Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q13261

- I15RA_HUMAN

UniProt

Q13261 - I15RA_HUMAN

Protein

Interleukin-15 receptor subunit alpha

Gene

IL15RA

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 129 (01 Oct 2014)
      Sequence version 1 (01 Nov 1996)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    High-affinity receptor for interleukin-15. Can signal both in cis and trans where IL15R from one subset of cells presents IL15 to neighboring IL2RG-expressing cells. Expression of different isoforms may alter or interfere with signal transduction. Isoform 5, isoform 6, isoform 7 and isoform 8 do not bind IL15. Signal transduction involves SYK.2 Publications

    GO - Molecular functioni

    1. cytokine receptor activity Source: UniProtKB
    2. protein binding Source: IntAct
    3. signal transducer activity Source: ProtInc

    GO - Biological processi

    1. cell proliferation Source: ProtInc
    2. cytokine-mediated signaling pathway Source: GOC
    3. JAK-STAT cascade Source: Ensembl
    4. negative regulation of neuron projection development Source: Ensembl
    5. positive regulation of natural killer cell differentiation Source: Ensembl
    6. response to nutrient levels Source: Ensembl
    7. signal transduction Source: ProtInc

    Keywords - Molecular functioni

    Receptor

    Enzyme and pathway databases

    SignaLinkiQ13261.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Interleukin-15 receptor subunit alpha
    Short name:
    IL-15 receptor subunit alpha
    Short name:
    IL-15R-alpha
    Short name:
    IL-15RA
    Alternative name(s):
    CD_antigen: CD215
    Cleaved into the following chain:
    Soluble interleukin-15 receptor subunit alpha
    Short name:
    sIL-15 receptor subunit alpha
    Short name:
    sIL-15R-alpha
    Short name:
    sIL-15RA
    Gene namesi
    Name:IL15RA
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 10

    Organism-specific databases

    HGNCiHGNC:5978. IL15RA.

    Subcellular locationi

    Membrane 1 Publication; Single-pass type I membrane protein 1 Publication. Nucleus membrane 1 Publication; Single-pass type I membrane protein 1 Publication
    Note: Mainly found associated with the nuclear membrane.
    Isoform 5 : Endoplasmic reticulum membrane; Single-pass type I membrane protein. Golgi apparatus membrane; Single-pass type I membrane protein. Cytoplasmic vesicle membrane; Single-pass type I membrane protein. Membrane; Single-pass type I membrane protein
    Note: Isoform 5, isoform 6, isoform 7 and isoform 8 are associated with endoplasmic reticulum, Golgi and cytoplasmic vesicles, but not with the nuclear membrane.
    Isoform 6 : Endoplasmic reticulum membrane; Single-pass type I membrane protein. Golgi apparatus membrane; Single-pass type I membrane protein. Cytoplasmic vesicle membrane; Single-pass type I membrane protein. Membrane; Single-pass type I membrane protein
    Note: Isoform 5, isoform 6, isoform 7 and isoform 8 are associated with endoplasmic reticulum, Golgi and cytoplasmic vesicles, but not with the nuclear membrane.
    Isoform 7 : Endoplasmic reticulum membrane; Single-pass type I membrane protein. Golgi apparatus membrane; Single-pass type I membrane protein. Cytoplasmic vesicle membrane; Single-pass type I membrane protein. Membrane; Single-pass type I membrane protein
    Note: Isoform 5, isoform 6, isoform 7 and isoform 8 are associated with endoplasmic reticulum, Golgi and cytoplasmic vesicles, but not with the nuclear membrane.
    Isoform 8 : Endoplasmic reticulum membrane; Single-pass type I membrane protein. Golgi apparatus membrane; Single-pass type I membrane protein. Cytoplasmic vesicle membrane; Single-pass type I membrane protein. Membrane; Single-pass type I membrane protein
    Note: Isoform 5, isoform 6, isoform 7 and isoform 8 are associated with endoplasmic reticulum, Golgi and cytoplasmic vesicles, but not with the nuclear membrane.

