SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q13308

- PTK7_HUMAN

UniProt

Q13308 - PTK7_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Inactive tyrosine-protein kinase 7

Gene
PTK7, CCK4
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Inactive tyrosine kinase involved in Wnt signaling pathway. Component of both the non-canonical (also known as the Wnt/planar cell polarity signaling) and the canonical Wnt signaling pathway. Functions in cell adhesion, cell migration, cell polarity, proliferation, actin cytoskeleton reorganization and apoptosis. Has a role in embryogenesis, epithelial tissue organization and angiogenesis.5 Publications

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sitei621 – 6222Cleavage; by MMP14

GO - Molecular functioni

  1. ATP binding Source: InterPro
  2. protein binding Source: UniProtKB
  3. transmembrane receptor protein tyrosine kinase activity Source: ProtInc

GO - Biological processi

  1. actin cytoskeleton reorganization Source: UniProtKB
  2. axis elongation Source: Ensembl
  3. canonical Wnt signaling pathway Source: UniProtKB
  4. cell adhesion Source: UniProtKB-KW
  5. cell migration Source: UniProtKB
  6. cellular response to retinoic acid Source: BHF-UCL
  7. cochlea morphogenesis Source: Ensembl
  8. convergent extension Source: Ensembl
  9. establishment of epithelial cell apical/basal polarity Source: Ensembl
  10. establishment of planar polarity Source: Ensembl
  11. lung-associated mesenchyme development Source: Ensembl
  12. neural tube closure Source: Ensembl
  13. peptidyl-tyrosine phosphorylation Source: GOC
  14. planar cell polarity pathway involved in neural tube closure Source: Ensembl
  15. positive regulation of neuron projection development Source: BHF-UCL
  16. signal transduction Source: ProtInc
  17. wound healing Source: Ensembl
Complete GO annotation...

Keywords - Molecular functioni

Receptor

Keywords - Biological processi

Cell adhesion, Wnt signaling pathway

Names & Taxonomyi

Protein namesi
Recommended name:
Inactive tyrosine-protein kinase 7
Alternative name(s):
Colon carcinoma kinase 4
Short name:
CCK-4
Protein-tyrosine kinase 7
Pseudo tyrosine kinase receptor 7
Tyrosine-protein kinase-like 7
Gene namesi
Name:PTK7
Synonyms:CCK4
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 6

Organism-specific databases

HGNCiHGNC:9618. PTK7.

Subcellular locationi

Membrane; Single-pass type I membrane protein. Cell junction
Note: Colocalizes with MMP14 at cell junctions. Also localizes at the leading edge of migrating cells.1 Publication

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini31 – 704674Extracellular Reviewed predictionAdd
BLAST
Transmembranei705 – 72521Helical; Reviewed predictionAdd
BLAST
Topological domaini726 – 1070345Cytoplasmic Reviewed predictionAdd
BLAST

GO - Cellular componenti

  1. cell-cell junction Source: UniProtKB
  2. integral component of plasma membrane Source: ProtInc
Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Membrane

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi622 – 6221L → D: Prevents proteolysis by MMP14. 1 Publication
Mutagenesisi641 – 6411M → R: No impact on proteolysis by MMP14. 1 Publication
Mutagenesisi701 – 7011M → D: No impact on proteolysis by MMP14. 1 Publication

