Reviewed,
UniProtKB/Swiss-Prot Q13330 (MTA1_HUMAN)
Last modified
November 25, 2008.
Version 86.
History...
Clusters with 100%,
90%,
50% identity |
Documents (3) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Metastasis-associated protein MTA1 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 715 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | May be involved in the regulation of gene expression by covalent modification of histone proteins. The long isoform is a corepressor of estrogen receptor (ER). The short isoform binds to ER and sequesters it in the cytoplasm and enhances non-genomic responses of ER. |
| Subunit structure | Component of the nucleosome-remodeling and histone-deacetylase multiprotein complex (NuRD). Interacts with HDAC1 and ITGB3BP/CENPR. |
| Subcellular location | Isoform Short: Cytoplasm. Isoform Long: Nucleus. |
| Tissue specificity | Widely expressed. High expression in brain, ovaries, adrenal glands and virgin mammary glands. Higher in tumors than in adjacent normal tissue from the same individual. |
| Developmental stage | Highly expressed in metastatic cells. |
| Miscellaneous | The short isoform contains a Leu-Arg-Ile-Leu-Leu motif (ER binding motif). |
| Sequence similarities | Contains 1 BAH domain. Contains 1 ELM2 domain. Contains 1 GATA-type zinc finger. Contains 1 SANT domain. |
Ontologies
Keywords | |
|---|---|
| Cellular component | Cytoplasm Nucleus |
| Coding sequence diversity | Alternative splicing |
| Domain | Zinc-finger |
| Ligand | DNA-binding Metal-binding Zinc |
| PTM | Phosphoprotein |
Gene Ontology (GO) | |
| Biological process | regulation of transcription, DNA-dependent Inferred from electronic annotation. Source: InterPro signal transduction Ref.1Traceable author statement. Source: ProtInc |
| Cellular component | cytoplasm Inferred from electronic annotation. Source: UniProtKB-KW nucleusInferred from electronic annotation. Source: InterPro |
| Molecular function | sequence-specific DNA binding Inferred from electronic annotation. Source: InterPro transcription factor activityInferred from electronic annotation. Source: InterPro zinc ion bindingInferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform Long (identifier: Q13330-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform Short (identifier: Q13330-2) Also known as: MTA1S; The sequence of this isoform differs from the canonical sequence as follows: 398-430: TTQSYQWYSWGPPNMQCRLCASCWTYWKKYGGL → MSSLRILLDILEEIWWLENANPVRWREARTKPQ 431-715: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 715 | 715 | Metastasis-associated protein MTA1 | PRO_0000083493 | |||||
Regions | |||||||||
| Domain | 1 – 164 | 164 | BAH | ||||||
| Domain | 165 – 276 | 112 | ELM2 | ||||||
| Domain | 283 – 335 | 53 | SANT | ||||||
| Zinc finger | 393 – 420 | 28 | GATA-type; atypical | ||||||
| Motif | 545 – 552 | 8 | SH3-binding Potential | ||||||
| Motif | 696 – 705 | 10 | SH3-binding Potential | ||||||
| Compositional bias | 697 – 705 | 9 | Poly-Pro | ||||||
Amino acid modifications | |||||||||
| Modified residue | 386 | 1 | Phosphoserine | ||||||
| Modified residue | 449 | 1 | Phosphoserine | ||||||
| Modified residue | 467 | 1 | Phosphothreonine | ||||||
| Modified residue | 522 | 1 | Phosphoserine | ||||||
| Modified residue | 564 | 1 | Phosphothreonine | ||||||
| Modified residue | 576 | 1 | Phosphoserine | ||||||
Natural variations | |||||||||
| Alternative sequence | 398 – 430 | 33 | TTQSY…KYGGL → MSSLRILLDILEEIWWLENA NPVRWREARTKPQ in isoform Short. | VSP_001601 | |||||
| Alternative sequence | 431 – 715 | 285 | Missing in isoform Short. | VSP_001602 | |||||
Experimental info | |||||||||
| Sequence conflict | 498 | 1 | N → H in AAH09443. Ref.4 | ||||||
| Sequence conflict | 655 | 1 | G → D in AAH09443. Ref.4 | ||||||
| Sequence conflict | 661 – 662 | 2 | PK → AT in AAH09443. Ref.4 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "A novel candidate metastasis-associated gene, mta1, differentially expressed in highly metastatic mammary adenocarcinoma cell lines. cDNA cloning, expression, and protein analyses." Toh Y., Pencil S.D., Nicolson G.L. J. Biol. Chem. 269:22958-22963(1994) [PubMed: 8083195] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM LONG). |
| [2] | "Analysis of the complete sequence of the novel metastasis-associated candidate gene, mta1, differentially expressed in mammary adenocarcinoma and breast cancer cell lines." Toh Y., Pencil S.D., Nicolson G.L. Gene 159:97-104(1995) [PubMed: 7607577] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM LONG). |