    GO - Cellular componenti

    1. cytoplasmic vesicle membrane Source: UniProtKB-SubCell
    2. endoplasmic reticulum membrane Source: UniProtKB-SubCell
    3. extracellular space Source: UniProtKB-SubCell
    4. Golgi membrane Source: UniProtKB-SubCell
    5. integral component of membrane Source: UniProtKB-KW
    6. nuclear membrane Source: UniProtKB-SubCell
    7. plasma membrane Source: Ensembl

    Keywords - Cellular componenti

    Cytoplasmic vesicle, Endoplasmic reticulum, Golgi apparatus, Membrane, Nucleus, Secreted

    Pathology & Biotechi

    Mutagenesis

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Mutagenesisi227 – 2271Y → F: Abrogates association with SYK and phosphorylation upon IL-15 stimulation. 1 Publication

    Organism-specific databases

    PharmGKBiPA29791.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 3030Sequence AnalysisAdd
    BLAST
    Chaini31 – 267237Interleukin-15 receptor subunit alphaPRO_0000011044Add
    BLAST
    Chaini31 – ?Soluble interleukin-15 receptor subunit alphaPRO_0000333855

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Disulfide bondi33 ↔ 75
    Disulfide bondi59 ↔ 93
    Glycosylationi137 – 1371N-linked (GlcNAc...)Sequence Analysis

    Post-translational modificationi

    A soluble form (sIL-15RA) arises from proteolytic shedding of the membrane-anchored receptor. The cleavage involves ADAM17/TACE By similarity. It also binds IL-15 and thus interferes with IL-15 binding to the membrane receptor.By similarity1 Publication
    Phosphorylated by activated SYK.1 Publication
    N-glycosylated and O-glycosylated.1 Publication

    Keywords - PTMi

    Disulfide bond, Glycoprotein, Phosphoprotein

    Proteomic databases

    PaxDbiQ13261.
    PRIDEiQ13261.

    Miscellaneous databases

    PMAP-CutDBQ13261.

    Expressioni

    Tissue specificityi

    Isoform 1, isoform 3, isoform 4, isoform 5, isoform 6, isoform 7, isoform 8 and isoform 9 are widely expressed. Expressed in fetal brain with higher expression in the hippocampus and cerebellum than in cortex and thalamus. Higher levels of soluble sIL-15RA form in comparison with membrane-bound forms is present in all brain structures.3 Publications

    Gene expression databases

    ArrayExpressiQ13261.
    BgeeiQ13261.
    CleanExiHS_IL15RA.
    GenevestigatoriQ13261.

    Organism-specific databases

    HPAiCAB026215.

    Interactioni

    Subunit structurei

    The interleukin-15 receptor IL15R is a heterotrimer of IL15RA, IL2RB and IL2RG. IL15RA also self-associates By similarity. Interacts with SYK.By similarity2 Publications

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    IL15P409333EBI-980354,EBI-980274

    Protein-protein interaction databases

    BioGridi109814. 7 interactions.
    IntActiQ13261. 7 interactions.
    STRINGi9606.ENSP00000369312.

    Structurei

    Secondary structure

    1
    267
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Beta strandi42 – 443
    Beta strandi54 – 596
    Beta strandi63 – 653
    Beta strandi72 – 776
    Turni79 – 813
    Beta strandi84 – 863
    Beta strandi93 – 953
    Helixi97 – 1026

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    2ERSNMR-A31-96[»]
    2Z3QX-ray1.85B/D31-132[»]
    2Z3RX-ray2.00B/D/F/H/J/L/N/P31-132[»]
    4GS7X-ray2.35D30-97[»]
    ProteinModelPortaliQ13261.
    SMRiQ13261. Positions 31-108.
    ModBaseiSearch...
    MobiDBiSearch...

    Miscellaneous databases

    EvolutionaryTraceiQ13261.

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini31 – 205175ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini229 – 26739CytoplasmicSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei206 – 22823HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini31 – 9565SushiPROSITE-ProRule annotationAdd
    BLAST

    Sequence similaritiesi

    Contains 1 Sushi (CCP/SCR) domain.PROSITE-ProRule annotation

    Keywords - Domaini

    Signal, Sushi, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG41222.
    HOVERGENiHBG052061.
    InParanoidiQ13261.
    KOiK05074.
    OMAiGSHESSH.
    OrthoDBiEOG7V767N.
    PhylomeDBiQ13261.
    TreeFamiTF338443.

    Family and domain databases

    InterProiIPR000436. Sushi_SCR_CCP.
    [Graphical view]
    SMARTiSM00032. CCP. 1 hit.
    [Graphical view]
    SUPFAMiSSF57535. SSF57535. 1 hit.
    PROSITEiPS50923. SUSHI. 1 hit.
    [Graphical view]

    Sequences (9)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 9 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q13261-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MAPRRARGCR TLGLPALLLL LLLRPPATRG ITCPPPMSVE HADIWVKSYS    50
    LYSRERYICN SGFKRKAGTS SLTECVLNKA TNVAHWTTPS LKCIRDPALV 100
    HQRPAPPSTV TTAGVTPQPE SLSPSGKEPA ASSPSSNNTA ATTAAIVPGS 150
    QLMPSKSPST GTTEISSHES SHGTPSQTTA KNWELTASAS HQPPGVYPQG 200
    HSDTTVAIST STVLLCGLSA VSLLACYLKS RQTPPLASVE MEAMEALPVT 250
    WGTSSRDEDL ENCSHHL 267
    Length:267
    Mass (Da):28,233
    Last modified:November 1, 1996 - v1
    Checksum:iA9CFC885189E96BE
    GO
    Isoform 2 (identifier: Q13261-3) [UniParc]FASTAAdd to Basket

    Also known as: delta3E1E7Il-15RA

    The sequence of this isoform differs from the canonical sequence as follows:
         95-128: RDPALVHQRPAPPSTVTTAGVTPQPESLSPSGKE → K

    Show »
    Length:234
    Mass (Da):24,870
    Checksum:i9ACAD3E117A8C9AF
    GO
    Isoform 3 (identifier: Q13261-4) [UniParc]FASTAAdd to Basket

    Also known as: E1E7'Il-15RA

    The sequence of this isoform differs from the canonical sequence as follows:
         232-267: QTPPLASVEMEAMEALPVTWGTSSRDEDLENCSHHL → ASVCSCHPRSAGHTCSVGSVC

    Show »
    Length:252
    Mass (Da):26,299
    Checksum:iA58933D9E843EDC6
    GO
    Isoform 4 (identifier: Q13261-5) [UniParc]FASTAAdd to Basket

    Also known as: delta3E1E7'Il-15RA

    The sequence of this isoform differs from the canonical sequence as follows:
         95-128: RDPALVHQRPAPPSTVTTAGVTPQPESLSPSGKE → K
         232-267: QTPPLASVEMEAMEALPVTWGTSSRDEDLENCSHHL → ASVCSCHPRSAGHTCSVGSVC

    Show »
    Length:219
    Mass (Da):22,936
    Checksum:iDD564A227CB6AA3F
    GO
    Isoform 5 (identifier: Q13261-6) [UniParc]FASTAAdd to Basket

    Also known as: delta2E1E7Il-15RA

    The sequence of this isoform differs from the canonical sequence as follows:
         31-95: Missing.

    Show »
    Length:202
    Mass (Da):20,904
    Checksum:iD4F5DD2EA004C6D2
    GO
    Isoform 6 (identifier: Q13261-7) [UniParc]FASTAAdd to Basket

    Also known as: delta2E1E7'Il-15RA

    The sequence of this isoform differs from the canonical sequence as follows:
         31-95: Missing.
         232-267: QTPPLASVEMEAMEALPVTWGTSSRDEDLENCSHHL → ASVCSCHPRSAGHTCSVGSVC

    Show »
    Length:187
    Mass (Da):18,969
    Checksum:iD7A5B6202C329FB0
    GO
    Isoform 7 (identifier: Q13261-8) [UniParc]FASTAAdd to Basket

    Also known as: delta2deltaE1E73Il-15RA

    The sequence of this isoform differs from the canonical sequence as follows:
         30-127: Missing.

    Show »
    Length:169
    Mass (Da):17,641
    Checksum:i238A6ECC5B7675A1
    GO
    Isoform 8 (identifier: Q13261-9) [UniParc]FASTAAdd to Basket

    Also known as: delta2delta3E1E7'Il-15RA

    The sequence of this isoform differs from the canonical sequence as follows:
         30-127: Missing.
         232-267: QTPPLASVEMEAMEALPVTWGTSSRDEDLENCSHHL → ASVCSCHPRSAGHTCSVGSVC

    Show »
    Length:154
    Mass (Da):15,707
    Checksum:i23F224FD25881D2C
    GO
    Isoform 9 (identifier: Q13261-10) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-36: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:231
    Mass (Da):24,388
    Checksum:i85A770AB71977219
    GO

    Sequence cautioni

    The sequence AAB88175.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.
    The sequence CAI41080.1 differs from that shown. Reason: Erroneous gene model prediction.
    The sequence EAW86419.1 differs from that shown. Reason: Erroneous gene model prediction.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti200 – 2001G → D in AAH74726. (PubMed:9110174)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti182 – 1821N → T.3 Publications
    Corresponds to variant rs2228059 [ dbSNP | Ensembl ].
    VAR_020967

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 3636Missing in isoform 9. 1 PublicationVSP_055406Add
    BLAST
    Alternative sequencei30 – 12798Missing in isoform 7 and isoform 8. CuratedVSP_012623Add
    BLAST
    Alternative sequencei31 – 9565Missing in isoform 5 and isoform 6. CuratedVSP_012624Add
    BLAST
    Alternative sequencei95 – 12834RDPAL…PSGKE → K in isoform 2 and isoform 4. 2 PublicationsVSP_012625Add
    BLAST
    Alternative sequencei232 – 26736QTPPL…CSHHL → ASVCSCHPRSAGHTCSVGSV C in isoform 3, isoform 4, isoform 6 and isoform 8. 1 PublicationVSP_012626Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U31628 mRNA. Translation: AAC50312.1.
    CR457064 mRNA. Translation: CAG33345.1.
    CR542023 mRNA. Translation: CAG46820.1.
    AY316538 Genomic DNA. Translation: AAP69528.1.
    AK304211 mRNA. Translation: BAG65084.1.
    AL137186 Genomic DNA. Translation: CAI41080.1. Sequence problems.
    AL137186 Genomic DNA. Translation: CAI41082.1.
    AL137186 Genomic DNA. Translation: CAI41083.1.
    CH471072 Genomic DNA. Translation: EAW86417.1.
    CH471072 Genomic DNA. Translation: EAW86418.1.
    CH471072 Genomic DNA. Translation: EAW86419.1. Sequence problems.
    BC074726 mRNA. Translation: AAH74726.1.
    BC107777 mRNA. Translation: AAI07778.1.
    BC121140 mRNA. Translation: AAI21141.1.
    BC121141 mRNA. Translation: AAI21142.1.
    AF035279 mRNA. Translation: AAB88175.1. Different initiation.
    CCDSiCCDS7074.1. [Q13261-1]
    CCDS7075.2. [Q13261-3]
    RefSeqiNP_001230468.1. NM_001243539.1.
    NP_001243694.1. NM_001256765.1.
    NP_002180.1. NM_002189.3. [Q13261-1]
    NP_751950.2. NM_172200.2. [Q13261-3]
    UniGeneiHs.445124.

    Genome annotation databases

    EnsembliENST00000379971; ENSP00000369306; ENSG00000134470. [Q13261-9]
    ENST00000379977; ENSP00000369312; ENSG00000134470. [Q13261-1]
    ENST00000397248; ENSP00000380421; ENSG00000134470. [Q13261-10]
    ENST00000397250; ENSP00000380422; ENSG00000134470. [Q13261-8]
    ENST00000397251; ENSP00000380423; ENSG00000134470. [Q13261-6]
    ENST00000397255; ENSP00000380426; ENSG00000134470. [Q13261-4]
    ENST00000525219; ENSP00000431529; ENSG00000134470. [Q13261-10]
    ENST00000528354; ENSP00000435454; ENSG00000134470. [Q13261-3]
    ENST00000530685; ENSP00000435995; ENSG00000134470. [Q13261-5]
    GeneIDi3601.
    KEGGihsa:3601.
    UCSCiuc001iiv.3. human. [Q13261-1]
    uc010qau.2. human. [Q13261-3]
    uc021pmp.1. human. [Q13261-8]

    Polymorphism databases

    DMDMi59799763.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Web resourcesi

    SeattleSNPs

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U31628 mRNA. Translation: AAC50312.1 .
    CR457064 mRNA. Translation: CAG33345.1 .
    CR542023 mRNA. Translation: CAG46820.1 .
    AY316538 Genomic DNA. Translation: AAP69528.1 .
    AK304211 mRNA. Translation: BAG65084.1 .
    AL137186 Genomic DNA. Translation: CAI41080.1 . Sequence problems.
    AL137186 Genomic DNA. Translation: CAI41082.1 .
    AL137186 Genomic DNA. Translation: CAI41083.1 .
    CH471072 Genomic DNA. Translation: EAW86417.1 .
    CH471072 Genomic DNA. Translation: EAW86418.1 .
    CH471072 Genomic DNA. Translation: EAW86419.1 . Sequence problems.
    BC074726 mRNA. Translation: AAH74726.1 .
    BC107777 mRNA. Translation: AAI07778.1 .
    BC121140 mRNA. Translation: AAI21141.1 .
    BC121141 mRNA. Translation: AAI21142.1 .
    AF035279 mRNA. Translation: AAB88175.1 . Different initiation.
    CCDSi CCDS7074.1. [Q13261-1 ]
    CCDS7075.2. [Q13261-3 ]
    RefSeqi NP_001230468.1. NM_001243539.1.
    NP_001243694.1. NM_001256765.1.
    NP_002180.1. NM_002189.3. [Q13261-1 ]
    NP_751950.2. NM_172200.2. [Q13261-3 ]
    UniGenei Hs.445124.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    2ERS NMR - A 31-96 [» ]
    2Z3Q X-ray 1.85 B/D 31-132 [» ]
    2Z3R X-ray 2.00 B/D/F/H/J/L/N/P 31-132 [» ]
    4GS7 X-ray 2.35 D 30-97 [» ]
    ProteinModelPortali Q13261.
    SMRi Q13261. Positions 31-108.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 109814. 7 interactions.
    IntActi Q13261. 7 interactions.
    STRINGi 9606.ENSP00000369312.

    Polymorphism databases

    DMDMi 59799763.

    Proteomic databases

    PaxDbi Q13261.
    PRIDEi Q13261.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000379971 ; ENSP00000369306 ; ENSG00000134470 . [Q13261-9 ]
    ENST00000379977 ; ENSP00000369312 ; ENSG00000134470 . [Q13261-1 ]
    ENST00000397248 ; ENSP00000380421 ; ENSG00000134470 . [Q13261-10 ]
    ENST00000397250 ; ENSP00000380422 ; ENSG00000134470 . [Q13261-8 ]
    ENST00000397251 ; ENSP00000380423 ; ENSG00000134470 . [Q13261-6 ]
    ENST00000397255 ; ENSP00000380426 ; ENSG00000134470 . [Q13261-4 ]
    ENST00000525219 ; ENSP00000431529 ; ENSG00000134470 . [Q13261-10 ]
    ENST00000528354 ; ENSP00000435454 ; ENSG00000134470 . [Q13261-3 ]
    ENST00000530685 ; ENSP00000435995 ; ENSG00000134470 . [Q13261-5 ]
    GeneIDi 3601.
    KEGGi hsa:3601.
    UCSCi uc001iiv.3. human. [Q13261-1 ]
    uc010qau.2. human. [Q13261-3 ]
    uc021pmp.1. human. [Q13261-8 ]

