Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q13330

- MTA1_HUMAN

UniProt

Q13330 - MTA1_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Metastasis-associated protein MTA1

Gene

MTA1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Transcriptional coregulator which can act as both a transcriptional corepressor and coactivator. As a part of the histone-deacetylase multiprotein complex (NuRD), regulates transcription of its targets by modifying the acetylation status of the target chromatin and cofactor accessibility to the target DNA. In conjunction with other components of NuRD, acts as a transcriptional corepressor of BRCA1, ESR1, TFF1 and CDKN1A. Acts as a transcriptional coactivator of BCAS3, PAX5 and SUMO2, independent of the NuRD complex. Stimulates the expression of WNT1 by inhibiting the expression of its transcriptional corepressor SIX3. Plays a role in the inflammatory responses, both as a target and as a component of the NF-kappa-B signaling and regulates a subset of proinflammatory cytokines such as IL1B, MIP2, and TNF. Regulates p53-dependent and -independent DNA repair processes following genotoxic stress. Regulates the stability and function of p53/TP53 by inhibiting its ubiquitination by COP1 and MDM2 thereby regulating the p53-dependent DNA repair. Plays an important role in tumorigenesis, tumor invasion, and metastasis. Involved in the epigenetic regulation of ESR1 expression in breast cancer in a TFAP2C, IFI16 and HDAC4/5/6-dependent manner. Plays a role in the regulation of the circadian clock and is essential for the generation and maintenance of circadian rhythms under constant light and for normal entrainment of behavior to light-dark (LD) cycles. Positively regulates the CLOCK-ARNTL/BMAL1 heterodimer mediated transcriptional activation of its own transcription and the transcription of CRY1. Regulates deacetylation of ARNTL/BMAL1 by regulating SIRT1 expression, resulting in derepressing CRY1-mediated transcription repression. Isoform Short binds to ESR1 and sequesters it in the cytoplasm and enhances its non-genomic responses.6 Publications

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri393 – 42028GATA-type; atypicalAdd
BLAST

GO - Molecular functioni

  1. chromatin binding Source: InterPro
  2. core promoter binding Source: UniProtKB
  3. core promoter sequence-specific DNA binding Source: UniProtKB
  4. RNA polymerase II repressing transcription factor binding Source: BHF-UCL
  5. sequence-specific DNA binding transcription factor activity Source: InterPro
  6. transcription coactivator activity Source: UniProtKB
  7. transcription corepressor activity Source: UniProtKB
  8. zinc ion binding Source: InterPro

GO - Biological processi

  1. circadian regulation of gene expression Source: UniProtKB
  2. double-strand break repair Source: UniProtKB
  3. entrainment of circadian clock by photoperiod Source: UniProtKB
  4. locomotor rhythm Source: UniProtKB
  5. positive regulation of protein autoubiquitination Source: UniProtKB
  6. proteasome-mediated ubiquitin-dependent protein catabolic process Source: UniProtKB
  7. regulation of gene expression, epigenetic Source: UniProtKB
  8. regulation of inflammatory response Source: UniProtKB
  9. response to ionizing radiation Source: UniProtKB
  10. response to lipopolysaccharide Source: UniProtKB
  11. secretory granule organization Source: Ensembl
  12. signal transduction Source: ProtInc
  13. transcription, DNA-templated Source: UniProtKB-KW
Complete GO annotation...

Keywords - Molecular functioni

Activator, Repressor

Keywords - Biological processi

Biological rhythms, Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding, Metal-binding, Zinc

Enzyme and pathway databases

ReactomeiREACT_953. RNA Polymerase I Transcription Initiation.

Names & Taxonomyi

Protein namesi
Recommended name:
Metastasis-associated protein MTA1
Gene namesi
Name:MTA1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 14

Organism-specific databases

HGNCiHGNC:7410. MTA1.

Subcellular locationi

Isoform Long : Nucleus. Nucleus envelope. Cytoplasm. Cytoplasmcytoskeleton
Note: Associated with microtubules. Localization at the nuclear envelope is TPR-dependent.