Organism-specific databases

PharmGKBiPA33961.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 3030 Reviewed predictionAdd
BLAST
Chaini31 – 10701040Inactive tyrosine-protein kinase 7PRO_0000016748Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi53 ↔ 101 By similarity
Glycosylationi116 – 1161N-linked (GlcNAc...)1 Publication
Disulfide bondi150 ↔ 200 By similarity
Glycosylationi175 – 1751N-linked (GlcNAc...)1 Publication
Glycosylationi184 – 1841N-linked (GlcNAc...) Reviewed prediction
Glycosylationi214 – 2141N-linked (GlcNAc...) Reviewed prediction
Disulfide bondi246 ↔ 301 By similarity
Glycosylationi268 – 2681N-linked (GlcNAc...)1 Publication
Glycosylationi283 – 2831N-linked (GlcNAc...)1 Publication
Disulfide bondi343 ↔ 391 By similarity
Glycosylationi405 – 4051N-linked (GlcNAc...) Reviewed prediction
Disulfide bondi433 ↔ 481 By similarity
Glycosylationi463 – 4631N-linked (GlcNAc...) Reviewed prediction
Disulfide bondi524 ↔ 570 By similarity
Glycosylationi567 – 5671N-linked (GlcNAc...) Reviewed prediction
Disulfide bondi613 ↔ 664 By similarity
Glycosylationi646 – 6461N-linked (GlcNAc...)2 Publications

Post-translational modificationi

MMP14 cleaves PTK7 between Pro-621 and Leu-622 generating an N-terminal soluble (70 kDa) fragment and a membrane C-terminal (50 kDa) fragment. Proteolysis by MMP14 regulates PTK7 function in non-canonical Wnt signaling pathway.

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

MaxQBiQ13308.
PaxDbiQ13308.
PRIDEiQ13308.

PTM databases

PhosphoSiteiQ13308.

Expressioni

Tissue specificityi

Highly expressed in lung, liver, pancreas, kidney, placenta and melanocytes. Weakly expressed in thyroid gland, ovary, brain, heart and skeletal muscle. Also expressed in erythroleukemia cells. But not expressed in colon.

Inductioni

Higher expression in cell lines established from normal non-tumorigenic tissues compared to cell lines established from highly metastatic invasive carcinomas (at protein level).1 Publication

Gene expression databases

ArrayExpressiQ13308.
BgeeiQ13308.
CleanExiHS_PTK7.
GenevestigatoriQ13308.

Organism-specific databases

HPAiHPA003222.

Interactioni

Subunit structurei

Interacts with CTNNB1.1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
CTNNB1P352225EBI-2803245,EBI-491549

Protein-protein interaction databases

BioGridi111721. 2 interactions.
IntActiQ13308. 3 interactions.
MINTiMINT-4532536.

Structurei

3D structure databases

ProteinModelPortaliQ13308.
SMRiQ13308. Positions 34-693, 759-1061.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini31 – 12090Ig-like C2-type 1Add
BLAST
Domaini128 – 21891Ig-like C2-type 2Add
BLAST
Domaini225 – 31793Ig-like C2-type 3Add
BLAST
Domaini309 – 40799Ig-like C2-type 4Add
BLAST
Domaini412 – 49786Ig-like C2-type 5Add
BLAST
Domaini503 – 58684Ig-like C2-type 6Add
BLAST
Domaini578 – 680103Ig-like C2-type 7Add
BLAST
Domaini796 – 1066271Protein kinase; inactiveAdd
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni794 – 1070277Interaction with CTNNB1Add
BLAST

Domaini

The protein kinase domain is predicted to be catalytically inactive.

Sequence similaritiesi

Keywords - Domaini

Immunoglobulin domain, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiCOG0515.
HOVERGENiHBG008320.
InParanoidiQ13308.
KOiK05127.
OMAiDGTWYRC.
OrthoDBiEOG790G1M.
PhylomeDBiQ13308.
TreeFamiTF326835.

Family and domain databases

Gene3Di2.60.40.10. 7 hits.
InterProiIPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR013098. Ig_I-set.
IPR003599. Ig_sub.
IPR003598. Ig_sub2.
IPR011009. Kinase-like_dom.
IPR000719. Prot_kinase_dom.
IPR001245. Ser-Thr/Tyr_kinase_cat_dom.
IPR008266. Tyr_kinase_AS.
IPR020635. Tyr_kinase_cat_dom.
[Graphical view]
PfamiPF07679. I-set. 6 hits.
PF07714. Pkinase_Tyr. 1 hit.
[Graphical view]
PRINTSiPR00109. TYRKINASE.
SMARTiSM00409. IG. 2 hits.
SM00408. IGc2. 5 hits.
SM00219. TyrKc. 1 hit.
[Graphical view]
SUPFAMiSSF56112. SSF56112. 1 hit.
PROSITEiPS50835. IG_LIKE. 7 hits.
PS50011. PROTEIN_KINASE_DOM. 1 hit.
PS00109. PROTEIN_KINASE_TYR. 1 hit.
[Graphical view]

