti64 – 641R → Q in ACV91713. 1 PublicationCurated
Sequence conflicti231 – 2311G → GVG(PubMed:7989337)Curated

Polymorphismi

SLC14A1 is responsible for the Kidd blood group system (JK) [MIMi:111000]. JK is defined by 2 alleles, JK*01 and JK*02 that give rise to Jk(a) and Jk(b) antigens respectively. The molecular basis of the Jk(a)/Jk(b) antigens is a single variation in position 280; Asp-280 corresponds to Jk(a) and Asn-280 to Jk(b). Some individuals carry silenced JK*01 and JK*02 alleles, designated JK*01N or JK*02N. They results in a Jk(null) phenotype associated with reduced urea permeability of red blood cells. Jk(null) is not associated with any obvious clinical syndrome except for a urine concentration defect.

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti44 – 441E → K.3 Publications
Corresponds to variant rs2298720 [ dbSNP | Ensembl ].
VAR_022319
Natural varianti74 – 741N → K in Jk(null). 1 Publication
VAR_065466
Natural varianti167 – 1671M → V in Jk(null). 2 Publications
Corresponds to variant rs2298719 [ dbSNP | Ensembl ].
VAR_051483
Natural varianti171 – 1711W → R.
Corresponds to variant rs9948825 [ dbSNP | Ensembl ].
VAR_051484
Natural varianti280 – 2801D → N in Jk(b). 4 Publications
Corresponds to variant rs1058396 [ dbSNP | Ensembl ].
VAR_005669
Natural varianti291 – 2911S → P in Jk(null). 2 Publications
Corresponds to variant rs78242949 [ dbSNP | Ensembl ].
VAR_013752
Natural varianti299 – 2991G → E in Jk(null). 1 Publication
VAR_065467
Natural varianti319 – 3191T → M in Jk(null). 1 Publication
VAR_065468

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 11M → MNGRSLIGGAGDARHGPVWK DPFGTKAGDAARRGIARLSL ALADGSQEQEPEEEIAM in isoform 2. 1 PublicationVSP_041573

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
L36121 mRNA. No translation available.
U35735 mRNA. Translation: AAB00181.1.
Y19039 mRNA. Translation: CAB60834.1.
AK091064 mRNA. Translation: BAG52274.1.
AK123681 mRNA. Translation: BAG53935.1.
AK289608 mRNA. Translation: BAF82297.1.
AY942197 Genomic DNA. Translation: AAX20112.1.
BC050539 mRNA. Translation: AAH50539.1.
GQ502682 mRNA. Translation: ACV91713.1.
EF571316 Genomic DNA. No translation available.
EF571317 Genomic DNA. No translation available.
EF571318 Genomic DNA. No translation available.
CCDSiCCDS11925.1. [Q13336-1]
CCDS45860.1. [Q13336-2]
PIRiA55662.
RefSeqiNP_001122060.3. NM_001128588.3. [Q13336-2]
NP_001139508.2. NM_001146036.2. [Q13336-1]
NP_001139509.1. NM_001146037.1. [Q13336-2]
NP_056949.4. NM_015865.6. [Q13336-1]
UniGeneiHs.101307.

Genome annotation databases

EnsembliENST00000321925; ENSP00000318546; ENSG00000141469. [Q13336-1]
ENST00000415427; ENSP00000412309; ENSG00000141469. [Q13336-2]
ENST00000436407; ENSP00000390637; ENSG00000141469. [Q13336-2]
ENST00000586142; ENSP00000470476; ENSG00000141469. [Q13336-1]
GeneIDi6563.
KEGGihsa:6563.
UCSCiuc002lbf.4. human. [Q13336-1]
uc002lbj.4. human. [Q13336-2]