GO - Cellular componenti

  1. cytoplasm Source: UniProtKB
  2. endoplasmic reticulum Source: Ensembl
  3. intracellular membrane-bounded organelle Source: HPA
  4. microtubule Source: UniProtKB
  5. nuclear envelope Source: UniProtKB
  6. nucleus Source: UniProtKB
  7. NuRD complex Source: Ensembl
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton, Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi182 – 1821K → A: Reduced ubiquitination. Significant reduction in ubiquitination; when associated with A-626. 1 Publication
Mutagenesisi509 – 5091K → R: Reduced sumoylation and transcriptional corepressor activity. 1 Publication
Mutagenesisi626 – 6261K → A: Loss of acetylation and transcriptional coactivator activity. Reduced ubiquitination. Significant reduction in ubiquitination; when associated with A-182. 3 Publications
Mutagenesisi711 – 7133IVI → AAA: Significant loss of interaction with SUMO1 and SUMO2 and reduced transcriptional corepressor activity. 1 Publication

Organism-specific databases

PharmGKBiPA31218.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 715715Metastasis-associated protein MTA1PRO_0000083493Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Cross-linki182 – 182Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)1 Publication
Modified residuei386 – 3861Phosphoserine6 Publications
Modified residuei446 – 4461Phosphoserine2 Publications
Modified residuei449 – 4491Phosphoserine3 Publications
Cross-linki509 – 509Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2 and SUMO3)
Modified residuei522 – 5221Phosphoserine4 Publications
Modified residuei564 – 5641Phosphothreonine3 Publications
Modified residuei576 – 5761Phosphoserine4 Publications
Modified residuei578 – 5781Phosphothreonine3 Publications
Modified residuei626 – 6261N6-acetyllysine3 Publications
Cross-linki626 – 626Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)1 Publication
Modified residuei639 – 6391Phosphoserine1 Publication

Post-translational modificationi

Phosphorylation by CSNK1G2/CK1 triggered by estrogen enhances corepression of estrogen receptor (ER).7 Publications
Acetylation is essential for its transcriptional coactivator activity.3 Publications
Sumoylation positively regulates its transcriptional corepressor activity but does not affect the protein stability. Sumoylated preferentially by SUMO2 or SUMO3 than SUMO1. Sumoylation is enhanced by PIAS1/3/4 and preferentially sumoylated by SUMO2 in the presence of PIAS1/3/4. Desumoylated by SENP1.1 Publication
Ubiquitinated by RFWD2, which leads to proteasomal degradation.1 Publication

Keywords - PTMi

Acetylation, Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

MaxQBiQ13330.
PaxDbiQ13330.
PRIDEiQ13330.

PTM databases

PhosphoSiteiQ13330.

Expressioni

Tissue specificityi

Widely expressed. High expression in brain, liver, kidney, and cardiac muscle, ovaries, adrenal glands and virgin mammary glands. Higher in tumors than in adjacent normal tissue from the same individual. Up-regulated in a wide variety of cancers including breast, liver, ovarian, and colorectal cancer and its expression levels are closely correlated with tumor aggressiveness and metastasis.2 Publications

Developmental stagei

Highly expressed in metastatic cells.

Gene expression databases

BgeeiQ13330.
CleanExiHS_MTA1.
ExpressionAtlasiQ13330. baseline and differential.
GenevestigatoriQ13330.

Organism-specific databases

HPAiCAB004508.
HPA005544.

Interactioni

Subunit structurei

Component of the nucleosome-remodeling and histone-deacetylase multiprotein complex (NuRD). Interacts with HDAC1 and ITGB3BP/CENPR. Binds to CSNK1G2 in the cytoplasm. Interacts with NACC2. Interacts with ARNTL/BMAL1 and CLOCK. Interacts with EP300, TFAP2C, IFI16, TPR, HDAC2, UBE2I/UBC9, PIAS1, PIAS3, PIAS4, p53/TP53, MDM2, RFWD2, SUMO1, SUMO2, SENP1 and SENP2. Interacts with SIX3; facilitates the binding of SIX3 to the core DNA motif of SIX3 promoter (By similarity).By similarity12 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
ESR1P033724EBI-714236,EBI-78473
HDAC1Q135474EBI-714236,EBI-301834
HDAC2Q927694EBI-714236,EBI-301821
HIF1AQ166656EBI-714236,EBI-447269

Protein-protein interaction databases

BioGridi114562. 74 interactions.
DIPiDIP-41751N.
IntActiQ13330. 15 interactions.
MINTiMINT-255103.
STRINGi9606.ENSP00000333633.