Sequences (6)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 6 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q13308-1) [UniParc]FASTAAdd to Basket

Also known as: PTK7-1

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MGAARGSPAR PRRLPLLSVL LLPLLGGTQT AIVFIKQPSS QDALQGRRAL     50
LRCEVEAPGP VHVYWLLDGA PVQDTERRFA QGSSLSFAAV DRLQDSGTFQ 100
CVARDDVTGE EARSANASFN IKWIEAGPVV LKHPASEAEI QPQTQVTLRC 150
HIDGHPRPTY QWFRDGTPLS DGQSNHTVSS KERNLTLRPA GPEHSGLYSC 200
CAHSAFGQAC SSQNFTLSIA DESFARVVLA PQDVVVARYE EAMFHCQFSA 250
QPPPSLQWLF EDETPITNRS RPPHLRRATV FANGSLLLTQ VRPRNAGIYR 300
CIGQGQRGPP IILEATLHLA EIEDMPLFEP RVFTAGSEER VTCLPPKGLP 350
EPSVWWEHAG VRLPTHGRVY QKGHELVLAN IAESDAGVYT CHAANLAGQR 400
RQDVNITVAT VPSWLKKPQD SQLEEGKPGY LDCLTQATPK PTVVWYRNQM 450
LISEDSRFEV FKNGTLRINS VEVYDGTWYR CMSSTPAGSI EAQARVQVLE 500
KLKFTPPPQP QQCMEFDKEA TVPCSATGRE KPTIKWERAD GSSLPEWVTD 550
NAGTLHFARV TRDDAGNYTC IASNGPQGQI RAHVQLTVAV FITFKVEPER 600
TTVYQGHTAL LQCEAQGDPK PLIQWKGKDR ILDPTKLGPR MHIFQNGSLV 650
IHDVAPEDSG RYTCIAGNSC NIKHTEAPLY VVDKPVPEES EGPGSPPPYK 700
MIQTIGLSVG AAVAYIIAVL GLMFYCKKRC KAKRLQKQPE GEEPEMECLN 750
GGPLQNGQPS AEIQEEVALT SLGSGPAATN KRHSTSDKMH FPRSSLQPIT 800
TLGKSEFGEV FLAKAQGLEE GVAETLVLVK SLQSKDEQQQ LDFRRELEMF 850
GKLNHANVVR LLGLCREAEP HYMVLEYVDL GDLKQFLRIS KSKDEKLKSQ 900
PLSTKQKVAL CTQVALGMEH LSNNRFVHKD LAARNCLVSA QRQVKVSALG 950
LSKDVYNSEY YHFRQAWVPL RWMSPEAILE GDFSTKSDVW AFGVLMWEVF 1000
THGEMPHGGQ ADDEVLADLQ AGKARLPQPE GCPSKLYRLM QRCWALSPKD 1050
RPSFSEIASA LGDSTVDSKP 1070
Length:1,070
Mass (Da):118,392
Last modified:October 17, 2006 - v2
Checksum:i304926A1774EB5F4
GO
Isoform 2 (identifier: Q13308-2) [UniParc]FASTAAdd to Basket

Also known as: PTK7-2

The sequence of this isoform differs from the canonical sequence as follows:
     500-539: Missing.

