Q13336 (UT1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 105.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Urea transporter 1 Alternative name(s): Solute carrier family 14 member 1 Urea transporter, erythrocyte | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 389 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | Specialized low-affinity urea transporter. Mediates urea transport in erythrocytes. |
| Subcellular location | Membrane; Multi-pass membrane protein. Cell membrane By similarity. |
| Tissue specificity | Erythrocytes. |
| Polymorphism | SLC14A1 is responsible for the Kidd blood group system (JK) [MIM:111000]. JK is defined by 2 alleles, JK*01 and JK*02 that give rise to Jk(a) and Jk(b) antigens respectively. The molecular basis of the Jk(a)/Jk(b) antigens is a single variation in position 280; Asp-280 corresponds to Jk(a) and Asn-280 to Jk(b). Some individuals carry silenced JK*01 and JK*02 alleles, designated JK*01N or JK*02N. They results in a Jk(null) phenotype associated with reduced urea permeability of red blood cells. Jk(null) is not associated with any obvious clinical syndrome except for a urine concentration defect. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Transport |
| Cellular component | Cell membrane Membrane |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Transmembrane Transmembrane helix |
| Molecular function | Blood group antigen |
| PTM | Glycoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Cellular component | integral to plasma membrane Traceable author statement. Source: ProtInc |
| Molecular function | urea transmembrane transporter activity Traceable author statement. Source: ProtInc |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q13336-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q13336-2) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MNGRSLIGGAGDARHGPVWKDPFGTKAGDAARRGIARLSLALADGSQEQEPEEEIAM |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 389 | 389 | Urea transporter 1 | PRO_0000065737 | |||||
Regions | |||||||||
| Transmembrane | 53 – 73 | 21 | Helical; Potential | ||||||
| Transmembrane | 78 – 98 | 21 | Helical; Potential | ||||||
| Transmembrane | 116 – 136 | 21 | Helical; Potential | ||||||
| Transmembrane | 143 – 163 | 21 | Helical; Potential | ||||||
| Transmembrane | 173 – 193 | 21 | Helical; Potential | ||||||
| Transmembrane | 243 – 263 | 21 | Helical; Potential | ||||||
| Transmembrane | 281 – 301 | 21 | Helical; Potential | ||||||
| Transmembrane | 310 – 330 | 21 | Helical; Potential | ||||||
| Transmembrane | 333 – 353 | 21 | Helical; Potential | ||||||
Amino acid modifications | |||||||||
| Glycosylation | 211 | 1 | N-linked (GlcNAc...) Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 | 1 | M → MNGRSLIGGAGDARHGPVWK DPFGTKAGDAARRGIARLSL ALADGSQEQEPEEEIAM in isoform 2. | VSP_041573 | |||||
| Natural variant | 44 | 1 | E → K. Ref.1 Ref.5 Ref.6 Corresponds to variant rs2298720 [ dbSNP | Ensembl ]. | VAR_022319 | |||||
| Natural variant | 74 | 1 | N → K in Jk(null). Ref.12 | VAR_065466 | |||||
| Natural variant | 167 | 1 | M → V in Jk(null). Ref.7 Ref.12 Corresponds to variant rs2298719 [ dbSNP | Ensembl ]. | VAR_051483 | |||||
| Natural variant | 171 | 1 | W → R. Corresponds to variant rs9948825 [ dbSNP | Ensembl ]. | VAR_051484 | |||||
| Natural variant | 280 | 1 | D → N in Jk(b). Ref.3 Ref.6 Ref.7 Ref.8 Corresponds to variant rs1058396 [ dbSNP | Ensembl ]. | VAR_005669 | |||||
| Natural variant | 291 | 1 | S → P in Jk(null). Ref.10 Ref.11 | VAR_013752 | |||||
| Natural variant | 299 | 1 | G → E in Jk(null). Ref.12 | VAR_065467 | |||||
| Natural variant | 319 | 1 | T → M in Jk(null). Ref.9 | VAR_065468 | |||||
Experimental info | |||||||||
| Sequence conflict | 49 | 1 | L → M in BAF82297. Ref.5 | ||||||
| Sequence conflict | 64 | 1 | R → Q in ACV91713. Ref.8 | ||||||
| Sequence conflict | 231 | 1 | G → GVG Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Cloning and functional expression of a urea transporter from human bone marrow cells." Olives B., Neau P., Bailly P., Hediger M.A., Rousselet G., Cartron J.-P., Ripoche P. J. Biol. Chem. 269:31649-31652(1994) [PubMed: 7989337] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT LYS-44. Tissue: Bone marrow. |
| [2] | "RACH2, a novel human gene that complements a fission yeast cell cycle checkpoint mutation." Davey S., Beach D. Mol. Biol. Cell 6:1411-1421(1995) [PubMed: 8573795] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [3] | "The molecular basis of the Kidd blood group polymorphism and its lack of association with type 1 diabetes susceptibility." Olives B., Merriman M., Bailly P., Bain S., Barnett A., Todd T., Cartron J.-P., Merriman T. Hum. Mol. Genet. 6:1017-1020(1997) [PubMed: 9215669] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), POLYMORPHISM, VARIANT JK(B) ASN-280. |