Structurei

Secondary structure

1
715
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Turni171 – 1733
Turni192 – 1943
Beta strandi195 – 1995
Helixi207 – 22418
Helixi238 – 2469
Helixi248 – 26013
Turni261 – 2633
Helixi265 – 2728
Helixi284 – 2874
Helixi290 – 30314
Helixi307 – 3137
Helixi320 – 33011

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
4BKXX-ray3.00A162-335[»]
4PBYX-ray2.50C/D656-686[»]
4PBZX-ray2.15B670-695[»]
4PC0X-ray2.50C/D670-711[»]
ProteinModelPortaliQ13330.
SMRiQ13330. Positions 165-333.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini1 – 164164BAHPROSITE-ProRule annotationAdd
BLAST
Domaini165 – 276112ELM2PROSITE-ProRule annotationAdd
BLAST
Domaini283 – 33553SANTPROSITE-ProRule annotationAdd
BLAST

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi545 – 5528SH3-bindingSequence Analysis
Motifi696 – 70510SH3-bindingSequence Analysis
Motifi711 – 7155SUMO interaction motif 1 (SIM); crucial for efficient sumoylation

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi697 – 7059Poly-Pro

Domaini

Isoform Short contains a Leu-Arg-Ile-Leu-Leu motif (ER binding motif).

Sequence similaritiesi

Contains 1 BAH domain.PROSITE-ProRule annotation
Contains 1 ELM2 domain.PROSITE-ProRule annotation
Contains 1 GATA-type zinc finger.Curated
Contains 1 SANT domain.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri393 – 42028GATA-type; atypicalAdd
BLAST

Keywords - Domaini

Zinc-finger

Phylogenomic databases

eggNOGiNOG252834.
GeneTreeiENSGT00580000081398.
HOGENOMiHOG000045387.
HOVERGENiHBG002598.
InParanoidiQ13330.
KOiK11660.
OMAiDKHATLS.
OrthoDBiEOG780RM1.
PhylomeDBiQ13330.
TreeFamiTF106444.

Family and domain databases

InterProiIPR001025. BAH_dom.
IPR000949. ELM2_dom.
IPR009057. Homeodomain-like.
IPR001005. SANT/Myb.
IPR017884. SANT_dom.
IPR000679. Znf_GATA.
[Graphical view]
PfamiPF01426. BAH. 1 hit.
PF01448. ELM2. 1 hit.
PF00320. GATA. 1 hit.
[Graphical view]
SMARTiSM00439. BAH. 1 hit.
SM00717. SANT. 1 hit.
SM00401. ZnF_GATA. 1 hit.
[Graphical view]
SUPFAMiSSF46689. SSF46689. 1 hit.
PROSITEiPS51038. BAH. 1 hit.
PS51156. ELM2. 1 hit.
PS51293. SANT. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform Long (identifier: Q13330-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAANMYRVGD YVYFENSSSN PYLIRRIEEL NKTANGNVEA KVVCFYRRRD
60 70 80 90 100
ISSTLIALAD KHATLSVCYK AGPGADNGEE GEIEEEMENP EMVDLPEKLK
110 120 130 140 150
HQLRHRELFL SRQLESLPAT HIRGKCSVTL LNETESLKSY LEREDFFFYS
160 170 180 190 200
LVYDPQQKTL LADKGEIRVG NRYQADITDL LKEGEEDGRD QSRLETQVWE
210 220 230 240 250
AHNPLTDKQI DQFLVVARSV GTFARALDCS SSVRQPSLHM SAAAASRDIT
260 270 280 290 300
LFHAMDTLHK NIYDISKAIS ALVPQGGPVL CRDEMEEWSA SEANLFEEAL
310 320 330 340 350
EKYGKDFTDI QQDFLPWKSL TSIIEYYYMW KTTDRYVQQK RLKAAEAESK
360 370 380 390 400
LKQVYIPNYN KPNPNQISVN NVKAGVVNGT GAPGQSPGAG RACESCYTTQ
410 420 430 440 450
SYQWYSWGPP NMQCRLCASC WTYWKKYGGL KMPTRLDGER PGPNRSNMSP
460 470 480 490 500
HGLPARSSGS PKFAMKTRQA FYLHTTKLTR IARRLCREIL RPWHAARHPY
510 520 530 540 550
LPINSAAIKA ECTARLPEAS QSPLVLKQAV RKPLEAVLRY LETHPRPPKP
560 570 580 590 600
DPVKSVSSVL SSLTPAKVAP VINNGSPTIL GKRSYEQHNG VDGNMKKRLL
610 620 630 640 650
MPSRGLANHG QARHMGPSRN LLLNGKSYPT KVRLIRGGSL PPVKRRRMNW
660 670 680 690 700
IDAPDDVFYM ATEETRKIRK LLSSSETKRA ARRPYKPIAL RQSQALPPRP
710
PPPAPVNDEP IVIED
Length:715
Mass (Da):80,786
Last modified:September 22, 2009 - v2
Checksum:i2D5330F0489AE62E
GO
Isoform Short (identifier: Q13330-2) [UniParc]FASTAAdd to Basket