Show »
Length:1,030
Mass (Da):113,805
Checksum:i34501D254ED02C49
GO
Isoform 3 (identifier: Q13308-3) [UniParc]FASTAAdd to Basket

Also known as: PTK7-3

The sequence of this isoform differs from the canonical sequence as follows:
     410-540: TVPSWLKKPQ...KPTIKWERAD → N

Show »
Length:940
Mass (Da):103,581
Checksum:i33FEE51123972DA8
GO
Isoform 4 (identifier: Q13308-4) [UniParc]FASTAAdd to Basket

Also known as: PTK7-4

The sequence of this isoform differs from the canonical sequence as follows:
     627-682: Missing.

Show »
Length:1,014
Mass (Da):112,261
Checksum:iBCAA8FEBBF9909B8
GO
Isoform 5 (identifier: Q13308-5) [UniParc]FASTAAdd to Basket

Also known as: PTK7-5

The sequence of this isoform differs from the canonical sequence as follows:
     804-816: KSEFGEVFLAKAQ → RPQAVPEDFQEQG
     817-1070: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.

Show »
Length:816
Mass (Da):89,764
Checksum:i20405B0B94CA99EB
GO
Isoform 6 (identifier: Q13308-6) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-26: MGAARGSPARPRRLPLLSVLLLPLLG → MGSFLSGEKRPSAPTVGSAMEKKEFPTPPGRVGP

Note: No experimental confirmation available.

Show »
Length:1,078
Mass (Da):119,197
Checksum:iE5F3E9970734EAF8
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti276 – 2761R → H.1 Publication
Corresponds to variant rs56188167 [ dbSNP | Ensembl ].
VAR_041502
Natural varianti410 – 4101T → S.1 Publication
Corresponds to variant rs34021075 [ dbSNP | Ensembl ].
VAR_041503
Natural varianti745 – 7451E → D.1 Publication
Corresponds to variant rs9472017 [ dbSNP | Ensembl ].
VAR_041504
Natural varianti766 – 7661E → Q.1 Publication
Corresponds to variant rs56216742 [ dbSNP | Ensembl ].
VAR_041505
Natural varianti777 – 7771A → V.1 Publication
Corresponds to variant rs34764696 [ dbSNP | Ensembl ].
VAR_041506
Natural varianti783 – 7831H → R.1 Publication
Corresponds to variant rs55820547 [ dbSNP | Ensembl ].
VAR_041507
Natural varianti933 – 9331A → V in a colorectal adenocarcinoma sample; somatic mutation. 1 Publication
VAR_041508
Natural varianti1029 – 10291P → T.1 Publication
Corresponds to variant rs55755163 [ dbSNP | Ensembl ].
VAR_041509
Natural varianti1038 – 10381R → Q.1 Publication
Corresponds to variant rs34865794 [ dbSNP | Ensembl ].
VAR_041510

