Q13308 (PTK7_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 129.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Inactive tyrosine-protein kinase 7 Alternative name(s): Colon carcinoma kinase 4 Short name=CCK-4 Protein-tyrosine kinase 7 Pseudo tyrosine kinase receptor 7 Tyrosine-protein kinase-like 7 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 1070 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Inactive tyrosine kinase involved in Wnt signaling pathway. Component of both the non-canonical (also known as the Wnt/planar cell polarity signaling) and the canonical Wnt signaling pathway. Functions in cell adhesion, cell migration, cell polarity, proliferation, actin cytoskeleton reorganization and apoptosis. Has a role in embryogenesis, epithelial tissue organization and angiogenesis. Ref.10 Ref.12 Ref.13 Ref.14 Ref.16 |
| Subunit structure | Interacts with CTNNB1. Ref.16 |
| Subcellular location | Membrane; Single-pass type I membrane protein. Cell junction. Note: Co-localizes with MMP14 at cell junctions. Also localizes at the leading edge of migrating cells. Ref.13 |
| Tissue specificity | Highly expressed in lung, liver, pancreas, kidney, placenta and melanocytes. Weakly expressed in thyroid gland, ovary, brain, heart and skeletal muscle. Also expressed in erythroleukemia cells. But not expressed in colon. |
| Induction | Higher expression in cell lines established from normal non-tumorigenic tissues compared to cell lines established from highly metastatic invasive carcinomas (at protein level). Ref.13 |
| Domain | The protein kinase domain is predicted to be catalytically inactive. |
| Post-translational modification | MMP14 cleaves PTK7 between Pro-621 and Leu-622 generating an N-terminal soluble (70 kDa) fragment and a membrane C-terminal (50 kDa) fragment. Proteolysis by MMP14 regulates PTK7 function in non-canonical Wnt signaling pathway. |
| Sequence similarities | Belongs to the protein kinase superfamily. Tyr protein kinase family. Insulin receptor subfamily. Contains 7 Ig-like C2-type (immunoglobulin-like) domains. Contains 1 protein kinase domain. |
Ontologies
Alternative products
| This entry describes 6 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q13308-1) Also known as: PTK7-1; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q13308-2) Also known as: PTK7-2; The sequence of this isoform differs from the canonical sequence as follows: 500-539: Missing. | ||||||
| Isoform 3 (identifier: Q13308-3) Also known as: PTK7-3; The sequence of this isoform differs from the canonical sequence as follows: 410-540: TVPSWLKKPQ...KPTIKWERAD → N | ||||||
| Isoform 4 (identifier: Q13308-4) Also known as: PTK7-4; The sequence of this isoform differs from the canonical sequence as follows: 627-682: Missing. | ||||||
| Isoform 5 (identifier: Q13308-5) Also known as: PTK7-5; The sequence of this isoform differs from the canonical sequence as follows: 804-816: KSEFGEVFLAKAQ → RPQAVPEDFQEQG 817-1070: Missing. | ||||||
| Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. | ||||||
| Isoform 6 (identifier: Q13308-6) The sequence of this isoform differs from the canonical sequence as follows: 1-26: MGAARGSPARPRRLPLLSVLLLPLLG → MGSFLSGEKRPSAPTVGSAMEKKEFPTPPGRVGP | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 30 | 30 | Potential | ||||||||