Also known as: MTA1S

The sequence of this isoform differs from the canonical sequence as follows:
     398-430: TTQSYQWYSWGPPNMQCRLCASCWTYWKKYGGL → MSSLRILLDILEEIWWLENANPVRWREARTKPQ
     431-715: Missing.

Show »
Length:430
Mass (Da):49,017
Checksum:iDE4B752E9476C6CE
GO
Isoform 3 (identifier: Q13330-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     64-81: TLSVCYKAGPGADNGEEG → R

Show »
Length:698
Mass (Da):79,192
Checksum:iBCF775330376172E
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti498 – 4981H → N in AAA78935. (PubMed:8083195)Curated
Sequence conflicti545 – 5451P → R in AAI42942. (PubMed:15489334)Curated
Sequence conflicti655 – 6551D → G in AAA78935. (PubMed:8083195)Curated
Sequence conflicti661 – 6622AT → PK in AAA78935. (PubMed:8083195)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti372 – 3721V → I.
Corresponds to variant rs4983413 [ dbSNP | Ensembl ].
VAR_055847
Natural varianti612 – 6121A → T.3 Publications
Corresponds to variant rs13707 [ dbSNP | Ensembl ].
VAR_058965

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei64 – 8118TLSVC…NGEEG → R in isoform 3. 1 PublicationVSP_042207Add
BLAST
Alternative sequencei398 – 43033TTQSY…KYGGL → MSSLRILLDILEEIWWLENA NPVRWREARTKPQ in isoform Short. 1 PublicationVSP_001601Add
BLAST
Alternative sequencei431 – 715285Missing in isoform Short. 1 PublicationVSP_001602Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U35113 mRNA. Translation: AAA78935.1.
AF508978 mRNA. Translation: AAN01613.1.
AL928654 Genomic DNA. No translation available.
BC009443 mRNA. Translation: AAH09443.2.
BC142941 mRNA. Translation: AAI42942.1.
BX248776 mRNA. Translation: CAD66583.1.
CCDSiCCDS32169.1. [Q13330-1]
CCDS55954.1. [Q13330-2]
RefSeqiNP_001190187.1. NM_001203258.1. [Q13330-2]
NP_004680.2. NM_004689.3. [Q13330-1]
UniGeneiHs.525629.

Genome annotation databases

EnsembliENST00000331320; ENSP00000333633; ENSG00000182979. [Q13330-1]
ENST00000405646; ENSP00000384180; ENSG00000182979. [Q13330-3]
ENST00000438610; ENSP00000393438; ENSG00000182979. [Q13330-2]
GeneIDi9112.
KEGGihsa:9112.
UCSCiuc001yqx.3. human. [Q13330-1]
uc001yqy.3. human. [Q13330-2]

Polymorphism databases

DMDMi259016275.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U35113 mRNA. Translation: AAA78935.1 .
AF508978 mRNA. Translation: AAN01613.1 .
AL928654 Genomic DNA. No translation available.
BC009443 mRNA. Translation: AAH09443.2 .
BC142941 mRNA. Translation: AAI42942.1 .
BX248776 mRNA. Translation: CAD66583.1 .
CCDSi CCDS32169.1. [Q13330-1 ]
CCDS55954.1. [Q13330-2 ]
RefSeqi NP_001190187.1. NM_001203258.1. [Q13330-2 ]
NP_004680.2. NM_004689.3. [Q13330-1 ]
UniGenei Hs.525629.