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 2626MGAAR…LPLLG → MGSFLSGEKRPSAPTVGSAM EKKEFPTPPGRVGP in isoform 6. VSP_044775Add
BLAST
Alternative sequencei410 – 540131TVPSW…WERAD → N in isoform 3. VSP_037181Add
BLAST
Alternative sequencei500 – 53940Missing in isoform 2. VSP_037182Add
BLAST
Alternative sequencei627 – 68256Missing in isoform 4. VSP_037183Add
BLAST
Alternative sequencei804 – 81613KSEFG…LAKAQ → RPQAVPEDFQEQG in isoform 5. VSP_037184Add
BLAST
Alternative sequencei817 – 1070254Missing in isoform 5. VSP_037185Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti87 – 871F → L in BAF85278. 1 Publication
Sequence conflicti92 – 921R → P in AAA87565. 1 Publication
Sequence conflicti93 – 931L → P in AAH71557. 1 Publication
Sequence conflicti147 – 1471T → K in AAA87565. 1 Publication
Sequence conflicti207 – 2071G → S in AAA87565. 1 Publication
Sequence conflicti495 – 4962RV → VL in AAA87565. 1 Publication
Sequence conflicti515 – 5151E → G in AAA87565. 1 Publication
Sequence conflicti755 – 7551Q → R in BAH12463. 1 Publication
Sequence conflicti799 – 7991I → F in BAF85278. 1 Publication
Sequence conflicti881 – 8811G → E in AAA87565. 1 Publication
Sequence conflicti969 – 9691P → A in AAA87565. 1 Publication
Sequence conflicti992 – 9921F → S in AAA87565. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U33635 mRNA. Translation: AAA87565.1.
U40271 mRNA. Translation: AAC50484.2.
AF447176
, AF447157, AF447158, AF447162, AF447164, AF447167, AF447170, AF447171, AF447173, AF447174, AF447175 Genomic DNA. Translation: AAL39062.1.
AF531868 mRNA. Translation: AAN04862.1.
AF531869 mRNA. Translation: AAN04863.1.
AF531870 mRNA. Translation: AAN04864.1.
AF531871 mRNA. Translation: AAN04865.1.
AF531872 mRNA. Translation: AAN04866.1.
AK291016 mRNA. Translation: BAF83705.1.
AK292589 mRNA. Translation: BAF85278.1.
AK296953 mRNA. Translation: BAH12463.1.
AL355385 Genomic DNA. Translation: CAI13783.1.
CH471081 Genomic DNA. Translation: EAX04154.1.
CH471081 Genomic DNA. Translation: EAX04155.1.
CH471081 Genomic DNA. Translation: EAX04156.1.
CH471081 Genomic DNA. Translation: EAX04158.1.
CH471081 Genomic DNA. Translation: EAX04160.1.
BC071557 mRNA. Translation: AAH71557.1.
CCDSiCCDS4884.1. [Q13308-1]
CCDS4885.1. [Q13308-2]
CCDS4886.1. [Q13308-3]
CCDS4887.1. [Q13308-4]
CCDS59021.1. [Q13308-6]
PIRiJC4593.
RefSeqiNP_001257327.1. NM_001270398.1. [Q13308-6]
NP_002812.2. NM_002821.4. [Q13308-1]
NP_690619.1. NM_152880.3. [Q13308-2]
NP_690620.1. NM_152881.3. [Q13308-3]
NP_690621.1. NM_152882.3. [Q13308-4]
UniGeneiHs.90572.

Genome annotation databases

EnsembliENST00000230418; ENSP00000230418; ENSG00000112655. [Q13308-5]
ENST00000230419; ENSP00000230419; ENSG00000112655. [Q13308-1]
ENST00000345201; ENSP00000325992; ENSG00000112655. [Q13308-2]
ENST00000349241; ENSP00000325462; ENSG00000112655. [Q13308-3]
ENST00000352931; ENSP00000326029; ENSG00000112655. [Q13308-4]
ENST00000481273; ENSP00000418754; ENSG00000112655. [Q13308-6]
GeneIDi5754.
KEGGihsa:5754.
UCSCiuc003oub.2. human. [Q13308-1]
uc003ouc.2. human. [Q13308-4]
uc003oud.2. human. [Q13308-2]
uc003oue.2. human. [Q13308-3]

Polymorphism databases

DMDMi116242736.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U33635 mRNA. Translation: AAA87565.1 .
U40271 mRNA. Translation: AAC50484.2 .
AF447176
, AF447157 , AF447158 , AF447162 , AF447164 , AF447167 , AF447170 , AF447171 , AF447173 , AF447174 , AF447175 Genomic DNA. Translation: AAL39062.1 .
AF531868 mRNA. Translation: AAN04862.1 .
AF531869 mRNA. Translation: AAN04863.1 .
AF531870 mRNA. Translation: AAN04864.1 .
AF531871 mRNA. Translation: AAN04865.1 .
AF531872 mRNA. Translation: AAN04866.1 .
AK291016 mRNA. Translation: BAF83705.1 .
AK292589 mRNA. Translation: BAF85278.1 .
AK296953 mRNA. Translation: BAH12463.1 .
AL355385 Genomic DNA. Translation: CAI13783.1 .
CH471081 Genomic DNA. Translation: EAX04154.1 .
CH471081 Genomic DNA. Translation: EAX04155.1 .
CH471081 Genomic DNA. Translation: EAX04156.1 .
CH471081 Genomic DNA. Translation: EAX04158.1 .
CH471081 Genomic DNA. Translation: EAX04160.1 .
BC071557 mRNA. Translation: AAH71557.1 .
CCDSi CCDS4884.1. [Q13308-1 ]
CCDS4885.1. [Q13308-2 ]
CCDS4886.1. [Q13308-3 ]
CCDS4887.1. [Q13308-4 ]
CCDS59021.1. [Q13308-6 ]
PIRi JC4593.
RefSeqi NP_001257327.1. NM_001270398.1. [Q13308-6 ]
NP_002812.2. NM_002821.4. [Q13308-1 ]
NP_690619.1. NM_152880.3. [Q13308-2 ]
NP_690620.1. NM_152881.3. [Q13308-3 ]
NP_690621.1. NM_152882.3. [Q13308-4 ]
UniGenei Hs.90572.

3D structure databases

ProteinModelPortali Q13308.
SMRi Q13308. Positions 34-693, 759-1061.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 111721. 2 interactions.
IntActi Q13308. 3 interactions.
MINTi MINT-4532536.

PTM databases

PhosphoSitei Q13308.

Polymorphism databases

DMDMi 116242736.

Proteomic databases

MaxQBi Q13308.
PaxDbi Q13308.
PRIDEi Q13308.

Protocols and materials databases

DNASUi 5754.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000230418 ; ENSP00000230418 ; ENSG00000112655 . [Q13308-5 ]
ENST00000230419 ; ENSP00000230419 ; ENSG00000112655 . [Q13308-1 ]
ENST00000345201 ; ENSP00000325992 ; ENSG00000112655 . [Q13308-2 ]
ENST00000349241 ; ENSP00000325462 ; ENSG00000112655 . [Q13308-3 ]
ENST00000352931 ; ENSP00000326029 ; ENSG00000112655 . [Q13308-4 ]
ENST00000481273 ; ENSP00000418754 ; ENSG00000112655 . [Q13308-6 ]
GeneIDi 5754.
KEGGi hsa:5754.
UCSCi uc003oub.2. human. [Q13308-1 ]
uc003ouc.2. human. [Q13308-4 ]
uc003oud.2. human. [Q13308-2 ]
uc003oue.2. human. [Q13308-3 ]

Organism-specific databases

CTDi 5754.
GeneCardsi GC06P043044.
HGNCi HGNC:9618. PTK7.
HPAi HPA003222.
MIMi 601890. gene.
neXtProti NX_Q13308.
PharmGKBi PA33961.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG0515.
HOVERGENi HBG008320.
InParanoidi Q13308.
KOi K05127.
OMAi DGTWYRC.
OrthoDBi EOG790G1M.
PhylomeDBi Q13308.
TreeFami TF326835.

Miscellaneous databases

ChiTaRSi PTK7. human.
GeneWikii PTK7.
GenomeRNAii 5754.
NextBioi 22390.
PROi Q13308.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q13308.
Bgeei Q13308.
CleanExi HS_PTK7.
Genevestigatori Q13308.

Family and domain databases

Gene3Di 2.60.40.10. 7 hits.
InterProi IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR013098. Ig_I-set.
IPR003599. Ig_sub.
IPR003598. Ig_sub2.
IPR011009. Kinase-like_dom.
IPR000719. Prot_kinase_dom.
IPR001245. Ser-Thr/Tyr_kinase_cat_dom.
IPR008266. Tyr_kinase_AS.
IPR020635. Tyr_kinase_cat_dom.
[Graphical view ]
Pfami PF07679. I-set. 6 hits.
PF07714. Pkinase_Tyr. 1 hit.
[Graphical view ]
PRINTSi PR00109. TYRKINASE.
SMARTi SM00409. IG. 2 hits.
SM00408. IGc2. 5 hits.
SM00219. TyrKc. 1 hit.
[Graphical view ]
SUPFAMi SSF56112. SSF56112. 1 hit.
PROSITEi PS50835. IG_LIKE. 7 hits.
PS50011. PROTEIN_KINASE_DOM. 1 hit.
PS00109. PROTEIN_KINASE_TYR. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Colon carcinoma kinase-4 defines a new subclass of the receptor tyrosine kinase family."
    Mossie K., Jallal B., Alves F., Sures I., Plowman G.D., Ullrich A.
    Oncogene 11:2179-2184(1995) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Colon carcinoma and Placenta.
  2. "Characterization of the human full-length PTK7 cDNA encoding a receptor protein tyrosine kinase-like molecule closely related to chick KLG."
    Park S.-K., Lee H.-S., Lee S.-T.
    J. Biochem. 119:235-239(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Fibroblast.
  3. "Organization of the human PTK7 gene encoding a receptor protein tyrosine kinase-like molecule and alternative splicing of its mRNA."
    Jung J.-W., Ji A.-R., Lee J., Kim U.-J., Lee S.-T.
    Biochim. Biophys. Acta 1579:153-163(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3; 4 AND 5).
    Tissue: Testis.
  4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2 AND 6).
    Tissue: Testis and Tongue.
  5. "The DNA sequence and analysis of human chromosome 6."
    Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D.
    , Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beare D.M., Beasley H., Beasley O., Bird C.P., Blakey S.E., Bray-Allen S., Brook J., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Clark S.Y., Clark G., Clee C.M., Clegg S., Cobley V., Collier R.E., Collins J.E., Colman L.K., Corby N.R., Coville G.J., Culley K.M., Dhami P., Davies J., Dunn M., Earthrowl M.E., Ellington A.E., Evans K.A., Faulkner L., Francis M.D., Frankish A., Frankland J., French L., Garner P., Garnett J., Ghori M.J., Gilby L.M., Gillson C.J., Glithero R.J., Grafham D.V., Grant M., Gribble S., Griffiths C., Griffiths M.N.D., Hall R., Halls K.S., Hammond S., Harley J.L., Hart E.A., Heath P.D., Heathcott R., Holmes S.J., Howden P.J., Howe K.L., Howell G.R., Huckle E., Humphray S.J., Humphries M.D., Hunt A.R., Johnson C.M., Joy A.A., Kay M., Keenan S.J., Kimberley A.M., King A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C.R., Lloyd D.M., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., Maslen G.L., Matthews L., McCann O.T., McLaren S.J., McLay K., McMurray A., Moore M.J.F., Mullikin J.C., Niblett D., Nickerson T., Novik K.L., Oliver K., Overton-Larty E.K., Parker A., Patel R., Pearce A.V., Peck A.I., Phillimore B.J.C.T., Phillips S., Plumb R.W., Porter K.M., Ramsey Y., Ranby S.A., Rice C.M., Ross M.T., Searle S.M., Sehra H.K., Sheridan E., Skuce C.D., Smith S., Smith M., Spraggon L., Squares S.L., Steward C.A., Sycamore N., Tamlyn-Hall G., Tester J., Theaker A.J., Thomas D.W., Thorpe A., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., White S.S., Whitehead S.L., Whittaker H., Wild A., Willey D.J., Wilmer T.E., Wood J.M., Wray P.W., Wyatt J.C., Young L., Younger R.M., Bentley D.R., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Dunham I., Rogers J., Beck S.
    Nature 425:805-811(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Placenta.
  8. "Identification and quantification of N-linked glycoproteins using hydrazide chemistry, stable isotope labeling and mass spectrometry."
    Zhang H., Li X.-J., Martin D.B., Aebersold R.