| Chain | 31 – 1070 | 1040 | Inactive tyrosine-protein kinase 7 | PRO_0000016748 | |||||||
Regions | |||||||||||
| Topological domain | 31 – 704 | 674 | Extracellular Potential | ||||||||
| Transmembrane | 705 – 725 | 21 | Helical; Potential | ||||||||
| Topological domain | 726 – 1070 | 345 | Cytoplasmic Potential | ||||||||
| Domain | 31 – 120 | 90 | Ig-like C2-type 1 | ||||||||
| Domain | 128 – 218 | 91 | Ig-like C2-type 2 | ||||||||
| Domain | 225 – 317 | 93 | Ig-like C2-type 3 | ||||||||
| Domain | 309 – 407 | 99 | Ig-like C2-type 4 | ||||||||
| Domain | 412 – 497 | 86 | Ig-like C2-type 5 | ||||||||
| Domain | 503 – 586 | 84 | Ig-like C2-type 6 | ||||||||
| Domain | 578 – 680 | 103 | Ig-like C2-type 7 | ||||||||
| Domain | 796 – 1066 | 271 | Protein kinase; inactive | ||||||||
| Region | 794 – 1070 | 277 | Interaction with CTNNB1 | ||||||||
Sites | |||||||||||
| Site | 621 – 622 | 2 | Cleavage; by MMP14 | ||||||||
Amino acid modifications | |||||||||||
| Glycosylation | 116 | 1 | N-linked (GlcNAc...) Ref.11 | ||||||||
| Glycosylation | 175 | 1 | N-linked (GlcNAc...) Ref.11 | ||||||||
| Glycosylation | 184 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 214 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 268 | 1 | N-linked (GlcNAc...) Ref.11 | ||||||||
| Glycosylation | 283 | 1 | N-linked (GlcNAc...) Ref.11 | ||||||||
| Glycosylation | 405 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 463 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 567 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 646 | 1 | N-linked (GlcNAc...) Ref.8 Ref.9 | ||||||||
| Disulfide bond | 53 ↔ 101 | By similarity | |||||||||
| Disulfide bond | 150 ↔ 200 | By similarity | |||||||||
| Disulfide bond | 246 ↔ 301 | By similarity | |||||||||
| Disulfide bond | 343 ↔ 391 | By similarity | |||||||||
| Disulfide bond | 433 ↔ 481 | By similarity | |||||||||
| Disulfide bond | 524 ↔ 570 | By similarity | |||||||||
| Disulfide bond | 613 ↔ 664 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 1 – 26 | 26 | MGAAR…LPLLG → MGSFLSGEKRPSAPTVGSAM EKKEFPTPPGRVGP in isoform 6. | VSP_044775 | |||||||
| Alternative sequence | 410 – 540 | 131 | TVPSW…WERAD → N in isoform 3. | VSP_037181 | |||||||
| Alternative sequence | 500 – 539 | 40 | Missing in isoform 2. | VSP_037182 | |||||||
| Alternative sequence | 627 – 682 | 56 | Missing in isoform 4. | VSP_037183 | |||||||
| Alternative sequence | 804 – 816 | 13 | KSEFG…LAKAQ → RPQAVPEDFQEQG in isoform 5. | VSP_037184 | |||||||
| Alternative sequence | 817 – 1070 | 254 | Missing in isoform 5. | VSP_037185 | |||||||
| Natural variant | 276 | 1 | R → H. Ref.17 Corresponds to variant rs56188167 [ dbSNP | Ensembl ]. | VAR_041502 | |||||||
| Natural variant | 410 | 1 | T → S. Ref.17 Corresponds to variant rs34021075 [ dbSNP | Ensembl ]. | VAR_041503 | |||||||
| Natural variant | 745 | 1 | E → D. Ref.17 Corresponds to variant rs9472017 [ dbSNP | Ensembl ]. | VAR_041504 | |||||||
| Natural variant | 766 | 1 | E → Q. Ref.17 Corresponds to variant rs56216742 [ dbSNP | Ensembl ]. | VAR_041505 | |||||||
| Natural variant | 777 | 1 | A → V. Ref.17 Corresponds to variant rs34764696 [ dbSNP | Ensembl ]. | VAR_041506 | |||||||
| Natural variant | 783 | 1 | H → R. Ref.17 Corresponds to variant rs55820547 [ dbSNP | Ensembl ]. | VAR_041507 | |||||||