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
4BKX X-ray 3.00 A 162-335 [» ]
4PBY X-ray 2.50 C/D 656-686 [» ]
4PBZ X-ray 2.15 B 670-695 [» ]
4PC0 X-ray 2.50 C/D 670-711 [» ]
ProteinModelPortali Q13330.
SMRi Q13330. Positions 165-333.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 114562. 74 interactions.
DIPi DIP-41751N.
IntActi Q13330. 15 interactions.
MINTi MINT-255103.
STRINGi 9606.ENSP00000333633.

PTM databases

PhosphoSitei Q13330.

Polymorphism databases

DMDMi 259016275.

Proteomic databases

MaxQBi Q13330.
PaxDbi Q13330.
PRIDEi Q13330.

Protocols and materials databases

DNASUi 9112.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000331320 ; ENSP00000333633 ; ENSG00000182979 . [Q13330-1 ]
ENST00000405646 ; ENSP00000384180 ; ENSG00000182979 . [Q13330-3 ]
ENST00000438610 ; ENSP00000393438 ; ENSG00000182979 . [Q13330-2 ]
GeneIDi 9112.
KEGGi hsa:9112.
UCSCi uc001yqx.3. human. [Q13330-1 ]
uc001yqy.3. human. [Q13330-2 ]

Organism-specific databases

CTDi 9112.
GeneCardsi GC14P105886.
HGNCi HGNC:7410. MTA1.
HPAi CAB004508.
HPA005544.
MIMi 603526. gene.
neXtProti NX_Q13330.
PharmGKBi PA31218.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG252834.
GeneTreei ENSGT00580000081398.
HOGENOMi HOG000045387.
HOVERGENi HBG002598.
InParanoidi Q13330.
KOi K11660.
OMAi DKHATLS.
OrthoDBi EOG780RM1.
PhylomeDBi Q13330.
TreeFami TF106444.

Enzyme and pathway databases

Reactomei REACT_953. RNA Polymerase I Transcription Initiation.

Miscellaneous databases

ChiTaRSi MTA1. human.
GeneWikii MTA1.
GenomeRNAii 9112.
NextBioi 34153.
PROi Q13330.
SOURCEi Search...

Gene expression databases

Bgeei Q13330.
CleanExi HS_MTA1.
ExpressionAtlasi Q13330. baseline and differential.
Genevestigatori Q13330.