| [3] | "A naturally occurring MTA1 variant sequesters oestrogen receptor-alpha in the cytoplasm." Kumar R., Wang R.-A., Mazumdar A., Talukder A.H., Mandal M., Yang Z., Bagheri-Yarmand R., Sahin A., Hortobagyi G., Adam L., Barnes C.J., Vadlamudi R.K. Nature 418:654-657(2002) [PubMed: 12167865] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM SHORT), SUBCELLULAR LOCATION. Tissue: Mammary gland. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 453-715. Tissue: Brain. |
| [5] | "NURD, a novel complex with both ATP-dependent chromatin-remodeling and histone deacetylase activities." Xue Y., Wong J., Moreno G.T., Young M.K., Cote J., Wang W. Mol. Cell 2:851-861(1998) [PubMed: 9885572] [Abstract] Cited for: IDENTIFICATION IN NURD COMPLEX. |
| [6] | "Metastasis-associated protein 1 interacts with NRIF3, an estrogen-inducible nuclear receptor coregulator." Talukder A.H., Gururaj A., Mishra S.K., Vadlamudi R.K., Kumar R. Mol. Cell. Biol. 24:6581-6591(2004) [PubMed: 15254226] [Abstract] Cited for: INTERACTION WITH ITGB3BP. |
| [7] | "Large-scale characterization of HeLa cell nuclear phosphoproteins." Beausoleil S.A., Jedrychowski M., Schwartz D., Elias J.E., Villen J., Li J., Cohn M.A., Cantley L.C., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 101:12130-12135(2004) [PubMed: 15302935] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-576, MASS SPECTROMETRY. Tissue: Epithelium. |
| [8] | "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks." Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M. Cell 127:635-648(2006) [PubMed: 17081983] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-467, MASS SPECTROMETRY. Tissue: Epithelium. |
| [9] | "A probability-based approach for high-throughput protein phosphorylation analysis and site localization." Beausoleil S.A., Villen J., Gerber S.A., Rush J., Gygi S.P. Nat. Biotechnol. 24:1285-1292(2006) [PubMed: 16964243] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-386 AND THR-564, MASS SPECTROMETRY. Tissue: Epithelium. |
| [10] | "Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis." Cantin G.T., Yi W., Lu B., Park S.K., Xu T., Lee J.-D., Yates J.R. III J. Proteome Res. 7:1346-1351(2008) [PubMed: 18220336] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-564, MASS SPECTROMETRY. |
| [11] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed: 18669648] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-386; SER-449; SER-522; THR-564 AND SER-576, MASS SPECTROMETRY. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| U35113 mRNA. Translation: AAA78935.1. AF508978 mRNA. Translation: AAN01613.1. BC009443 mRNA. Translation: AAH09443.2. | |
| RefSeq | NP_004680.2. |
| UniGene | Hs.525629 |
3D structure databases | |
| SMR | Q13330. Positions 285-341. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q13330. |
PTM databases | |
| PhosphoSite | Q13330. |
Genome annotation databases | |
| Ensembl | ENSG00000182979. Homo sapiens. [Contig view] |
| GeneID | 9112. |
| KEGG | hsa:9112. |
Organism-specific databases | |
| H-InvDB | HIX0018922. |
| HGNC | HGNC:7410. MTA1. |
| HPA | CAB004508. HPA005544. |
| MIM | 603526. gene. |
| PharmGKB | PA38688. |
| GenAtlas | Search... |
| GeneCards | Search... |
Phylogenomic databases | |
| HOGENOM | Q13330. |
| HOVERGEN | Q13330. |
Gene expression databases | |
| ArrayExpress | Q13330. |
| CleanEx | HS_MTA1. |
| GermOnline | ENSG00000182979. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR001025. BAH. IPR000949. ELM2. IPR014778. Myb_DNA-bd. IPR001005. SANT_DNA-bd. IPR000679. Znf_GATA. [Graphical view] |
| Pfam | PF01426. BAH. 1 hit. PF01448. ELM2. 1 hit. PF00320. GATA. 1 hit. PF00249. Myb_DNA-binding. 1 hit. [Graphical view] |
| SMART | SM00439. BAH. 1 hit. SM00717. SANT. 1 hit. SM00401. ZnF_GATA. 1 hit. [Graphical view] |
| PROSITE | PS51038. BAH. 1 hit. PS51156. ELM2. 1 hit. PS00344. GATA_ZN_FINGER_1. False negative. PS50114. GATA_ZN_FINGER_2. False negative. PS51293. SANT. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 34153. |
| SOURCE | Search... |
Entry information
| Entry name | MTA1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q13330 Secondary accession number(s): Q8NFI8, Q96GI8 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| Human chromosome 14 Human chromosome 14: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with