    Nat. Biotechnol. 21:660-666(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: GLYCOSYLATION AT ASN-646.
  9. "Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry."
    Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H.
    J. Proteome Res. 8:651-661(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-646.
    Tissue: Liver.
  10. "Soluble PTK7 inhibits tube formation, migration, and invasion of endothelial cells and angiogenesis."
    Shin W.-S., Maeng Y.-S., Jung J.-W., Min J.-K., Kwon Y.-G., Lee S.-T.
    Biochem. Biophys. Res. Commun. 371:793-798(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION.
  11. "Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins."
    Wollscheid B., Bausch-Fluck D., Henderson C., O'Brien R., Bibel M., Schiess R., Aebersold R., Watts J.D.
    Nat. Biotechnol. 27:378-386(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-116; ASN-175; ASN-268 AND ASN-283.
    Tissue: Leukemic T-cell.
  12. "The cell polarity PTK7 receptor acts as a modulator of the chemotherapeutic response in acute myeloid leukemia and impairs clinical outcome."
    Prebet T., Lhoumeau A.-C., Arnoulet C., Aulas A., Marchetto S., Audebert S., Puppo F., Chabannon C., Sainty D., Santoni M.-J., Sebbagh M., Summerour V., Huon Y., Shin W.-S., Lee S.-T., Esterni B., Vey N., Borg J.-P.
    Blood 116:2315-2323(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION.
  13. "The Wnt/planar cell polarity protein-tyrosine kinase-7 (PTK7) is a highly efficient proteolytic target of membrane type-1 matrix metalloproteinase: implications in cancer and embryogenesis."
    Golubkov V.S., Chekanov A.V., Cieplak P., Aleshin A.E., Chernov A.V., Zhu W., Radichev I.A., Zhang D., Dong P.D., Strongin A.Y.
    J. Biol. Chem. 285:35740-35749(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, SUBCELLULAR LOCATION, INDUCTION, CLEAVAGE, MUTAGENESIS OF LEU-622; MET-641 AND MET-701.
  14. "Silencing of PTK7 in colon cancer cells: caspase-10-dependent apoptosis via mitochondrial pathway."
    Meng L., Sefah K., O'Donoghue M.B., Zhu G., Shangguan D., Noorali A., Chen Y., Zhou L., Tan W.
    PLoS ONE 5:E14018-E14018(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION.
  15. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  16. Cited for: FUNCTION, INTERACTION WITH CTNNB1, REGION.
  17. "Patterns of somatic mutation in human cancer genomes."
    Greenman C., Stephens P., Smith R., Dalgliesh G.L., Hunter C., Bignell G., Davies H., Teague J., Butler A., Stevens C., Edkins S., O'Meara S., Vastrik I., Schmidt E.E., Avis T., Barthorpe S., Bhamra G., Buck G.
    , Choudhury B., Clements J., Cole J., Dicks E., Forbes S., Gray K., Halliday K., Harrison R., Hills K., Hinton J., Jenkinson A., Jones D., Menzies A., Mironenko T., Perry J., Raine K., Richardson D., Shepherd R., Small A., Tofts C., Varian J., Webb T., West S., Widaa S., Yates A., Cahill D.P., Louis D.N., Goldstraw P., Nicholson A.G., Brasseur F., Looijenga L., Weber B.L., Chiew Y.-E., DeFazio A., Greaves M.F., Green A.R., Campbell P., Birney E., Easton D.F., Chenevix-Trench G., Tan M.-H., Khoo S.K., Teh B.T., Yuen S.T., Leung S.Y., Wooster R., Futreal P.A., Stratton M.R.
    Nature 446:153-158(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: VARIANTS [LARGE SCALE ANALYSIS] HIS-276; SER-410; ASP-745; GLN-766; VAL-777; ARG-783; VAL-933; THR-1029 AND GLN-1038.

Entry informationi

Entry nameiPTK7_HUMAN
AccessioniPrimary (citable) accession number: Q13308
Secondary accession number(s): A8K974
, B7Z477, E9PFZ5, Q13417, Q5T650, Q6IQ54, Q8NFA5, Q8NFA6, Q8NFA7, Q8NFA8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: October 17, 2006
Last modified: July 9, 2014
This is version 141 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human and mouse protein kinases
    Human and mouse protein kinases: classification and index
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi