SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q13261

- I15RA_HUMAN

UniProt

Q13261 - I15RA_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Interleukin-15 receptor subunit alpha
Gene
IL15RA
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

High-affinity receptor for interleukin-15. Can signal both in cis and trans where IL15R from one subset of cells presents IL15 to neighboring IL2RG-expressing cells. Expression of different isoforms may alter or interfere with signal transduction. Isoform 5, isoform 6, isoform 7 and isoform 8 do not bind IL15. Signal transduction involves SYK.2 Publications

GO - Molecular functioni

  1. cytokine receptor activity Source: UniProtKB
  2. protein binding Source: IntAct
  3. signal transducer activity Source: ProtInc
Complete GO annotation...

GO - Biological processi

  1. JAK-STAT cascade Source: Ensembl
  2. cell proliferation Source: ProtInc
  3. cytokine-mediated signaling pathway Source: GOC
  4. negative regulation of neuron projection development Source: Ensembl
  5. positive regulation of natural killer cell differentiation Source: Ensembl
  6. response to nutrient levels Source: Ensembl
  7. signal transduction Source: ProtInc
Complete GO annotation...

Keywords - Molecular functioni

Receptor

Enzyme and pathway databases

SignaLinkiQ13261.

Names & Taxonomyi

Protein namesi
Recommended name:
Interleukin-15 receptor subunit alpha
Short name:
IL-15 receptor subunit alpha
Short name:
IL-15R-alpha
Short name:
IL-15RA
Alternative name(s):
CD_antigen: CD215
Cleaved into the following chain:
Soluble interleukin-15 receptor subunit alpha
Short name:
sIL-15 receptor subunit alpha
Short name:
sIL-15R-alpha
Short name:
sIL-15RA
Gene namesi
Name:IL15RA
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 10

Organism-specific databases

HGNCiHGNC:5978. IL15RA.

Subcellular locationi

Membrane; Single-pass type I membrane protein. Nucleus membrane; Single-pass type I membrane protein
Note: Mainly found associated with the nuclear membrane.1 Publication
Isoform 5 : Endoplasmic reticulum membrane; Single-pass type I membrane protein. Golgi apparatus membrane; Single-pass type I membrane protein. Cytoplasmic vesicle membrane; Single-pass type I membrane protein. Membrane; Single-pass type I membrane protein
Note: Isoform 5, isoform 6, isoform 7 and isoform 8 are associated with endoplasmic reticulum, Golgi and cytoplasmic vesicles, but not with the nuclear membrane.1 Publication
Isoform 6 : Endoplasmic reticulum membrane; Single-pass type I membrane protein. Golgi apparatus membrane; Single-pass type I membrane protein. Cytoplasmic vesicle membrane; Single-pass type I membrane protein. Membrane; Single-pass type I membrane protein
Note: Isoform 5, isoform 6, isoform 7 and isoform 8 are associated with endoplasmic reticulum, Golgi and cytoplasmic vesicles, but not with the nuclear membrane.1 Publication
Isoform 7 : Endoplasmic reticulum membrane; Single-pass type I membrane protein. Golgi apparatus membrane; Single-pass type I membrane protein. Cytoplasmic vesicle membrane; Single-pass type I membrane protein. Membrane; Single-pass type I membrane protein
Note: Isoform 5, isoform 6, isoform 7 and isoform 8 are associated with endoplasmic reticulum, Golgi and cytoplasmic vesicles, but not with the nuclear membrane.1 Publication
Isoform 8 : Endoplasmic reticulum membrane; Single-pass type I membrane protein. Golgi apparatus membrane; Single-pass type I membrane protein. Cytoplasmic vesicle membrane; Single-pass type I membrane protein. Membrane; Single-pass type I membrane protein
Note: Isoform 5, isoform 6, isoform 7 and isoform 8 are associated with endoplasmic reticulum, Golgi and cytoplasmic vesicles, but not with the nuclear membrane.1 Publication
Chain Soluble interleukin-15 receptor subunit alpha : Secretedextracellular space 1 Publication

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini31 – 205175Extracellular Reviewed prediction
Add
BLAST
Transmembranei206 – 22823Helical; Reviewed prediction
Add
BLAST
Topological domaini229 – 26739Cytoplasmic Reviewed prediction
Add
BLAST