| [4] | "At physiological expression levels, the Kidd blood group/urea transporter protein is not a water channel." Sidoux-Walter F., Lucien N., Olives B., Gobin R., Rousselet G., Kamsteeg E.J., Ripoche P., Deen P.M.T., Cartron J.-P., Bailly P. J. Biol. Chem. 274:30228-30235(1999) [PubMed: 10514515] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Blood. |
| [5] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2), VARIANT LYS-44. Tissue: Artery smooth muscle, Brain cortex and Caudate nucleus. |
| [6] | SeattleSNPs variation discovery resource Submitted (FEB-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS LYS-44 AND ASN-280. |
| [7] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANTS VAL-167 AND ASN-280. Tissue: Colon. |
| [8] | "Missense mutations that result in serological JKnull phenotypes." Posadas J.B., Shnyreva M., Gaur P., Nakaya S., Devanaboina M., Teramura G., Haile A., Gaur L.K. Submitted (AUG-2009) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-381, VARIANT ASN-280. |
| [9] | "Erythroid urea transporter deficiency due to novel JKnull alleles." Wester E.S., Johnson S.T., Copeland T., Malde R., Lee E., Storry J.R., Olsson M.L. Transfusion 48:365-372(2008) [PubMed: 18028269] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 52-113; 222-257 AND 317-332, VARIANT JK(NULL) MET-319. |
| [10] | "Molecular heterogeneity of the Jk(null) phenotype: expression analysis of the Jk(S291P) mutation found in Finns." Sidoux-Walter F., Lucien N., Nissinen R., Sistonen P., Henry S., Moulds J., Cartron J.-P., Bailly P. Blood 96:1566-1573(2000) [PubMed: 10942407] [Abstract] Cited for: VARIANT JK(NULL) PRO-291. |
| [11] | "Genomic characterization of the Kidd blood group gene: different molecular basis of the Jk(a-b-) phenotype in Polynesians and Finns." Irshaid N.M., Henry S.M., Olsson M.L. Transfusion 40:69-74(2000) [PubMed: 10644814] [Abstract] Cited for: VARIANT JK(NULL) PRO-291. |
| [12] | "Two novel Jk(null) alleles derived from 222C>A in Exon 5 and 896G>A in Exon 9 of the JK gene." Liu H.M., Lin J.S., Chen P.S., Lyou J.Y., Chen Y.J., Tzeng C.H. Transfusion 49:259-264(2009) [PubMed: 18980618] [Abstract] Cited for: VARIANTS JK(NULL) LYS-74; VAL-167 AND GLU-299. |
| + | Additional computationally mapped references. |
Web resources
| dbRBC/BGMUT Blood group antigen gene mutation database |
| GeneReviews |
| SeattleSNPs |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | L36121 mRNA. No translation available. U35735 mRNA. Translation: AAB00181.1. Y19039 mRNA. Translation: CAB60834.1. AK091064 mRNA. Translation: BAG52274.1. AK123681 mRNA. Translation: BAG53935.1. AK289608 mRNA. Translation: BAF82297.1. AY942197 Genomic DNA. Translation: AAX20112.1. BC050539 mRNA. Translation: AAH50539.1. GQ502682 mRNA. Translation: ACV91713.1. EF571316 Genomic DNA. No translation available. EF571317 Genomic DNA. No translation available. EF571318 Genomic DNA. No translation available. |
| IPI | IPI00298337. IPI00646873. |
| PIR | A55662. |
| RefSeq | NP_001122060.3. NM_001128588.3. NP_001139508.2. NM_001146036.2. NP_001139509.1. NM_001146037.1. NP_056949.4. NM_015865.6. |
| UniGene | Hs.101307. |
3D structure databases | |
| ProteinModelPortal | Q13336. |
| SMR | Q13336. Positions 43-378. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | Q13336. |
PTM databases | |
| PhosphoSite | Q13336. |
Polymorphism databases | |
| DMDM | 4033779. |
Proteomic databases | |
| PRIDE | Q13336. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000321925; ENSP00000318546; ENSG00000141469. ENST00000415427; ENSP00000412309; ENSG00000141469. ENST00000436407; ENSP00000390637; ENSG00000141469. |
| GeneID | 6563. |
| KEGG | hsa:6563. |
| NMPDR | fig|9606.3.peg.14984. |
| UCSC | uc002lbf.2. human. |
Organism-specific databases | |
| CTD | 6563. |
| GeneCards | GC18P043304. |
| H-InvDB | HIX0014423. |
| HGNC | HGNC:10918. SLC14A1. |
| MIM | 111000. phenotype. 613868. gene. |
| neXtProt | NX_Q13336. |
| PharmGKB | PA35810. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | prNOG05032. |
| HOVERGEN | HBG000540. |
| InParanoid | Q13336. |
| OrthoDB | EOG48D0VG. |
| PhylomeDB | Q13336. |
Enzyme and pathway databases | |
| Reactome | REACT_15518. Transmembrane transport of small molecules. REACT_20679. Amine compound SLC transporters. |
Gene expression databases | |
| ArrayExpress | Q13336. |
| Bgee | Q13336. |
| CleanEx | HS_SLC14A1. |
| Genevestigator | Q13336. |
| GermOnline | ENSG00000141469. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR004937. Urea_transporter. [Graphical view] |
| KO | K08716. |
| PANTHER | PTHR10464. Urea_transporter. 1 hit. |
| Pfam | PF03253. UT. 1 hit. [Graphical view] |
| PIRSF | PIRSF016502. Urea_transporter. 1 hit. |
| ProtoNet | Search... |
Other | |
| NextBio | 25535. |
| SOURCE | Search... |
Entry information
| Entry name | UT1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q13336 Secondary accession number(s): A8K0P3 Q86VM5 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Blood group antigen proteins Nomenclature of blood group antigens and list of entries |
| Human chromosome 18 Human chromosome 18: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |

Clusters with