Reviewed,
UniProtKB/Swiss-Prot Q13261 (I15RA_HUMAN)
Last modified
June 16, 2009.
Version 78.
History...
Clusters with 100%,
90%,
50% identity |
Documents (6) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Interleukin-15 receptor subunit alpha Short name=IL-15R-alpha Short name=IL-15RA Cleaved into the following chain: 1- Recommended name: Soluble interleukin-15 receptor subunit alpha Short name=sIL-15R-alpha Short name=sIL-15RA | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 267 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Receptor for interleukin-15. Expression of different isoforms may alter or interfere with signal transduction. Isoform 6, isoform 7, isoform 8 and isoform 9 do not bind IL15. Signal transduction involves STAT3, STAT5, STAT6, JAK2 By similarity and SYK. |
| Subunit structure | The interleukin-15 receptor IL15R is a heterotrimer of IL15RA, IL2RB and IL2RG. IL15RA also self-associates By similarity. Interacts with SYK. |
| Subcellular location | Membrane; Single-pass type I membrane protein. Nucleus membrane; Single-pass type I membrane protein. Note: Mainly found associated with the nuclear membrane. Ref.7 Isoform 6: Endoplasmic reticulum membrane; Single-pass type I membrane protein. Golgi apparatus membrane; Single-pass type I membrane protein. Cytoplasmic vesicle membrane; Single-pass type I membrane protein. Membrane; Single-pass type I membrane protein. Note: Isoform 6, isoform 7, isoform 8 and isoform 9 are associated with endoplasmic reticulum, Golgi and cytoplasmic vesicles, but not with the nuclear membrane. Ref.7 Isoform 7: Endoplasmic reticulum membrane; Single-pass type I membrane protein. Golgi apparatus membrane; Single-pass type I membrane protein. Cytoplasmic vesicle membrane; Single-pass type I membrane protein. Membrane; Single-pass type I membrane protein. Note: Isoform 6, isoform 7, isoform 8 and isoform 9 are associated with endoplasmic reticulum, Golgi and cytoplasmic vesicles, but not with the nuclear membrane. Ref.7 Isoform 8: Endoplasmic reticulum membrane; Single-pass type I membrane protein. Golgi apparatus membrane; Single-pass type I membrane protein. Cytoplasmic vesicle membrane; Single-pass type I membrane protein. Membrane; Single-pass type I membrane protein. Note: Isoform 6, isoform 7, isoform 8 and isoform 9 are associated with endoplasmic reticulum, Golgi and cytoplasmic vesicles, but not with the nuclear membrane. Ref.7 Isoform 9: Endoplasmic reticulum membrane; Single-pass type I membrane protein. Golgi apparatus membrane; Single-pass type I membrane protein. Cytoplasmic vesicle membrane; Single-pass type I membrane protein. Membrane; Single-pass type I membrane protein. Note: Isoform 6, isoform 7, isoform 8 and isoform 9 are associated with endoplasmic reticulum, Golgi and cytoplasmic vesicles, but not with the nuclear membrane. Ref.7 Soluble interleukin-15 receptor subunit alpha: Secreted › extracellular space. Ref.7 |
| Tissue specificity | Isoform 1, isoform 3, isoform 4, isoform 5, isoform 6, isoform 7, isoform 8 and isoform 9 are widely expressed. Expressed in fetal brain with higher expression in the hippocampus and cerebellum than in cortex and thalamus. Higher levels of soluble sIL-15RA form in comparison with membrane-bound forms is present in all brain structures. Ref.7 Ref.1 Ref.9 |
| Post-translational modification | A soluble form (sIL-15RA) arises from proteolytic shedding of the membrane-anchored receptor. The cleavage involves ADAM17/TACE By similarity. It also binds IL-15 and thus interferes with IL-15 binding to the membrane receptor. Phosphorylated by activated SYK. Ref.8 N-glycosylated and O-glycosylated. Ref.7 |
| Sequence similarities | Contains 1 Sushi (CCP/SCR) domain. |
Ontologies
Alternative products
