Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Inactive tyrosine-protein kinase 7

Gene

PTK7

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Inactive tyrosine kinase involved in Wnt signaling pathway. Component of both the non-canonical (also known as the Wnt/planar cell polarity signaling) and the canonical Wnt signaling pathway. Functions in cell adhesion, cell migration, cell polarity, proliferation, actin cytoskeleton reorganization and apoptosis. Has a role in embryogenesis, epithelial tissue organization and angiogenesis.5 Publications

GO - Molecular functioni

GO - Biological processi

  • actin cytoskeleton reorganization Source: UniProtKB
  • axis elongation Source: Ensembl
  • canonical Wnt signaling pathway Source: UniProtKB
  • cell adhesion Source: UniProtKB-KW
  • cell migration Source: UniProtKB
  • cellular response to retinoic acid Source: BHF-UCL
  • cochlea morphogenesis Source: Ensembl
  • convergent extension Source: Ensembl
  • coronary vasculature development Source: Ensembl
  • establishment of epithelial cell apical/basal polarity Source: Ensembl
  • establishment of planar polarity Source: Ensembl
  • lung-associated mesenchyme development Source: Ensembl
  • planar cell polarity pathway involved in neural tube closure Source: Ensembl
  • positive regulation of neuron projection development Source: BHF-UCL
  • signal transduction Source: ProtInc
  • ventricular septum development Source: Ensembl
  • wound healing Source: Ensembl
Complete GO annotation...

Keywords - Molecular functioni

Receptor

Keywords - Biological processi

Cell adhesion, Wnt signaling pathway

Enzyme and pathway databases

BioCyciZFISH:ENSG00000112655-MONOMER.
SIGNORiQ13308.

Names & Taxonomyi

Protein namesi
Recommended name:
Inactive tyrosine-protein kinase 7
Alternative name(s):
Colon carcinoma kinase 4
Short name:
CCK-4
Protein-tyrosine kinase 7
Pseudo tyrosine kinase receptor 7
Tyrosine-protein kinase-like 7
Gene namesi
Name:PTK7
Synonyms:CCK4
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 6

Organism-specific databases

HGNCiHGNC:9618. PTK7.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini31 – 704ExtracellularSequence analysisAdd BLAST674
Transmembranei705 – 725HelicalSequence analysisAdd BLAST21
Topological domaini726 – 1070CytoplasmicSequence analysisAdd BLAST345

GO - Cellular componenti

  • cell-cell junction Source: UniProtKB
  • focal adhesion Source: UniProtKB
  • integral component of plasma membrane Source: ProtInc
Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Membrane

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi622L → D: Prevents proteolysis by MMP14. 1 Publication1
Mutagenesisi641M → R: No impact on proteolysis by MMP14. 1 Publication1
Mutagenesisi701M → D: No impact on proteolysis by MMP14. 1 Publication1

Organism-specific databases

DisGeNETi5754.
OpenTargetsiENSG00000112655.
PharmGKBiPA33961.

Polymorphism and mutation databases

BioMutaiPTK7.
DMDMi116242736.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 30Sequence analysisAdd BLAST30
ChainiPRO_000001674831 – 1070Inactive tyrosine-protein kinase 7Add BLAST1040

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi53 ↔ 101PROSITE-ProRule annotation
Glycosylationi116N-linked (GlcNAc...)1 Publication1
Disulfide bondi150 ↔ 200PROSITE-ProRule annotation
Glycosylationi175N-linked (GlcNAc...)1 Publication1
Glycosylationi184N-linked (GlcNAc...)Sequence analysis1
Glycosylationi214N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi246 ↔ 301PROSITE-ProRule annotation
Glycosylationi268N-linked (GlcNAc...)1 Publication1
Glycosylationi283N-linked (GlcNAc...)1 Publication1
Disulfide bondi343 ↔ 391PROSITE-ProRule annotation
Glycosylationi405N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi433 ↔ 481PROSITE-ProRule annotation
Glycosylationi463N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi524 ↔ 570PROSITE-ProRule annotation
Glycosylationi567N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi613 ↔ 664PROSITE-ProRule annotation
Glycosylationi646N-linked (GlcNAc...)2 Publications1
Modified residuei1064PhosphoserineBy similarity1

Post-translational modificationi

MMP14 cleaves PTK7 between Pro-621 and Leu-622 generating an N-terminal soluble (70 kDa) fragment and a membrane C-terminal (50 kDa) fragment. Proteolysis by MMP14 regulates PTK7 function in non-canonical Wnt signaling pathway.1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sitei621 – 622Cleavage; by MMP142

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

EPDiQ13308.
MaxQBiQ13308.
PaxDbiQ13308.
PeptideAtlasiQ13308.
PRIDEiQ13308.
TopDownProteomicsiQ13308-3. [Q13308-3]

PTM databases

iPTMnetiQ13308.
PhosphoSitePlusiQ13308.
SwissPalmiQ13308.
UniCarbKBiQ13308.

Expressioni

Tissue specificityi

Highly expressed in lung, liver, pancreas, kidney, placenta and melanocytes. Weakly expressed in thyroid gland, ovary, brain, heart and skeletal muscle. Also expressed in erythroleukemia cells. But not expressed in colon.

Inductioni

Higher expression in cell lines established from normal non-tumorigenic tissues compared to cell lines established from highly metastatic invasive carcinomas (at protein level).1 Publication

Gene expression databases

BgeeiENSG00000112655.
CleanExiHS_PTK7.
ExpressionAtlasiQ13308. baseline and differential.
GenevisibleiQ13308. HS.

Organism-specific databases

HPAiHPA003222.

Interactioni

Subunit structurei

Interacts with CTNNB1.1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
CTNNB1P352225EBI-2803245,EBI-491549

Protein-protein interaction databases

BioGridi111721. 9 interactors.
IntActiQ13308. 14 interactors.
MINTiMINT-4532536.
STRINGi9606.ENSP00000230419.

Structurei

3D structure databases

ProteinModelPortaliQ13308.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini31 – 120Ig-like C2-type 1Add BLAST90
Domaini128 – 218Ig-like C2-type 2Add BLAST91
Domaini225 – 317Ig-like C2-type 3Add BLAST93
Domaini309 – 407Ig-like C2-type 4Add BLAST99
Domaini412 – 497Ig-like C2-type 5Add BLAST86
Domaini503 – 586Ig-like C2-type 6Add BLAST84
Domaini578 – 680Ig-like C2-type 7Add BLAST103
Domaini796 – 1066Protein kinase; inactivePROSITE-ProRule annotationAdd BLAST271

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni794 – 1070Interaction with CTNNB11 PublicationAdd BLAST277

Domaini

The protein kinase domain is predicted to be catalytically inactive.

Sequence similaritiesi

Belongs to the protein kinase superfamily. Tyr protein kinase family. Insulin receptor subfamily.PROSITE-ProRule annotation
Contains 1 protein kinase domain.PROSITE-ProRule annotation

Keywords - Domaini

Immunoglobulin domain, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG1026. Eukaryota.
KOG4475. Eukaryota.
COG0515. LUCA.
GeneTreeiENSGT00760000118818.
HOGENOMiHOG000115767.
HOVERGENiHBG008320.
InParanoidiQ13308.
KOiK05127.
OrthoDBiEOG091G0BWE.
PhylomeDBiQ13308.
TreeFamiTF326835.

Family and domain databases

Gene3Di2.60.40.10. 7 hits.
InterProiIPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR013098. Ig_I-set.
IPR003599. Ig_sub.
IPR003598. Ig_sub2.
IPR011009. Kinase-like_dom.
IPR000719. Prot_kinase_dom.
IPR033592. PTK7.
IPR001245. Ser-Thr/Tyr_kinase_cat_dom.
IPR008266. Tyr_kinase_AS.
[Graphical view]
PANTHERiPTHR26391:SF15. PTHR26391:SF15. 2 hits.
PfamiPF07679. I-set. 3 hits.
PF07714. Pkinase_Tyr. 1 hit.
[Graphical view]
PRINTSiPR00109. TYRKINASE.
SMARTiSM00409. IG. 7 hits.
SM00408. IGc2. 7 hits.
[Graphical view]
SUPFAMiSSF48726. SSF48726. 7 hits.
SSF56112. SSF56112. 1 hit.
PROSITEiPS50835. IG_LIKE. 7 hits.
PS50011. PROTEIN_KINASE_DOM. 1 hit.
PS00109. PROTEIN_KINASE_TYR. 1 hit.
[Graphical view]

Sequences (6)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 6 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q13308-1) [UniParc]FASTAAdd to basket
Also known as: PTK7-1

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGAARGSPAR PRRLPLLSVL LLPLLGGTQT AIVFIKQPSS QDALQGRRAL
60 70 80 90 100
LRCEVEAPGP VHVYWLLDGA PVQDTERRFA QGSSLSFAAV DRLQDSGTFQ
110 120 130 140 150
CVARDDVTGE EARSANASFN IKWIEAGPVV LKHPASEAEI QPQTQVTLRC
160 170 180 190 200
HIDGHPRPTY QWFRDGTPLS DGQSNHTVSS KERNLTLRPA GPEHSGLYSC
210 220 230 240 250
CAHSAFGQAC SSQNFTLSIA DESFARVVLA PQDVVVARYE EAMFHCQFSA
260 270 280 290 300
QPPPSLQWLF EDETPITNRS RPPHLRRATV FANGSLLLTQ VRPRNAGIYR
310 320 330 340 350
CIGQGQRGPP IILEATLHLA EIEDMPLFEP RVFTAGSEER VTCLPPKGLP
360 370 380 390 400
EPSVWWEHAG VRLPTHGRVY QKGHELVLAN IAESDAGVYT CHAANLAGQR
410 420 430 440 450
RQDVNITVAT VPSWLKKPQD SQLEEGKPGY LDCLTQATPK PTVVWYRNQM
460 470 480 490 500
LISEDSRFEV FKNGTLRINS VEVYDGTWYR CMSSTPAGSI EAQARVQVLE
510 520 530 540 550
KLKFTPPPQP QQCMEFDKEA TVPCSATGRE KPTIKWERAD GSSLPEWVTD
560 570 580 590 600
NAGTLHFARV TRDDAGNYTC IASNGPQGQI RAHVQLTVAV FITFKVEPER
610 620 630 640 650
TTVYQGHTAL LQCEAQGDPK PLIQWKGKDR ILDPTKLGPR MHIFQNGSLV
660 670 680 690 700
IHDVAPEDSG RYTCIAGNSC NIKHTEAPLY VVDKPVPEES EGPGSPPPYK
710 720 730 740 750
MIQTIGLSVG AAVAYIIAVL GLMFYCKKRC KAKRLQKQPE GEEPEMECLN
760 770 780 790 800
GGPLQNGQPS AEIQEEVALT SLGSGPAATN KRHSTSDKMH FPRSSLQPIT
810 820 830 840 850
TLGKSEFGEV FLAKAQGLEE GVAETLVLVK SLQSKDEQQQ LDFRRELEMF
860 870 880 890 900
GKLNHANVVR LLGLCREAEP HYMVLEYVDL GDLKQFLRIS KSKDEKLKSQ
910 920 930 940 950
PLSTKQKVAL CTQVALGMEH LSNNRFVHKD LAARNCLVSA QRQVKVSALG
960 970 980 990 1000
LSKDVYNSEY YHFRQAWVPL RWMSPEAILE GDFSTKSDVW AFGVLMWEVF
1010 1020 1030 1040 1050
THGEMPHGGQ ADDEVLADLQ AGKARLPQPE GCPSKLYRLM QRCWALSPKD
1060 1070
RPSFSEIASA LGDSTVDSKP
Length:1,070
Mass (Da):118,392
Last modified:October 17, 2006 - v2
Checksum:i304926A1774EB5F4
GO
Isoform 2 (identifier: Q13308-2) [UniParc]FASTAAdd to basket
Also known as: PTK7-2

The sequence of this isoform differs from the canonical sequence as follows:
     500-539: Missing.

Show »
Length:1,030
Mass (Da):113,805
Checksum:i34501D254ED02C49
GO
Isoform 3 (identifier: Q13308-3) [UniParc]FASTAAdd to basket
Also known as: PTK7-3

The sequence of this isoform differs from the canonical sequence as follows:
     410-540: TVPSWLKKPQ...KPTIKWERAD → N

Show »
Length:940
Mass (Da):103,581
Checksum:i33FEE51123972DA8
GO
Isoform 4 (identifier: Q13308-4) [UniParc]FASTAAdd to basket
Also known as: PTK7-4

The sequence of this isoform differs from the canonical sequence as follows:
     627-682: Missing.

Show »
Length:1,014
Mass (Da):112,261
Checksum:iBCAA8FEBBF9909B8
GO
Isoform 5 (identifier: Q13308-5) [UniParc]FASTAAdd to basket
Also known as: PTK7-5

The sequence of this isoform differs from the canonical sequence as follows:
     804-816: KSEFGEVFLAKAQ → RPQAVPEDFQEQG
     817-1070: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:816
Mass (Da):89,764
Checksum:i20405B0B94CA99EB
GO
Isoform 6 (identifier: Q13308-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-26: MGAARGSPARPRRLPLLSVLLLPLLG → MGSFLSGEKRPSAPTVGSAMEKKEFPTPPGRVGP

Note: No experimental confirmation available.
Show »
Length:1,078
Mass (Da):119,197
Checksum:iE5F3E9970734EAF8
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti87F → L in BAF85278 (PubMed:14702039).Curated1
Sequence conflicti92R → P in AAA87565 (PubMed:7478540).Curated1
Sequence conflicti93L → P in AAH71557 (PubMed:15489334).Curated1
Sequence conflicti147T → K in AAA87565 (PubMed:7478540).Curated1
Sequence conflicti207G → S in AAA87565 (PubMed:7478540).Curated1
Sequence conflicti495 – 496RV → VL in AAA87565 (PubMed:7478540).Curated2
Sequence conflicti515E → G in AAA87565 (PubMed:7478540).Curated1
Sequence conflicti755Q → R in BAH12463 (PubMed:14702039).Curated1
Sequence conflicti799I → F in BAF85278 (PubMed:14702039).Curated1
Sequence conflicti881G → E in AAA87565 (PubMed:7478540).Curated1
Sequence conflicti969P → A in AAA87565 (PubMed:7478540).Curated1
Sequence conflicti992F → S in AAA87565 (PubMed:7478540).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_041502276R → H.1 PublicationCorresponds to variant rs56188167dbSNPEnsembl.1
Natural variantiVAR_041503410T → S.1 PublicationCorresponds to variant rs34021075dbSNPEnsembl.1
Natural variantiVAR_041504745E → D.1 PublicationCorresponds to variant rs9472017dbSNPEnsembl.1
Natural variantiVAR_041505766E → Q.1 PublicationCorresponds to variant rs56216742dbSNPEnsembl.1
Natural variantiVAR_041506777A → V.1 PublicationCorresponds to variant rs34764696dbSNPEnsembl.1
Natural variantiVAR_041507783H → R.1 PublicationCorresponds to variant rs55820547dbSNPEnsembl.1
Natural variantiVAR_041508933A → V in a colorectal adenocarcinoma sample; somatic mutation. 1 Publication1
Natural variantiVAR_0415091029P → T.1 PublicationCorresponds to variant rs55755163dbSNPEnsembl.1
Natural variantiVAR_0415101038R → Q.1 PublicationCorresponds to variant rs34865794dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0447751 – 26MGAAR…LPLLG → MGSFLSGEKRPSAPTVGSAM EKKEFPTPPGRVGP in isoform 6. 1 PublicationAdd BLAST26
Alternative sequenceiVSP_037181410 – 540TVPSW…WERAD → N in isoform 3. 1 PublicationAdd BLAST131
Alternative sequenceiVSP_037182500 – 539Missing in isoform 2. 2 PublicationsAdd BLAST40
Alternative sequenceiVSP_037183627 – 682Missing in isoform 4. 1 PublicationAdd BLAST56
Alternative sequenceiVSP_037184804 – 816KSEFG…LAKAQ → RPQAVPEDFQEQG in isoform 5. 1 PublicationAdd BLAST13
Alternative sequenceiVSP_037185817 – 1070Missing in isoform 5. 1 PublicationAdd BLAST254

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U33635 mRNA. Translation: AAA87565.1.
U40271 mRNA. Translation: AAC50484.2.
AF447176
, AF447157, AF447158, AF447162, AF447164, AF447167, AF447170, AF447171, AF447173, AF447174, AF447175 Genomic DNA. Translation: AAL39062.1.
AF531868 mRNA. Translation: AAN04862.1.
AF531869 mRNA. Translation: AAN04863.1.
AF531870 mRNA. Translation: AAN04864.1.
AF531871 mRNA. Translation: AAN04865.1.
AF531872 mRNA. Translation: AAN04866.1.
AK291016 mRNA. Translation: BAF83705.1.
AK292589 mRNA. Translation: BAF85278.1.
AK296953 mRNA. Translation: BAH12463.1.
AL355385 Genomic DNA. Translation: CAI13783.1.
CH471081 Genomic DNA. Translation: EAX04154.1.
CH471081 Genomic DNA. Translation: EAX04155.1.
CH471081 Genomic DNA. Translation: EAX04156.1.
CH471081 Genomic DNA. Translation: EAX04158.1.
CH471081 Genomic DNA. Translation: EAX04160.1.
BC071557 mRNA. Translation: AAH71557.1.
CCDSiCCDS4884.1. [Q13308-1]
CCDS4885.1. [Q13308-2]
CCDS4886.1. [Q13308-3]
CCDS4887.1. [Q13308-4]
CCDS59021.1. [Q13308-6]
PIRiJC4593.
RefSeqiNP_001257327.1. NM_001270398.1. [Q13308-6]
NP_002812.2. NM_002821.4. [Q13308-1]
NP_690619.1. NM_152880.3. [Q13308-2]
NP_690620.1. NM_152881.3. [Q13308-3]
NP_690621.1. NM_152882.3. [Q13308-4]
UniGeneiHs.90572.

Genome annotation databases

EnsembliENST00000230418; ENSP00000230418; ENSG00000112655. [Q13308-5]
ENST00000230419; ENSP00000230419; ENSG00000112655. [Q13308-1]
ENST00000345201; ENSP00000325992; ENSG00000112655. [Q13308-2]
ENST00000349241; ENSP00000325462; ENSG00000112655. [Q13308-3]
ENST00000352931; ENSP00000326029; ENSG00000112655. [Q13308-4]
ENST00000481273; ENSP00000418754; ENSG00000112655. [Q13308-6]
GeneIDi5754.
KEGGihsa:5754.
UCSCiuc003oub.3. human. [Q13308-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U33635 mRNA. Translation: AAA87565.1.
U40271 mRNA. Translation: AAC50484.2.
AF447176
, AF447157, AF447158, AF447162, AF447164, AF447167, AF447170, AF447171, AF447173, AF447174, AF447175 Genomic DNA. Translation: AAL39062.1.
AF531868 mRNA. Translation: AAN04862.1.
AF531869 mRNA. Translation: AAN04863.1.
AF531870 mRNA. Translation: AAN04864.1.
AF531871 mRNA. Translation: AAN04865.1.
AF531872 mRNA. Translation: AAN04866.1.
AK291016 mRNA. Translation: BAF83705.1.
AK292589 mRNA. Translation: BAF85278.1.
AK296953 mRNA. Translation: BAH12463.1.
AL355385 Genomic DNA. Translation: CAI13783.1.
CH471081 Genomic DNA. Translation: EAX04154.1.
CH471081 Genomic DNA. Translation: EAX04155.1.
CH471081 Genomic DNA. Translation: EAX04156.1.
CH471081 Genomic DNA. Translation: EAX04158.1.
CH471081 Genomic DNA. Translation: EAX04160.1.
BC071557 mRNA. Translation: AAH71557.1.
CCDSiCCDS4884.1. [Q13308-1]
CCDS4885.1. [Q13308-2]
CCDS4886.1. [Q13308-3]
CCDS4887.1. [Q13308-4]
CCDS59021.1. [Q13308-6]
PIRiJC4593.
RefSeqiNP_001257327.1. NM_001270398.1. [Q13308-6]
NP_002812.2. NM_002821.4. [Q13308-1]
NP_690619.1. NM_152880.3. [Q13308-2]
NP_690620.1. NM_152881.3. [Q13308-3]
NP_690621.1. NM_152882.3. [Q13308-4]
UniGeneiHs.90572.

3D structure databases

ProteinModelPortaliQ13308.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi111721. 9 interactors.
IntActiQ13308. 14 interactors.
MINTiMINT-4532536.
STRINGi9606.ENSP00000230419.

PTM databases

iPTMnetiQ13308.
PhosphoSitePlusiQ13308.
SwissPalmiQ13308.
UniCarbKBiQ13308.

Polymorphism and mutation databases

BioMutaiPTK7.
DMDMi116242736.

Proteomic databases

EPDiQ13308.
MaxQBiQ13308.
PaxDbiQ13308.
PeptideAtlasiQ13308.
PRIDEiQ13308.
TopDownProteomicsiQ13308-3. [Q13308-3]

Protocols and materials databases

DNASUi5754.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000230418; ENSP00000230418; ENSG00000112655. [Q13308-5]
ENST00000230419; ENSP00000230419; ENSG00000112655. [Q13308-1]
ENST00000345201; ENSP00000325992; ENSG00000112655. [Q13308-2]
ENST00000349241; ENSP00000325462; ENSG00000112655. [Q13308-3]
ENST00000352931; ENSP00000326029; ENSG00000112655. [Q13308-4]
ENST00000481273; ENSP00000418754; ENSG00000112655. [Q13308-6]
GeneIDi5754.
KEGGihsa:5754.
UCSCiuc003oub.3. human. [Q13308-1]

Organism-specific databases

CTDi5754.
DisGeNETi5754.
GeneCardsiPTK7.
HGNCiHGNC:9618. PTK7.
HPAiHPA003222.
MIMi601890. gene.
neXtProtiNX_Q13308.
OpenTargetsiENSG00000112655.
PharmGKBiPA33961.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1026. Eukaryota.
KOG4475. Eukaryota.
COG0515. LUCA.
GeneTreeiENSGT00760000118818.
HOGENOMiHOG000115767.
HOVERGENiHBG008320.
InParanoidiQ13308.
KOiK05127.
OrthoDBiEOG091G0BWE.
PhylomeDBiQ13308.
TreeFamiTF326835.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000112655-MONOMER.
SIGNORiQ13308.

Miscellaneous databases

ChiTaRSiPTK7. human.
GeneWikiiPTK7.
GenomeRNAii5754.
PROiQ13308.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000112655.
CleanExiHS_PTK7.
ExpressionAtlasiQ13308. baseline and differential.
GenevisibleiQ13308. HS.

Family and domain databases

Gene3Di2.60.40.10. 7 hits.
InterProiIPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR013098. Ig_I-set.
IPR003599. Ig_sub.
IPR003598. Ig_sub2.
IPR011009. Kinase-like_dom.
IPR000719. Prot_kinase_dom.
IPR033592. PTK7.
IPR001245. Ser-Thr/Tyr_kinase_cat_dom.
IPR008266. Tyr_kinase_AS.
[Graphical view]
PANTHERiPTHR26391:SF15. PTHR26391:SF15. 2 hits.
PfamiPF07679. I-set. 3 hits.
PF07714. Pkinase_Tyr. 1 hit.
[Graphical view]
PRINTSiPR00109. TYRKINASE.
SMARTiSM00409. IG. 7 hits.
SM00408. IGc2. 7 hits.
[Graphical view]
SUPFAMiSSF48726. SSF48726. 7 hits.
SSF56112. SSF56112. 1 hit.
PROSITEiPS50835. IG_LIKE. 7 hits.
PS50011. PROTEIN_KINASE_DOM. 1 hit.
PS00109. PROTEIN_KINASE_TYR. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiPTK7_HUMAN
AccessioniPrimary (citable) accession number: Q13308
Secondary accession number(s): A8K974
, B7Z477, E9PFZ5, Q13417, Q5T650, Q6IQ54, Q8NFA5, Q8NFA6, Q8NFA7, Q8NFA8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: October 17, 2006
Last modified: November 30, 2016
This is version 166 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human and mouse protein kinases
    Human and mouse protein kinases: classification and index
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.