Family and domain databases

InterProi IPR001025. BAH_dom.
IPR000949. ELM2_dom.
IPR009057. Homeodomain-like.
IPR001005. SANT/Myb.
IPR017884. SANT_dom.
IPR000679. Znf_GATA.
[Graphical view ]
Pfami PF01426. BAH. 1 hit.
PF01448. ELM2. 1 hit.
PF00320. GATA. 1 hit.
[Graphical view ]
SMARTi SM00439. BAH. 1 hit.
SM00717. SANT. 1 hit.
SM00401. ZnF_GATA. 1 hit.
[Graphical view ]
SUPFAMi SSF46689. SSF46689. 1 hit.
PROSITEi PS51038. BAH. 1 hit.
PS51156. ELM2. 1 hit.
PS51293. SANT. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "A novel candidate metastasis-associated gene, mta1, differentially expressed in highly metastatic mammary adenocarcinoma cell lines. cDNA cloning, expression, and protein analyses."
    Toh Y., Pencil S.D., Nicolson G.L.
    J. Biol. Chem. 269:22958-22963(1994) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM LONG), VARIANT THR-612.
  2. "Analysis of the complete sequence of the novel metastasis-associated candidate gene, mta1, differentially expressed in mammary adenocarcinoma and breast cancer cell lines."
    Toh Y., Pencil S.D., Nicolson G.L.
    Gene 159:97-104(1995) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM LONG), VARIANT THR-612.
  3. "A naturally occurring MTA1 variant sequesters oestrogen receptor-alpha in the cytoplasm."
    Kumar R., Wang R.-A., Mazumdar A., Talukder A.H., Mandal M., Yang Z., Bagheri-Yarmand R., Sahin A., Hortobagyi G., Adam L., Barnes C.J., Vadlamudi R.K.
    Nature 418:654-657(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM SHORT), SUBCELLULAR LOCATION.
    Tissue: Mammary gland.
  4. "The DNA sequence and analysis of human chromosome 14."
    Heilig R., Eckenberg R., Petit J.-L., Fonknechten N., Da Silva C., Cattolico L., Levy M., Barbe V., De Berardinis V., Ureta-Vidal A., Pelletier E., Vico V., Anthouard V., Rowen L., Madan A., Qin S., Sun H., Du H.
    , Pepin K., Artiguenave F., Robert C., Cruaud C., Bruels T., Jaillon O., Friedlander L., Samson G., Brottier P., Cure S., Segurens B., Aniere F., Samain S., Crespeau H., Abbasi N., Aiach N., Boscus D., Dickhoff R., Dors M., Dubois I., Friedman C., Gouyvenoux M., James R., Madan A., Mairey-Estrada B., Mangenot S., Martins N., Menard M., Oztas S., Ratcliffe A., Shaffer T., Trask B., Vacherie B., Bellemere C., Belser C., Besnard-Gonnet M., Bartol-Mavel D., Boutard M., Briez-Silla S., Combette S., Dufosse-Laurent V., Ferron C., Lechaplais C., Louesse C., Muselet D., Magdelenat G., Pateau E., Petit E., Sirvain-Trukniewicz P., Trybou A., Vega-Czarny N., Bataille E., Bluet E., Bordelais I., Dubois M., Dumont C., Guerin T., Haffray S., Hammadi R., Muanga J., Pellouin V., Robert D., Wunderle E., Gauguet G., Roy A., Sainte-Marthe L., Verdier J., Verdier-Discala C., Hillier L.W., Fulton L., McPherson J., Matsuda F., Wilson R., Scarpelli C., Gyapay G., Wincker P., Saurin W., Quetier F., Waterston R., Hood L., Weissenbach J.
    Nature 421:601-607(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM LONG), VARIANT THR-612.
    Tissue: Brain.
  6. "Full-length cDNA libraries and normalization."
    Li W.B., Gruber C., Jessee J., Polayes D.
    Submitted (JUL-2004) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 10-299 (ISOFORM 3).
    Tissue: Cervix carcinoma.
  7. "NURD, a novel complex with both ATP-dependent chromatin-remodeling and histone deacetylase activities."
    Xue Y., Wong J., Moreno G.T., Young M.K., Cote J., Wang W.
    Mol. Cell 2:851-861(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION IN NURD COMPLEX.
  8. "Metastasis-associated protein 1 interacts with NRIF3, an estrogen-inducible nuclear receptor coregulator."
    Talukder A.H., Gururaj A., Mishra S.K., Vadlamudi R.K., Kumar R.
    Mol. Cell. Biol. 24:6581-6591(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH ITGB3BP.
  9. "Metastatic tumor antigen 1 short form (MTA1s) associates with casein kinase I-gamma2, an estrogen-responsive kinase."
    Mishra S.K., Yang Z., Mazumdar A., Talukder A.H., Larose L., Kumar R.
    Oncogene 23:4422-4429(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION BY CSNK1G2/CK1, INTERACTION WITH CSNK1G2, SUBCELLULAR LOCATION.
  10. "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks."
    Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M.
    Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  11. "A probability-based approach for high-throughput protein phosphorylation analysis and site localization."
    Beausoleil S.A., Villen J., Gerber S.A., Rush J., Gygi S.P.
    Nat. Biotechnol. 24:1285-1292(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-386 AND THR-564, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  12. Cited for: FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY, ACETYLATION AT LYS-626, MUTAGENESIS OF LYS-626, INTERACTION WITH EP300.
  13. Erratum
    Gururaj A.E., Singh R.R., Rayala S.K., Holm C., den Hollander P., Zhang H., Balasenthil S., Talukder A.H., Landberg G., Kumar R.
    Proc. Natl. Acad. Sci. U.S.A. 110:4147-4148(2013)
  14. Cited for: FUNCTION, INTERACTION WITH HDAC2, ACETYLATION AT LYS-626, MUTAGENESIS OF LYS-626.
  15. "Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis."
    Cantin G.T., Yi W., Lu B., Park S.K., Xu T., Lee J.-D., Yates J.R. III
    J. Proteome Res. 7:1346-1351(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  16. "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle."
    Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M.
    Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-386, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  17. "MTA1-mediated transcriptional repression of BRCA1 tumor suppressor gene."
    Molli P.R., Singh R.R., Lee S.W., Kumar R.
    Oncogene 27:1971-1980(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION.
  18. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-386; SER-449; SER-522; THR-564 AND SER-576, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  19. "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
    Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
    Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  20. Cited for: FUNCTION, INTERACTION WITH MDM2 AND TP53.
  21. Cited for: UBIQUITINATION AT LYS-182 AND LYS-626, ACETYLATION AT LYS-626, MUTAGENESIS OF LYS-182 AND LYS-626, INTERACTION WITH RFWD2 AND HDAC2.
  22. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
    Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
    Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-386; SER-522; THR-564; SER-576 AND THR-578, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Leukemic T-cell.
  23. "Metastasis-associated protein 1 and its short form variant stimulates Wnt1 transcription through promoting its derepression from Six3 corepressor."
    Kumar R., Balasenthil S., Manavathi B., Rayala S.K., Pakala S.B.
    Cancer Res. 70:6649-6658(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH SIX3.
  24. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
    Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
    Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-386; SER-446; SER-449; SER-522; SER-576 AND THR-578, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  25. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  26. "SUMOylation and SUMO-interacting motif (SIM) of metastasis tumor antigen 1 (MTA1) synergistically regulate its transcriptional repressor function."
    Cong L., Pakala S.B., Ohshiro K., Li D.Q., Kumar R.
    J. Biol. Chem. 286:43793-43808(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, SUMOYLATION AT LYS-509, SUBCELLULAR LOCATION, INTERACTION WITH HDAC2; UBE2I; PIAS1; PIAS3; PIAS4; SUMO1; SUMO2; SENP1 AND SENP2, SUMO INTERACTION MOTIF, MUTAGENESIS OF LYS-509 AND 711-ILE--ILE-713.
  27. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
    Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
    Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-386; SER-446; SER-449; SER-522; SER-576; THR-578 AND SER-639, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  28. "Metastasis-associated protein 1/nucleosome remodeling and histone deacetylase complex in cancer."
    Li D.Q., Pakala S.B., Nair S.S., Eswaran J., Kumar R.
    Cancer Res. 72:387-394(2012) [PubMed] [Europe PMC] [Abstract]
    Cited for: REVIEW.
  29. "RBB, a novel transcription repressor, represses the transcription of HDM2 oncogene."
    Xuan C., Wang Q., Han X., Duan Y., Li L., Shi L., Wang Y., Shan L., Yao Z., Shang Y.
    Oncogene 32:3711-3721(2013) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH NACC2.
  30. "Differential regulation of estrogen receptor alpha expression in breast cancer cells by metastasis-associated protein 1."
    Kang H.J., Lee M.H., Kang H.L., Kim S.H., Ahn J.R., Na H., Na T.Y., Kim Y.N., Seong J.K., Lee M.O.
    Cancer Res. 74:1484-1494(2014) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, INTERACTION WITH TFAP2C AND IFI16, SUBCELLULAR LOCATION.
  31. "The subcellular distribution and function of MTA1 in cancer differentiation."
    Liu J., Xu D., Wang H., Zhang Y., Chang Y., Zhang J., Wang J., Li C., Liu H., Zhao M., Lin C., Zhan Q., Huang C., Qian H.
    Oncotarget 5:5153-5164(2014) [PubMed] [Europe PMC] [Abstract]
    Cited for: SUBCELLULAR LOCATION, TISSUE SPECIFICITY, INTERACTION WITH TPR AND HDAC2.

Entry informationi

Entry nameiMTA1_HUMAN
AccessioniPrimary (citable) accession number: Q13330
Secondary accession number(s): A5PLK4
, Q86SW2, Q8NFI8, Q96GI8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: September 22, 2009
Last modified: October 29, 2014
This is version 148 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 14
    Human chromosome 14: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3