| Natural variant | 933 | 1 | A → V in a colorectal adenocarcinoma sample; somatic mutation. Ref.17 | VAR_041508 | |||||||
| Natural variant | 1029 | 1 | P → T. Ref.17 Corresponds to variant rs55755163 [ dbSNP | Ensembl ]. | VAR_041509 | |||||||
| Natural variant | 1038 | 1 | R → Q. Ref.17 Corresponds to variant rs34865794 [ dbSNP | Ensembl ]. | VAR_041510 | |||||||
Experimental info | |||||||||||
| Mutagenesis | 622 | 1 | L → D: Prevents proteolysis by MMP14. Ref.13 | ||||||||
| Mutagenesis | 641 | 1 | M → R: No impact on proteolysis by MMP14. Ref.13 | ||||||||
| Mutagenesis | 701 | 1 | M → D: No impact on proteolysis by MMP14. Ref.13 | ||||||||
| Sequence conflict | 87 | 1 | F → L in BAF85278. Ref.4 | ||||||||
| Sequence conflict | 92 | 1 | R → P in AAA87565. Ref.1 | ||||||||
| Sequence conflict | 93 | 1 | L → P in AAH71557. Ref.7 | ||||||||
| Sequence conflict | 147 | 1 | T → K in AAA87565. Ref.1 | ||||||||
| Sequence conflict | 207 | 1 | G → S in AAA87565. Ref.1 | ||||||||
| Sequence conflict | 495 – 496 | 2 | RV → VL in AAA87565. Ref.1 | ||||||||
| Sequence conflict | 515 | 1 | E → G in AAA87565. Ref.1 | ||||||||
| Sequence conflict | 755 | 1 | Q → R in BAH12463. Ref.4 | ||||||||
| Sequence conflict | 799 | 1 | I → F in BAF85278. Ref.4 | ||||||||
| Sequence conflict | 881 | 1 | G → E in AAA87565. Ref.1 | ||||||||
| Sequence conflict | 969 | 1 | P → A in AAA87565. Ref.1 | ||||||||
| Sequence conflict | 992 | 1 | F → S in AAA87565. Ref.1 | ||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Colon carcinoma kinase-4 defines a new subclass of the receptor tyrosine kinase family." Mossie K., Jallal B., Alves F., Sures I., Plowman G.D., Ullrich A. Oncogene 11:2179-2184(1995) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Colon carcinoma and Placenta. |
| [2] | "Characterization of the human full-length PTK7 cDNA encoding a receptor protein tyrosine kinase-like molecule closely related to chick KLG." Park S.-K., Lee H.-S., Lee S.-T. J. Biochem. 119:235-239(1996) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Fibroblast. |
| [3] | "Organization of the human PTK7 gene encoding a receptor protein tyrosine kinase-like molecule and alternative splicing of its mRNA." Jung J.-W., Ji A.-R., Lee J., Kim U.-J., Lee S.-T. Biochim. Biophys. Acta 1579:153-163(2002) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3; 4 AND 5). Tissue: Testis. |
| [4] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2 AND 6). Tissue: Testis and Tongue. |
| [5] | "The DNA sequence and analysis of human chromosome 6." Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D. Beck S.Nature 425:805-811(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [7] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Placenta. |
| [8] | "Identification and quantification of N-linked glycoproteins using hydrazide chemistry, stable isotope labeling and mass spectrometry." Zhang H., Li X.-J., Martin D.B., Aebersold R. Nat. Biotechnol. 21:660-666(2003) [PubMed] [Europe PMC] [Abstract] Cited for: GLYCOSYLATION AT ASN-646. |
| [9] | "Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry." Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H. J. Proteome Res. 8:651-661(2009) [PubMed] [Europe PMC] [Abstract] Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-646, MASS SPECTROMETRY. Tissue: Liver. |