GO - Cellular componenti

  1. Golgi membrane Source: UniProtKB-SubCell
  2. cytoplasmic vesicle membrane Source: UniProtKB-SubCell
  3. endoplasmic reticulum membrane Source: UniProtKB-SubCell
  4. extracellular space Source: UniProtKB-SubCell
  5. integral component of membrane Source: UniProtKB-KW
  6. nuclear membrane Source: UniProtKB-SubCell
  7. plasma membrane Source: Ensembl
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasmic vesicle, Endoplasmic reticulum, Golgi apparatus, Membrane, Nucleus, Secreted

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi227 – 2271Y → F: Abrogates association with SYK and phosphorylation upon IL-15 stimulation. 1 Publication

Organism-specific databases

PharmGKBiPA29791.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 3030 Reviewed prediction
Add
BLAST
Chaini31 – 267237Interleukin-15 receptor subunit alpha
PRO_0000011044Add
BLAST
Chaini31 – ?Soluble interleukin-15 receptor subunit alphaPRO_0000333855

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi33 ↔ 752 Publications
Disulfide bondi59 ↔ 932 Publications
Glycosylationi137 – 1371N-linked (GlcNAc...) Reviewed prediction

Post-translational modificationi

A soluble form (sIL-15RA) arises from proteolytic shedding of the membrane-anchored receptor. The cleavage involves ADAM17/TACE By similarity. It also binds IL-15 and thus interferes with IL-15 binding to the membrane receptor.
Phosphorylated by activated SYK.1 Publication
N-glycosylated and O-glycosylated.1 Publication

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

PaxDbiQ13261.
PRIDEiQ13261.

Miscellaneous databases

PMAP-CutDBQ13261.

Expressioni

Tissue specificityi

Isoform 1, isoform 3, isoform 4, isoform 5, isoform 6, isoform 7, isoform 8 and isoform 9 are widely expressed. Expressed in fetal brain with higher expression in the hippocampus and cerebellum than in cortex and thalamus. Higher levels of soluble sIL-15RA form in comparison with membrane-bound forms is present in all brain structures.3 Publications

Gene expression databases

ArrayExpressiQ13261.
BgeeiQ13261.
CleanExiHS_IL15RA.
GenevestigatoriQ13261.

Organism-specific databases

HPAiCAB026215.

Interactioni

Subunit structurei

The interleukin-15 receptor IL15R is a heterotrimer of IL15RA, IL2RB and IL2RG. IL15RA also self-associates By similarity. Interacts with SYK.1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
IL15P409333EBI-980354,EBI-980274

Protein-protein interaction databases

BioGridi109814. 7 interactions.
IntActiQ13261. 7 interactions.
STRINGi9606.ENSP00000369312.

Structurei

Secondary structure

Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi42 – 443
Beta strandi54 – 596
Beta strandi63 – 653
Beta strandi72 – 776
Turni79 – 813
Beta strandi84 – 863
Beta strandi93 – 953
Helixi97 – 1026

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2ERSNMR-A31-96[»]
2Z3QX-ray1.85B/D31-132[»]
2Z3RX-ray2.00B/D/F/H/J/L/N/P31-132[»]
4GS7X-ray2.35D30-97[»]
ProteinModelPortaliQ13261.
SMRiQ13261. Positions 31-108.

Miscellaneous databases

EvolutionaryTraceiQ13261.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini31 – 9565Sushi
Add
BLAST

Sequence similaritiesi

Keywords - Domaini

Signal, Sushi, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG41222.
HOVERGENiHBG052061.
InParanoidiQ13261.
KOiK05074.
OMAiGSHESSH.
OrthoDBiEOG7V767N.
PhylomeDBiQ13261.
TreeFamiTF338443.

Family and domain databases

InterProiIPR000436. Sushi_SCR_CCP.
[Graphical view]
SMARTiSM00032. CCP. 1 hit.
[Graphical view]
SUPFAMiSSF57535. SSF57535. 1 hit.
PROSITEiPS50923. SUSHI. 1 hit.
[Graphical view]

Sequences (9)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 9 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q13261-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MAPRRARGCR TLGLPALLLL LLLRPPATRG ITCPPPMSVE HADIWVKSYS    50
LYSRERYICN SGFKRKAGTS SLTECVLNKA TNVAHWTTPS LKCIRDPALV 100
HQRPAPPSTV TTAGVTPQPE SLSPSGKEPA ASSPSSNNTA ATTAAIVPGS 150
QLMPSKSPST GTTEISSHES SHGTPSQTTA KNWELTASAS HQPPGVYPQG 200
HSDTTVAIST STVLLCGLSA VSLLACYLKS RQTPPLASVE MEAMEALPVT 250
WGTSSRDEDL ENCSHHL 267
Length:267
Mass (Da):28,233
Last modified:November 1, 1996 - v1
Checksum:iA9CFC885189E96BE
GO
Isoform 2 (identifier: Q13261-3) [UniParc]FASTAAdd to Basket