    Organism-specific databases

    CTDi 3601.
    GeneCardsi GC10M005991.
    H-InvDB HIX0035314.
    HGNCi HGNC:5978. IL15RA.
    HPAi CAB026215.
    MIMi 601070. gene.
    neXtProti NX_Q13261.
    PharmGKBi PA29791.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG41222.
    HOVERGENi HBG052061.
    InParanoidi Q13261.
    KOi K05074.
    OMAi GSHESSH.
    OrthoDBi EOG7V767N.
    PhylomeDBi Q13261.
    TreeFami TF338443.

    Enzyme and pathway databases

    SignaLinki Q13261.

    Miscellaneous databases

    EvolutionaryTracei Q13261.
    GeneWikii Interleukin_15_receptor,_alpha_subunit.
    GenomeRNAii 3601.
    NextBioi 14071.
    PMAP-CutDB Q13261.
    PROi Q13261.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q13261.
    Bgeei Q13261.
    CleanExi HS_IL15RA.
    Genevestigatori Q13261.

    Family and domain databases

    InterProi IPR000436. Sushi_SCR_CCP.
    [Graphical view ]
    SMARTi SM00032. CCP. 1 hit.
    [Graphical view ]
    SUPFAMi SSF57535. SSF57535. 1 hit.
    PROSITEi PS50923. SUSHI. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Functional characterization of the human interleukin-15 receptor alpha chain and close linkage of IL15RA and IL2RA genes."
      Anderson D.M., Kumaki S., Ahdieh M., Bertles J., Tometsko M., Loomis A., Giri J., Copeland N.G., Gilbert D.J., Jenkins N.A., Valentine V., Shapiro D.N., Morris S.W., Park L.S., Cosman D.
      J. Biol. Chem. 270:29862-29869(1995) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2 AND 3), FUNCTION, TISSUE SPECIFICITY, VARIANT THR-182.
      Tissue: Bone marrow stroma.
    2. "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)."
      Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
      Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    3. SeattleSNPs variation discovery resource
      Submitted (JUN-2003) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANT THR-182.
    4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: Trachea.
    5. "The DNA sequence and comparative analysis of human chromosome 10."
      Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L., Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K., Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L., Taylor A., Battles J.
      , Bird C.P., Ainscough R., Almeida J.P., Ashwell R.I.S., Ambrose K.D., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Bates K., Beasley H., Bray-Allen S., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Cahill P., Camire D., Carter N.P., Chapman J.C., Clark S.Y., Clarke G., Clee C.M., Clegg S., Corby N., Coulson A., Dhami P., Dutta I., Dunn M., Faulkner L., Frankish A., Frankland J.A., Garner P., Garnett J., Gribble S., Griffiths C., Grocock R., Gustafson E., Hammond S., Harley J.L., Hart E., Heath P.D., Ho T.P., Hopkins B., Horne J., Howden P.J., Huckle E., Hynds C., Johnson C., Johnson D., Kana A., Kay M., Kimberley A.M., Kershaw J.K., Kokkinaki M., Laird G.K., Lawlor S., Lee H.M., Leongamornlert D.A., Laird G., Lloyd C., Lloyd D.M., Loveland J., Lovell J., McLaren S., McLay K.E., McMurray A., Mashreghi-Mohammadi M., Matthews L., Milne S., Nickerson T., Nguyen M., Overton-Larty E., Palmer S.A., Pearce A.V., Peck A.I., Pelan S., Phillimore B., Porter K., Rice C.M., Rogosin A., Ross M.T., Sarafidou T., Sehra H.K., Shownkeen R., Skuce C.D., Smith M., Standring L., Sycamore N., Tester J., Thorpe A., Torcasso W., Tracey A., Tromans A., Tsolas J., Wall M., Walsh J., Wang H., Weinstock K., West A.P., Willey D.L., Whitehead S.L., Wilming L., Wray P.W., Young L., Chen Y., Lovering R.C., Moschonas N.K., Siebert R., Fechtel K., Bentley D., Durbin R.M., Hubbard T., Doucette-Stamm L., Beck S., Smith D.R., Rogers J.
      Nature 429:375-381(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 9), VARIANT THR-182.
      Tissue: Brain.
    8. "Large-scale concatenation cDNA sequencing."
      Yu W., Andersson B., Worley K.C., Muzny D.M., Ding Y., Liu W., Ricafrente J.Y., Wentland M.A., Lennon G., Gibbs R.A.
      Genome Res. 7:353-358(1997) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 30-267 (ISOFORM 1).
      Tissue: Brain.
    9. "Natural splicing of exon 2 of human interleukin-15 receptor alpha-chain mRNA results in a shortened form with a distinct pattern of expression."
      Dubois S., Magrangeas F., Lehours P., Raher S., Bernard J., Boisteau O., Leroy S., Minvielle S., Godard A., Jacques Y.
      J. Biol. Chem. 274:26978-26984(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: ALTERNATIVE SPLICING (ISOFORMS 1; 2; 3; 4; 5; 6; 7 AND 8), TISSUE SPECIFICITY, SUBCELLULAR LOCATION, GLYCOSYLATION.
    10. "The IL-15R alpha chain signals through association with Syk in human B cells."
      Bulanova E., Budagian V., Pohl T., Krause H., Durkop H., Paus R., Bulfone-Paus S.
      J. Immunol. 167:6292-6302(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, INTERACTION WITH SYK, PHOSPHORYLATION BY SYK, MUTAGENESIS OF TYR-227.
    11. "Expression of IL-15 and IL-15 receptor isoforms in select structures of human fetal brain."
      Kurowska M., Rudnicka W., Maslinska D., Maslinski W.
      Ann. N. Y. Acad. Sci. 966:441-445(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: TISSUE SPECIFICITY.
    12. Cited for: LIGAND-BINDING.
    13. "Natural, proteolytic release of a soluble form of human IL-15 receptor alpha-chain that behaves as a specific, high affinity IL-15 antagonist."
      Mortier E., Bernard J., Plet A., Jacques Y.
      J. Immunol. 173:1681-1688(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: PROTEOLYTIC PROCESSING, LIGAND-BINDING.
    14. "The structure of the interleukin-15 alpha receptor and its implications for ligand binding."
      Lorenzen I., Dingley A.J., Jacques Y., Grotzinger J.
      J. Biol. Chem. 281:6642-6647(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: STRUCTURE BY NMR OF 31-96, DISULFIDE BONDS.
    15. "Crystal structure of the IL-15-IL-15Ralpha complex, a cytokine-receptor unit presented in trans."
      Chirifu M., Hayashi C., Nakamura T., Toma S., Shuto T., Kai H., Yamagata Y., Davis S.J., Ikemizu S.
      Nat. Immunol. 8:1001-1007(2007) [PubMed] [Europe PMC] [Abstract]
      Cited for: X-RAY CRYSTALLOGRAPHY (1.85 ANGSTROMS) OF 31-132 IN COMPLEX WITH IL15, DISULFIDE BONDS.

    Entry informationi

    Entry nameiI15RA_HUMAN
    AccessioniPrimary (citable) accession number: Q13261
    Secondary accession number(s): B4E2C2
    , Q3B769, Q5JVA1, Q5JVA2, Q5JVA4, Q6B0J2, Q7LDR4, Q7Z609
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: February 1, 2005
    Last sequence update: November 1, 1996
    Last modified: October 1, 2014
    This is version 129 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. Human cell differentiation molecules
      CD nomenclature of surface proteins of human leucocytes and list of entries
    2. Human chromosome 10
      Human chromosome 10: entries, gene names and cross-references to MIM
    3. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    4. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    5. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    6. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    7. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3