| [10] | "Soluble PTK7 inhibits tube formation, migration, and invasion of endothelial cells and angiogenesis." Shin W.-S., Maeng Y.-S., Jung J.-W., Min J.-K., Kwon Y.-G., Lee S.-T. Biochem. Biophys. Res. Commun. 371:793-798(2008) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [11] | "Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins." Wollscheid B., Bausch-Fluck D., Henderson C., O'Brien R., Bibel M., Schiess R., Aebersold R., Watts J.D. Nat. Biotechnol. 27:378-386(2009) [PubMed] [Europe PMC] [Abstract] Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-116; ASN-175; ASN-268 AND ASN-283, MASS SPECTROMETRY. Tissue: Leukemic T-cell. |
| [12] | "The cell polarity PTK7 receptor acts as a modulator of the chemotherapeutic response in acute myeloid leukemia and impairs clinical outcome." Prebet T., Lhoumeau A.-C., Arnoulet C., Aulas A., Marchetto S., Audebert S., Puppo F., Chabannon C., Sainty D., Santoni M.-J., Sebbagh M., Summerour V., Huon Y., Shin W.-S., Lee S.-T., Esterni B., Vey N., Borg J.-P. Blood 116:2315-2323(2010) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [13] | "The Wnt/planar cell polarity protein-tyrosine kinase-7 (PTK7) is a highly efficient proteolytic target of membrane type-1 matrix metalloproteinase: implications in cancer and embryogenesis." Golubkov V.S., Chekanov A.V., Cieplak P., Aleshin A.E., Chernov A.V., Zhu W., Radichev I.A., Zhang D., Dong P.D., Strongin A.Y. J. Biol. Chem. 285:35740-35749(2010) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION, INDUCTION, CLEAVAGE, MUTAGENESIS OF LEU-622; MET-641 AND MET-701. |
| [14] | "Silencing of PTK7 in colon cancer cells: caspase-10-dependent apoptosis via mitochondrial pathway." Meng L., Sefah K., O'Donoghue M.B., Zhu G., Shangguan D., Noorali A., Chen Y., Zhou L., Tan W. PLoS ONE 5:E14018-E14018(2010) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [15] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [16] | "Protein tyrosine kinase 7 has a conserved role in Wnt/beta-catenin canonical signalling." Puppo F., Thome V., Lhoumeau A.-C., Cibois M., Gangar A., Lembo F., Belotti E., Marchetto S., Lecine P., Prebet T., Sebbagh M., Shin W.-S., Lee S.-T., Kodjabachian L., Borg J.-P. EMBO Rep. 12:43-49(2011) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH CTNNB1, REGION. |
| [17] | "Patterns of somatic mutation in human cancer genomes." Greenman C., Stephens P., Smith R., Dalgliesh G.L., Hunter C., Bignell G., Davies H., Teague J., Butler A., Stevens C., Edkins S., O'Meara S., Vastrik I., Schmidt E.E., Avis T., Barthorpe S., Bhamra G., Buck G. Stratton M.R.Nature 446:153-158(2007) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS [LARGE SCALE ANALYSIS] HIS-276; SER-410; ASP-745; GLN-766; VAL-777; ARG-783; VAL-933; THR-1029 AND GLN-1038. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | U33635 mRNA. Translation: AAA87565.1. U40271 mRNA. Translation: AAC50484.2. AF447176 AF447175 Genomic DNA. Translation: AAL39062.1.AF531868 mRNA. Translation: AAN04862.1. AF531869 mRNA. Translation: AAN04863.1. AF531870 mRNA. Translation: AAN04864.1. AF531871 mRNA. Translation: AAN04865.1. AF531872 mRNA. Translation: AAN04866.1. AK291016 mRNA. Translation: BAF83705.1. AK292589 mRNA. Translation: BAF85278.1. AK296953 mRNA. Translation: BAH12463.1. AL355385 Genomic DNA. Translation: CAI13783.1. CH471081 Genomic DNA. Translation: EAX04154.1. CH471081 Genomic DNA. Translation: EAX04155.1. CH471081 Genomic DNA. Translation: EAX04156.1. CH471081 Genomic DNA. Translation: EAX04158.1. CH471081 Genomic DNA. Translation: EAX04160.1. BC071557 mRNA. Translation: AAH71557.1. |