| This entry describes 9 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q13261-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q13261-2) The sequence of this isoform differs from the canonical sequence as follows: 1-36: Missing. | ||||||
| Isoform 3 (identifier: Q13261-3) Also known as: delta3E1E7Il-15RA; The sequence of this isoform differs from the canonical sequence as follows: 95-128: RDPALVHQRPAPPSTVTTAGVTPQPESLSPSGKE → K | ||||||
| Isoform 4 (identifier: Q13261-4) Also known as: E1E7'Il-15RA; The sequence of this isoform differs from the canonical sequence as follows: 232-267: QTPPLASVEMEAMEALPVTWGTSSRDEDLENCSHHL → ASVCSCHPRSAGHTCSVGSV | ||||||
| Isoform 5 (identifier: Q13261-5) Also known as: delta3E1E7'Il-15RA; The sequence of this isoform differs from the canonical sequence as follows: 95-128: RDPALVHQRPAPPSTVTTAGVTPQPESLSPSGKE → K 232-267: QTPPLASVEMEAMEALPVTWGTSSRDEDLENCSHHL → ASVCSCHPRSAGHTCSVGSV | ||||||
| Isoform 6 (identifier: Q13261-6) Also known as: delta2E1E7Il-15RA; The sequence of this isoform differs from the canonical sequence as follows: 31-95: Missing. | ||||||
| Note: Isoform 6, isoform 7, isoform 8 and isoform 9 are associated with endoplasmic reticulum, Golgi and cytoplasmic vesicles, but not with the nuclear membrane. Ref.7 | ||||||
| Isoform 7 (identifier: Q13261-7) Also known as: delta2E1E7'Il-15RA; The sequence of this isoform differs from the canonical sequence as follows: 31-95: Missing. 232-267: QTPPLASVEMEAMEALPVTWGTSSRDEDLENCSHHL → ASVCSCHPRSAGHTCSVGSV | ||||||
| Note: Isoform 6, isoform 7, isoform 8 and isoform 9 are associated with endoplasmic reticulum, Golgi and cytoplasmic vesicles, but not with the nuclear membrane. Ref.7 | ||||||
| Isoform 8 (identifier: Q13261-8) Also known as: delta2deltaE1E73Il-15RA; The sequence of this isoform differs from the canonical sequence as follows: 30-127: Missing. | ||||||
| Note: Isoform 6, isoform 7, isoform 8 and isoform 9 are associated with endoplasmic reticulum, Golgi and cytoplasmic vesicles, but not with the nuclear membrane. Ref.7 | ||||||
| Isoform 9 (identifier: Q13261-9) Also known as: delta2delta3E1E7'Il-15RA; The sequence of this isoform differs from the canonical sequence as follows: 30-127: Missing. 232-267: QTPPLASVEMEAMEALPVTWGTSSRDEDLENCSHHL → ASVCSCHPRSAGHTCSVGSV | ||||||
| Note: Isoform 6, isoform 7, isoform 8 and isoform 9 are associated with endoplasmic reticulum, Golgi and cytoplasmic vesicles, but not with the nuclear membrane. Ref.7 |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 30 | 30 | Potential | ||||||||||||||||||||||
| Chain | 31 – 267 | 237 | Interleukin-15 receptor subunit alpha | PRO_0000011044 | |||||||||||||||||||||
| Chain | 31 – ? | Soluble interleukin-15 receptor subunit alpha | PRO_0000333855 | ||||||||||||||||||||||
Regions | |||||||||||||||||||||||||
| Topological domain | 31 – 205 | 175 | Extracellular Potential | ||||||||||||||||||||||
| Transmembrane | 206 – 228 | 23 | Potential | ||||||||||||||||||||||
| Topological domain | 229 – 267 | 39 | Cytoplasmic Potential | ||||||||||||||||||||||
| Domain | 31 – 95 | 65 | Sushi | ||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||
| Glycosylation | 137 | 1 | N-linked (GlcNAc...) Potential | ||||||||||||||||||||||
| Disulfide bond | 33 ↔ 75 | Ref.12 Ref.13 | |||||||||||||||||||||||
| Disulfide bond | 59 ↔ 93 | Ref.12 Ref.13 | |||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||
| Alternative sequence | 1 – 36 | 36 | Missing in isoform 2. | VSP_012622 | |||||||||||||||||||||
| Alternative sequence | 30 – 127 | 98 | Missing in isoform 8 and isoform 9. | VSP_012623 | |||||||||||||||||||||
| Alternative sequence | 31 – 95 | 65 | Missing in isoform 6 and isoform 7. | VSP_012624 | |||||||||||||||||||||
| Alternative sequence | 95 – 128 | 34 | RDPAL…PSGKE → K in isoform 3 and isoform 5. | VSP_012625 | |||||||||||||||||||||
| Alternative sequence | 232 – 267 | 36 | QTPPL…CSHHL → ASVCSCHPRSAGHTCSVGSV in isoform 4, isoform 5, isoform 7 and isoform 9. | VSP_012626 | |||||||||||||||||||||
| Natural variant | 182 | 1 | N → T: dbSNP rs2228059. Ref.1 Ref.4 | VAR_020967 | |||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||
| Mutagenesis | 227 | 1 | Y → F: Abrogates association with SYK and phosphorylation upon IL-15 stimulation. Ref.8 | ||||||||||||||||||||||
| Sequence conflict | 200 | 1 | G → D in AAH74726. Ref.6 | ||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||
| Beta strand | 42 – 44 | 3 | |||||||||||||||||||||||
| Beta strand | 54 – 59 | 6 | |||||||||||||||||||||||
| Beta strand | 63 – 65 | 3 | |||||||||||||||||||||||
| Beta strand | 72 – 77 | 6 | |||||||||||||||||||||||
| Turn | 79 – 81 | 3 | |||||||||||||||||||||||
| Beta strand | 84 – 86 | 3 | |||||||||||||||||||||||
| Beta strand | 93 – 95 | 3 | |||||||||||||||||||||||
| Helix | 97 – 102 | 6 | |||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Functional characterization of the human interleukin-15 receptor alpha chain and close linkage of IL15RA and IL2RA genes." Anderson D.M., Kumaki S., Ahdieh M., Bertles J., Tometsko M., Loomis A., Giri J., Copeland N.G., Gilbert D.J., Jenkins N.A., Valentine V., Shapiro D.N., Morris S.W., Park L.S., Cosman D. J. Biol. Chem. 270:29862-29869(1995) [PubMed: 8530383] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 3 AND 4), FUNCTION, TISSUE SPECIFICITY, VARIANT THR-182. Tissue: Bone marrow stroma. |
| [2] | "Large-scale concatenation cDNA sequencing." Yu W., Andersson B., Worley K.C., Muzny D.M., Ding Y., Liu W., Ricafrente J.Y., Wentland M.A., Lennon G., Gibbs R.A. Genome Res. 7:353-358(1997) [PubMed: 9110174] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Brain. |
| [3] | "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)." Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). |
| [4] | SeattleSNPs variation discovery resource Submitted (JUN-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANT THR-182. |
| [5] | "The DNA sequence and comparative analysis of human chromosome 10." Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L., Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K., Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L., Taylor A., Battles J. Rogers J.Nature 429:375-381(2004) [PubMed: 15164054] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Brain. |
| [7] | "Natural splicing of exon 2 of human interleukin-15 receptor alpha-chain mRNA results in a shortened form with a distinct pattern of expression." Dubois S., Magrangeas F., Lehours P., Raher S., Bernard J., Boisteau O., Leroy S., Minvielle S., Godard A., Jacques Y. J. Biol. Chem. 274:26978-26984(1999) [PubMed: 10480910] [Abstract] Cited for: ALTERNATIVE SPLICING (ISOFORMS 1; 3; 4; 5; 6; 7; 8 AND 9), TISSUE SPECIFICITY, SUBCELLULAR LOCATION, GLYCOSYLATION. |
| [8] | "The IL-15R alpha chain signals through association with Syk in human B cells." Bulanova E., Budagian V., Pohl T., Krause H., Durkop H., Paus R., Bulfone-Paus S. J. Immunol. 167:6292-6302(2001) [PubMed: 11714793] [Abstract] Cited for: FUNCTION, INTERACTION WITH SYK, PHOSPHORYLATION BY SYK, MUTAGENESIS OF TYR-227. |
| [9] | "Expression of IL-15 and IL-15 receptor isoforms in select structures of human fetal brain." Kurowska M., Rudnicka W., Maslinska D., Maslinski W. Ann. N. Y. Acad. Sci. 966:441-445(2002) [PubMed: 12114302] [Abstract] Cited for: TISSUE SPECIFICITY. |
| [10] | "Identification of an interleukin-15alpha receptor-binding site on human interleukin-15." Bernard J., Harb C., Mortier E., Quemener A., Meloen R.H., Vermot-Desroches C., Wijdeness J., van Dijken P., Grotzinger J., Slootstra J.W., Plet A., Jacques Y. J. Biol. Chem. 279:24313-24322(2004) [PubMed: 15039446] [Abstract] Cited for: LIGAND-BINDING. |
| [11] | "Natural, proteolytic release of a soluble form of human IL-15 receptor alpha-chain that behaves as a specific, high affinity IL-15 antagonist." Mortier E., Bernard J., Plet A., Jacques Y. J. Immunol. 173:1681-1688(2004) [PubMed: 15265897] [Abstract] Cited for: PROTEOLYTIC PROCESSING, LIGAND-BINDING. |
| [12] | "The structure of the interleukin-15 alpha receptor and its implications for ligand binding." Lorenzen I., Dingley A.J., Jacques Y., Grotzinger J. J. Biol. Chem. 281:6642-6647(2006) [PubMed: 16377614] [Abstract] Cited for: STRUCTURE BY NMR OF 31-96, DISULFIDE BONDS. |
| [13] | "Crystal structure of the IL-15-IL-15Ralpha complex, a cytokine-receptor unit presented in trans." Chirifu M., Hayashi C., Nakamura T., Toma S., Shuto T., Kai H., Yamagata Y., Davis S.J., Ikemizu S. Nat. Immunol. 8:1001-1007(2007) [PubMed: 17643103] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (1.85 ANGSTROMS) OF 31-132 IN COMPLEX WITH IL15, DISULFIDE BONDS. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| U31628 mRNA. Translation: AAC50312.1. AF035279 mRNA. Translation: AAB88175.1. CR457064 mRNA. Translation: CAG33345.1. CR542023 mRNA. Translation: CAG46820.1. AY316538 Genomic DNA. Translation: AAP69528.1. AL137186 Genomic DNA. Translation: CAI41082.1. BC074726 mRNA. Translation: AAH74726.1. BC121140 mRNA. Translation: AAI21141.1. BC121141 mRNA. Translation: AAI21142.1. | |||||||||||||||||||||||||
| IPI | IPI00031807. IPI00180012. IPI00549208. IPI00549663. IPI00550381. IPI00550582. IPI00550778. IPI00550789. IPI00551001. | ||||||||||||||||||||||||
| RefSeq | NP_002180.1. NP_751950.1. | ||||||||||||||||||||||||
| UniGene | Hs.524117 | ||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||
| |||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||
| IntAct | Q13261. 1 interaction. | ||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||
| PRIDE | Q13261. | ||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||
| Ensembl | ENSG00000134470. Homo sapiens. [Contig view] | ||||||||||||||||||||||||
| GeneID | 3601. | ||||||||||||||||||||||||
| KEGG | hsa:3601. | ||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||
| GeneCards | GC10M006034. | ||||||||||||||||||||||||
| H-InvDB | HIX0035314. | ||||||||||||||||||||||||
| HGNC | HGNC:5978. IL15RA. | ||||||||||||||||||||||||
| MIM | 601070. gene. | ||||||||||||||||||||||||
| PharmGKB | PA29791. | ||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||
| HOGENOM | Q13261. | ||||||||||||||||||||||||
| HOVERGEN | Q13261. | ||||||||||||||||||||||||
| OMA | Q13261. DEDLENC. | ||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||
| ArrayExpress | Q13261. | ||||||||||||||||||||||||
| Bgee | Q13261. | ||||||||||||||||||||||||
| CleanEx | HS_IL15RA. | ||||||||||||||||||||||||
| GermOnline | ENSG00000134470. Homo sapiens. | ||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||
| InterPro | IPR000436. Sushi_SCR_CCP. [Graphical view] | ||||||||||||||||||||||||
| SMART | SM00032. CCP. 1 hit. [Graphical view] | ||||||||||||||||||||||||
| PROSITE | PS50923. SUSHI. 1 hit. [Graphical view] | ||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||
Other Resources | |||||||||||||||||||||||||
| NextBio | 14071. | ||||||||||||||||||||||||
| PMAP-CutDB | Q13261. | ||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||
Entry information
| Entry name | I15RA_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q13261 Secondary accession number(s): Q5JVA2 Q7Z609 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| Human chromosome 10 Human chromosome 10: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with