Also known as: delta3E1E7Il-15RA

The sequence of this isoform differs from the canonical sequence as follows:
     95-128: RDPALVHQRPAPPSTVTTAGVTPQPESLSPSGKE → K

Show »
Length:234
Mass (Da):24,870
Checksum:i9ACAD3E117A8C9AF
GO
Isoform 3 (identifier: Q13261-4) [UniParc]FASTAAdd to Basket

Also known as: E1E7'Il-15RA

The sequence of this isoform differs from the canonical sequence as follows:
     232-267: QTPPLASVEMEAMEALPVTWGTSSRDEDLENCSHHL → ASVCSCHPRSAGHTCSVGSVC

Show »
Length:252
Mass (Da):26,299
Checksum:iA58933D9E843EDC6
GO
Isoform 4 (identifier: Q13261-5) [UniParc]FASTAAdd to Basket

Also known as: delta3E1E7'Il-15RA

The sequence of this isoform differs from the canonical sequence as follows:
     95-128: RDPALVHQRPAPPSTVTTAGVTPQPESLSPSGKE → K
     232-267: QTPPLASVEMEAMEALPVTWGTSSRDEDLENCSHHL → ASVCSCHPRSAGHTCSVGSVC

Show »
Length:219
Mass (Da):22,936
Checksum:iDD564A227CB6AA3F
GO
Isoform 5 (identifier: Q13261-6) [UniParc]FASTAAdd to Basket

Also known as: delta2E1E7Il-15RA

The sequence of this isoform differs from the canonical sequence as follows:
     31-95: Missing.

Show »
Length:202
Mass (Da):20,904
Checksum:iD4F5DD2EA004C6D2
GO
Isoform 6 (identifier: Q13261-7) [UniParc]FASTAAdd to Basket

Also known as: delta2E1E7'Il-15RA

The sequence of this isoform differs from the canonical sequence as follows:
     31-95: Missing.
     232-267: QTPPLASVEMEAMEALPVTWGTSSRDEDLENCSHHL → ASVCSCHPRSAGHTCSVGSVC

Show »
Length:187
Mass (Da):18,969
Checksum:iD7A5B6202C329FB0
GO
Isoform 7 (identifier: Q13261-8) [UniParc]FASTAAdd to Basket

Also known as: delta2deltaE1E73Il-15RA

The sequence of this isoform differs from the canonical sequence as follows:
     30-127: Missing.

Show »
Length:169
Mass (Da):17,641
Checksum:i238A6ECC5B7675A1
GO
Isoform 8 (identifier: Q13261-9) [UniParc]FASTAAdd to Basket

Also known as: delta2delta3E1E7'Il-15RA

The sequence of this isoform differs from the canonical sequence as follows:
     30-127: Missing.
     232-267: QTPPLASVEMEAMEALPVTWGTSSRDEDLENCSHHL → ASVCSCHPRSAGHTCSVGSVC

Show »
Length:154
Mass (Da):15,707
Checksum:i23F224FD25881D2C
GO
Isoform 9 (identifier: Q13261-10) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-36: Missing.

Note: No experimental confirmation available.

Show »
Length:231
Mass (Da):24,388
Checksum:i85A770AB71977219
GO

Sequence cautioni

The sequence AAB88175.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.
The sequence CAI41080.1 differs from that shown. Reason: Erroneous gene model prediction.
The sequence EAW86419.1 differs from that shown. Reason: Erroneous gene model prediction.