Polymorphism databases

DMDMi4033779.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

dbRBC/BGMUT

Blood group antigen gene mutation database

SeattleSNPs

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
L36121 mRNA. No translation available.
U35735 mRNA. Translation: AAB00181.1 .
Y19039 mRNA. Translation: CAB60834.1 .
AK091064 mRNA. Translation: BAG52274.1 .
AK123681 mRNA. Translation: BAG53935.1 .
AK289608 mRNA. Translation: BAF82297.1 .
AY942197 Genomic DNA. Translation: AAX20112.1 .
BC050539 mRNA. Translation: AAH50539.1 .
GQ502682 mRNA. Translation: ACV91713.1 .
EF571316 Genomic DNA. No translation available.
EF571317 Genomic DNA. No translation available.
EF571318 Genomic DNA. No translation available.
CCDSi CCDS11925.1. [Q13336-1 ]
CCDS45860.1. [Q13336-2 ]
PIRi A55662.
RefSeqi NP_001122060.3. NM_001128588.3. [Q13336-2 ]
NP_001139508.2. NM_001146036.2. [Q13336-1 ]
NP_001139509.1. NM_001146037.1. [Q13336-2 ]
NP_056949.4. NM_015865.6. [Q13336-1 ]
UniGenei Hs.101307.

3D structure databases

ProteinModelPortali Q13336.
SMRi Q13336. Positions 36-381.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

DIPi DIP-60049N.
STRINGi 9606.ENSP00000412309.

Chemistry

ChEMBLi CHEMBL2390814.

Protein family/group databases

TCDBi 1.A.28.1.5. the urea transporter (ut) family.

Polymorphism databases

DMDMi 4033779.

Proteomic databases

PaxDbi Q13336.
PRIDEi Q13336.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000321925 ; ENSP00000318546 ; ENSG00000141469 . [Q13336-1 ]
ENST00000415427 ; ENSP00000412309 ; ENSG00000141469 . [Q13336-2 ]
ENST00000436407 ; ENSP00000390637 ; ENSG00000141469 . [Q13336-2 ]
ENST00000586142 ; ENSP00000470476 ; ENSG00000141469 . [Q13336-1 ]
GeneIDi 6563.
KEGGi hsa:6563.
UCSCi uc002lbf.4. human. [Q13336-1 ]
uc002lbj.4. human. [Q13336-2 ]

Organism-specific databases

CTDi 6563.
GeneCardsi GC18P043304.
HGNCi HGNC:10918. SLC14A1.
HPAi HPA059570.
MIMi 111000. phenotype.
613868. gene.
neXtProti NX_Q13336.
PharmGKBi PA35810.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG4413.
GeneTreei ENSGT00390000018729.
HOGENOMi HOG000065705.
HOVERGENi HBG000540.
InParanoidi Q13336.
KOi K08716.
OMAi PNIYKMP.
OrthoDBi EOG7GBFX8.
PhylomeDBi Q13336.
TreeFami TF332858.

Enzyme and pathway databases

Reactomei REACT_19305. Transport of glucose and other sugars, bile salts and organic acids, metal ions and amine compounds.

Miscellaneous databases

GeneWikii SLC14A1.
GenomeRNAii 6563.
NextBioi 25535.
PROi Q13336.
SOURCEi Search...

Gene expression databases

Bgeei Q13336.
CleanExi HS_SLC14A1.
ExpressionAtlasi Q13336. baseline and differential.
Genevestigatori Q13336.

Family and domain databases

Gene3Di 1.10.3430.10. 1 hit.
InterProi IPR029020. Ammonium/urea_transptr.
IPR004937. Urea_transporter.
[Graphical view ]
PANTHERi PTHR10464. PTHR10464. 1 hit.
Pfami PF03253. UT. 1 hit.
[Graphical view ]
PIRSFi PIRSF016502. Urea_transporter. 1 hit.
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Cloning and functional expression of a urea transporter from human bone marrow cells."
    Olives B., Neau P., Bailly P., Hediger M.A., Rousselet G., Cartron J.-P., Ripoche P.
    J. Biol. Chem. 269:31649-31652(1994) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT LYS-44.
    Tissue: Bone marrow.
  2. "RACH2, a novel human gene that complements a fission yeast cell cycle checkpoint mutation."
    Davey S., Beach D.
    Mol. Biol. Cell 6:1411-1421(1995) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  3. "The molecular basis of the Kidd blood group polymorphism and its lack of association with type 1 diabetes susceptibility."
    Olives B., Merriman M., Bailly P., Bain S., Barnett A., Todd T., Cartron J.-P., Merriman T.
    Hum. Mol. Genet. 6:1017-1020(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), POLYMORPHISM, VARIANT JK(B) ASN-280.
  4. "At physiological expression levels, the Kidd blood group/urea transporter protein is not a water channel."
    Sidoux-Walter F., Lucien N., Olives B., Gobin R., Rousselet G., Kamsteeg E.J., Ripoche P., Deen P.M.T., Cartron J.-P., Bailly P.
    J. Biol. Chem. 274:30228-30235(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Blood.
  5. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2), VARIANT LYS-44.
    Tissue: Artery smooth muscle, Brain cortex and Caudate nucleus.
  6. SeattleSNPs variation discovery resource
    Submitted (FEB-2005) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS LYS-44 AND ASN-280.
  7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANTS VAL-167 AND ASN-280.
    Tissue: Colon.
  8. "Missense mutations that result in serological JKnull phenotypes."
    Posadas J.B., Shnyreva M., Gaur P., Nakaya S., Devanaboina M., Teramura G., Haile A., Gaur L.K.
    Submitted (AUG-2009) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-381, VARIANT ASN-280.
  9. "Erythroid urea transporter deficiency due to novel JKnull alleles."
    Wester E.S., Johnson S.T., Copeland T., Malde R., Lee E., Storry J.R., Olsson M.L.
    Transfusion 48:365-372(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 52-113; 222-257 AND 317-332, VARIANT JK(NULL) MET-319.
  10. "Stomatin interacts with GLUT1/SLC2A1, band 3/SLC4A1, and aquaporin-1 in human erythrocyte membrane domains."
    Rungaldier S., Oberwagner W., Salzer U., Csaszar E., Prohaska R.
    Biochim. Biophys. Acta 1828:956-966(2013) [PubMed] [Europe PMC] [Abstract]
    Cited for: SUBCELLULAR LOCATION, TISSUE SPECIFICITY, IDENTIFICATION IN A COMPLEX WITH STOM, SUBUNIT.
  11. "Molecular heterogeneity of the Jk(null) phenotype: expression analysis of the Jk(S291P) mutation found in Finns."
    Sidoux-Walter F., Lucien N., Nissinen R., Sistonen P., Henry S., Moulds J., Cartron J.-P., Bailly P.
    Blood 96:1566-1573(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: VARIANT JK(NULL) PRO-291.
  12. "Genomic characterization of the Kidd blood group gene: different molecular basis of the Jk(a-b-) phenotype in Polynesians and Finns."
    Irshaid N.M., Henry S.M., Olsson M.L.
    Transfusion 40:69-74(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: VARIANT JK(NULL) PRO-291.
  13. "Two novel Jk(null) alleles derived from 222C>A in Exon 5 and 896G>A in Exon 9 of the JK gene."
    Liu H.M., Lin J.S., Chen P.S., Lyou J.Y., Chen Y.J., Tzeng C.H.
    Transfusion 49:259-264(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: VARIANTS JK(NULL) LYS-74; VAL-167 AND GLU-299.

Entry informationi

Entry nameiUT1_HUMAN
AccessioniPrimary (citable) accession number: Q13336
Secondary accession number(s): A8K0P3
, B3KR62, B3KVX3, C9EHF2, Q86VM5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: December 15, 1998
Last modified: October 29, 2014
This is version 132 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Blood group antigen proteins
    Nomenclature of blood group antigens and list of entries
  2. Human chromosome 18
    Human chromosome 18: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3