| IPI | IPI00168813. IPI00170814. IPI00174794. IPI00298292. IPI00478565. IPI00946792. |
| PIR | JC4593. |
| RefSeq | NP_001257327.1. NM_001270398.1. NP_002812.2. NM_002821.4. NP_690619.1. NM_152880.3. NP_690620.1. NM_152881.3. NP_690621.1. NM_152882.3. |
| UniGene | Hs.90572. |
3D structure databases | |
| ProteinModelPortal | Q13308. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q13308. 1 interaction. |
PTM databases | |
| PhosphoSite | Q13308. |
Polymorphism databases | |
| DMDM | 116242736. |
Proteomic databases | |
| PaxDb | Q13308. |
| PRIDE | Q13308. |
Protocols and materials databases | |
| DNASU | 5754. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000230418; ENSP00000230418; ENSG00000112655. ENST00000230419; ENSP00000230419; ENSG00000112655. ENST00000345201; ENSP00000325992; ENSG00000112655. ENST00000349241; ENSP00000325462; ENSG00000112655. ENST00000352931; ENSP00000326029; ENSG00000112655. ENST00000481273; ENSP00000418754; ENSG00000112655. |
| GeneID | 5754. |
| KEGG | hsa:5754. |
| UCSC | uc003oub.1. human. uc003ouc.1. human. uc003oud.1. human. uc003oue.1. human. |
Organism-specific databases | |
| CTD | 5754. |
| GeneCards | GC06P043044. |
| HGNC | HGNC:9618. PTK7. |
| HPA | HPA003222. |
| MIM | 601890. gene. |
| neXtProt | NX_Q13308. |
| PharmGKB | PA33961. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG0515. |
| HOVERGEN | HBG008320. |
| InParanoid | Q13308. |
| KO | K05127. |
| OrthoDB | EOG4DBTCZ. |
| PhylomeDB | Q13308. |
Gene expression databases | |
| ArrayExpress | Q13308. |
| Bgee | Q13308. |
| CleanEx | HS_PTK7. |
| Genevestigator | Q13308. |
| GermOnline | ENSG00000112655. Homo sapiens. |
Family and domain databases | |
| Gene3D | 2.60.40.10. 7 hits. |
| InterPro | IPR007110. Ig-like_dom. IPR013783. Ig-like_fold. IPR013098. Ig_I-set. IPR003599. Ig_sub. IPR003598. Ig_sub2. IPR011009. Kinase-like_dom. IPR000719. Prot_kinase_cat_dom. IPR001245. Ser-Thr/Tyr_kinase_cat_dom. IPR008266. Tyr_kinase_AS. IPR020635. Tyr_kinase_cat_dom. [Graphical view] |
| Pfam | PF07679. I-set. 6 hits. PF07714. Pkinase_Tyr. 1 hit. [Graphical view] |
| PRINTS | PR00109. TYRKINASE. |
| SMART | SM00409. IG. 2 hits. SM00408. IGc2. 5 hits. SM00219. TyrKc. 1 hit. [Graphical view] |
| SUPFAM | SSF56112. Kinase_like. 1 hit. |
| PROSITE | PS50835. IG_LIKE. 7 hits. PS50011. PROTEIN_KINASE_DOM. 1 hit. PS00109. PROTEIN_KINASE_TYR. 1 hit. PS00239. RECEPTOR_TYR_KIN_II. False negative. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | PTK7. human. |
| GenomeRNAi | 5754. |
| NextBio | 22390. |
| SOURCE | Search... |
Entry information
| Entry name | PTK7_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q13308 Secondary accession number(s): A8K974 Q8NFA8 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human and mouse protein kinases Human and mouse protein kinases: classification and index |
| Human chromosome 6 Human chromosome 6: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