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti182 – 1821N → T.2 Publications
Corresponds to variant rs2228059 [ dbSNP | Ensembl ].
VAR_020967

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 3636Missing in isoform 9.
VSP_055406Add
BLAST
Alternative sequencei30 – 12798Missing in isoform 7 and isoform 8.
VSP_012623Add
BLAST
Alternative sequencei31 – 9565Missing in isoform 5 and isoform 6.
VSP_012624Add
BLAST
Alternative sequencei95 – 12834RDPAL…PSGKE → K in isoform 2 and isoform 4.
VSP_012625Add
BLAST
Alternative sequencei232 – 26736QTPPL…CSHHL → ASVCSCHPRSAGHTCSVGSV C in isoform 3, isoform 4, isoform 6 and isoform 8.
VSP_012626Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti200 – 2001G → D in AAH74726. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U31628 mRNA. Translation: AAC50312.1.
CR457064 mRNA. Translation: CAG33345.1.
CR542023 mRNA. Translation: CAG46820.1.
AY316538 Genomic DNA. Translation: AAP69528.1.
AK304211 mRNA. Translation: BAG65084.1.
AL137186 Genomic DNA. Translation: CAI41080.1. Sequence problems.
AL137186 Genomic DNA. Translation: CAI41082.1.
AL137186 Genomic DNA. Translation: CAI41083.1.
CH471072 Genomic DNA. Translation: EAW86417.1.
CH471072 Genomic DNA. Translation: EAW86418.1.
CH471072 Genomic DNA. Translation: EAW86419.1. Sequence problems.
BC074726 mRNA. Translation: AAH74726.1.
BC107777 mRNA. Translation: AAI07778.1.
BC121140 mRNA. Translation: AAI21141.1.
BC121141 mRNA. Translation: AAI21142.1.
AF035279 mRNA. Translation: AAB88175.1. Different initiation.
CCDSiCCDS7074.1. [Q13261-1]
CCDS7075.2. [Q13261-3]
RefSeqiNP_001230468.1. NM_001243539.1.
NP_001243694.1. NM_001256765.1.
NP_002180.1. NM_002189.3. [Q13261-1]
NP_751950.2. NM_172200.2. [Q13261-3]
UniGeneiHs.445124.

Genome annotation databases

EnsembliENST00000379971; ENSP00000369306; ENSG00000134470. [Q13261-9]
ENST00000379977; ENSP00000369312; ENSG00000134470. [Q13261-1]
ENST00000397248; ENSP00000380421; ENSG00000134470.
ENST00000397250; ENSP00000380422; ENSG00000134470. [Q13261-8]
ENST00000397251; ENSP00000380423; ENSG00000134470. [Q13261-6]
ENST00000397255; ENSP00000380426; ENSG00000134470. [Q13261-4]
ENST00000525219; ENSP00000431529; ENSG00000134470.
ENST00000528354; ENSP00000435454; ENSG00000134470. [Q13261-3]
ENST00000530685; ENSP00000435995; ENSG00000134470. [Q13261-5]
GeneIDi3601.
KEGGihsa:3601.
UCSCiuc001iiv.3. human. [Q13261-1]
uc010qau.2. human. [Q13261-3]
uc021pmp.1. human. [Q13261-8]

Polymorphism databases

DMDMi59799763.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

SeattleSNPs

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U31628 mRNA. Translation: AAC50312.1 .
CR457064 mRNA. Translation: CAG33345.1 .
CR542023 mRNA. Translation: CAG46820.1 .
AY316538 Genomic DNA. Translation: AAP69528.1 .
AK304211 mRNA. Translation: BAG65084.1 .
AL137186 Genomic DNA. Translation: CAI41080.1 . Sequence problems.
AL137186 Genomic DNA. Translation: CAI41082.1 .
AL137186 Genomic DNA. Translation: CAI41083.1 .
CH471072 Genomic DNA. Translation: EAW86417.1 .
CH471072 Genomic DNA. Translation: EAW86418.1 .
CH471072 Genomic DNA. Translation: EAW86419.1 . Sequence problems.
BC074726 mRNA. Translation: AAH74726.1 .
BC107777 mRNA. Translation: AAI07778.1 .
BC121140 mRNA. Translation: AAI21141.1 .
BC121141 mRNA. Translation: AAI21142.1 .
AF035279 mRNA. Translation: AAB88175.1 . Different initiation.
CCDSi CCDS7074.1. [Q13261-1 ]
CCDS7075.2. [Q13261-3 ]
RefSeqi NP_001230468.1. NM_001243539.1.
NP_001243694.1. NM_001256765.1.
NP_002180.1. NM_002189.3. [Q13261-1 ]
NP_751950.2. NM_172200.2. [Q13261-3 ]
UniGenei Hs.445124.

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
2ERS NMR - A 31-96 [» ]
2Z3Q X-ray 1.85 B/D 31-132 [» ]
2Z3R X-ray 2.00 B/D/F/H/J/L/N/P 31-132 [» ]
4GS7 X-ray 2.35 D 30-97 [» ]
ProteinModelPortali Q13261.
SMRi Q13261. Positions 31-108.
ModBasei Search...

Protein-protein interaction databases

BioGridi 109814. 7 interactions.
IntActi Q13261. 7 interactions.
STRINGi 9606.ENSP00000369312.

Polymorphism databases

DMDMi 59799763.

Proteomic databases

PaxDbi Q13261.
PRIDEi Q13261.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000379971 ; ENSP00000369306 ; ENSG00000134470 . [Q13261-9 ]
ENST00000379977 ; ENSP00000369312 ; ENSG00000134470 . [Q13261-1 ]
ENST00000397248 ; ENSP00000380421 ; ENSG00000134470 .
ENST00000397250 ; ENSP00000380422 ; ENSG00000134470 . [Q13261-8 ]
ENST00000397251 ; ENSP00000380423 ; ENSG00000134470 . [Q13261-6 ]
ENST00000397255 ; ENSP00000380426 ; ENSG00000134470 . [Q13261-4 ]
ENST00000525219 ; ENSP00000431529 ; ENSG00000134470 .
ENST00000528354 ; ENSP00000435454 ; ENSG00000134470 . [Q13261-3 ]
ENST00000530685 ; ENSP00000435995 ; ENSG00000134470 . [Q13261-5 ]
GeneIDi 3601.
KEGGi hsa:3601.
UCSCi uc001iiv.3. human. [Q13261-1 ]
uc010qau.2. human. [Q13261-3 ]
uc021pmp.1. human. [Q13261-8 ]

Organism-specific databases

CTDi 3601.
GeneCardsi GC10M005991.
H-InvDB HIX0035314.
HGNCi HGNC:5978. IL15RA.
HPAi CAB026215.
MIMi 601070. gene.
neXtProti NX_Q13261.
PharmGKBi PA29791.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG41222.
HOVERGENi HBG052061.
InParanoidi Q13261.
KOi K05074.
OMAi GSHESSH.
OrthoDBi EOG7V767N.
PhylomeDBi Q13261.
TreeFami TF338443.

Enzyme and pathway databases

SignaLinki Q13261.

Miscellaneous databases

EvolutionaryTracei Q13261.
GeneWikii Interleukin_15_receptor,_alpha_subunit.
GenomeRNAii 3601.
NextBioi 14071.
PMAP-CutDB Q13261.
PROi Q13261.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q13261.
Bgeei Q13261.
CleanExi HS_IL15RA.
Genevestigatori Q13261.

Family and domain databases

InterProi IPR000436. Sushi_SCR_CCP.
[Graphical view ]
SMARTi SM00032. CCP. 1 hit.
[Graphical view ]
SUPFAMi SSF57535. SSF57535. 1 hit.
PROSITEi PS50923. SUSHI. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Functional characterization of the human interleukin-15 receptor alpha chain and close linkage of IL15RA and IL2RA genes."
    Anderson D.M., Kumaki S., Ahdieh M., Bertles J., Tometsko M., Loomis A., Giri J., Copeland N.G., Gilbert D.J., Jenkins N.A., Valentine V., Shapiro D.N., Morris S.W., Park L.S., Cosman D.
    J. Biol. Chem. 270:29862-29869(1995) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2 AND 3), FUNCTION, TISSUE SPECIFICITY, VARIANT THR-182.
    Tissue: Bone marrow stroma.
  2. "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)."
    Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
    Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
  3. SeattleSNPs variation discovery resource
    Submitted (JUN-2003) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANT THR-182.
  4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Trachea.
  5. "The DNA sequence and comparative analysis of human chromosome 10."
    Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L., Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K., Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L., Taylor A., Battles J.
    , Bird C.P., Ainscough R., Almeida J.P., Ashwell R.I.S., Ambrose K.D., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Bates K., Beasley H., Bray-Allen S., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Cahill P., Camire D., Carter N.P., Chapman J.C., Clark S.Y., Clarke G., Clee C.M., Clegg S., Corby N., Coulson A., Dhami P., Dutta I., Dunn M., Faulkner L., Frankish A., Frankland J.A., Garner P., Garnett J., Gribble S., Griffiths C., Grocock R., Gustafson E., Hammond S., Harley J.L., Hart E., Heath P.D., Ho T.P., Hopkins B., Horne J., Howden P.J., Huckle E., Hynds C., Johnson C., Johnson D., Kana A., Kay M., Kimberley A.M., Kershaw J.K., Kokkinaki M., Laird G.K., Lawlor S., Lee H.M., Leongamornlert D.A., Laird G., Lloyd C., Lloyd D.M., Loveland J., Lovell J., McLaren S., McLay K.E., McMurray A., Mashreghi-Mohammadi M., Matthews L., Milne S., Nickerson T., Nguyen M., Overton-Larty E., Palmer S.A., Pearce A.V., Peck A.I., Pelan S., Phillimore B., Porter K., Rice C.M., Rogosin A., Ross M.T., Sarafidou T., Sehra H.K., Shownkeen R., Skuce C.D., Smith M., Standring L., Sycamore N., Tester J., Thorpe A., Torcasso W., Tracey A., Tromans A., Tsolas J., Wall M., Walsh J., Wang H., Weinstock K., West A.P., Willey D.L., Whitehead S.L., Wilming L., Wray P.W., Young L., Chen Y., Lovering R.C., Moschonas N.K., Siebert R., Fechtel K., Bentley D., Durbin R.M., Hubbard T., Doucette-Stamm L., Beck S., Smith D.R., Rogers J.
    Nature 429:375-381(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 9), VARIANT THR-182.
    Tissue: Brain.
  8. "Large-scale concatenation cDNA sequencing."
    Yu W., Andersson B., Worley K.C., Muzny D.M., Ding Y., Liu W., Ricafrente J.Y., Wentland M.A., Lennon G., Gibbs R.A.
    Genome Res. 7:353-358(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 30-267 (ISOFORM 1).
    Tissue: Brain.
  9. "Natural splicing of exon 2 of human interleukin-15 receptor alpha-chain mRNA results in a shortened form with a distinct pattern of expression."
    Dubois S., Magrangeas F., Lehours P., Raher S., Bernard J., Boisteau O., Leroy S., Minvielle S., Godard A., Jacques Y.
    J. Biol. Chem. 274:26978-26984(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: ALTERNATIVE SPLICING (ISOFORMS 1; 2; 3; 4; 5; 6; 7 AND 8), TISSUE SPECIFICITY, SUBCELLULAR LOCATION, GLYCOSYLATION.
  10. "The IL-15R alpha chain signals through association with Syk in human B cells."
    Bulanova E., Budagian V., Pohl T., Krause H., Durkop H., Paus R., Bulfone-Paus S.
    J. Immunol. 167:6292-6302(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, INTERACTION WITH SYK, PHOSPHORYLATION BY SYK, MUTAGENESIS OF TYR-227.
  11. "Expression of IL-15 and IL-15 receptor isoforms in select structures of human fetal brain."
    Kurowska M., Rudnicka W., Maslinska D., Maslinski W.
    Ann. N. Y. Acad. Sci. 966:441-445(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: TISSUE SPECIFICITY.
  12. Cited for: LIGAND-BINDING.
  13. "Natural, proteolytic release of a soluble form of human IL-15 receptor alpha-chain that behaves as a specific, high affinity IL-15 antagonist."
    Mortier E., Bernard J., Plet A., Jacques Y.
    J. Immunol. 173:1681-1688(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: PROTEOLYTIC PROCESSING, LIGAND-BINDING.
  14. "The structure of the interleukin-15 alpha receptor and its implications for ligand binding."
    Lorenzen I., Dingley A.J., Jacques Y., Grotzinger J.
    J. Biol. Chem. 281:6642-6647(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: STRUCTURE BY NMR OF 31-96, DISULFIDE BONDS.
  15. "Crystal structure of the IL-15-IL-15Ralpha complex, a cytokine-receptor unit presented in trans."
    Chirifu M., Hayashi C., Nakamura T., Toma S., Shuto T., Kai H., Yamagata Y., Davis S.J., Ikemizu S.
    Nat. Immunol. 8:1001-1007(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: X-RAY CRYSTALLOGRAPHY (1.85 ANGSTROMS) OF 31-132 IN COMPLEX WITH IL15, DISULFIDE BONDS.

Entry informationi

Entry nameiI15RA_HUMAN
AccessioniPrimary (citable) accession number: Q13261
Secondary accession number(s): B4E2C2
, Q3B769, Q5JVA1, Q5JVA2, Q5JVA4, Q6B0J2, Q7LDR4, Q7Z609
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 1, 2005
Last sequence update: November 1, 1996
Last modified: September 3, 2014
This is version 128 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human cell differentiation molecules
    CD nomenclature of surface proteins of human leucocytes and list of entries
  2. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  7. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi