Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q13241 (KLRD1_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 132. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (7) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Natural killer cells antigen CD94
Alternative name(s):
KP43
Killer cell lectin-like receptor subfamily D member 1
NK cell receptor
CD_antigen=CD94
Gene names
Name:KLRD1
Synonyms:CD94
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length179 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Plays a role as a receptor for the recognition of MHC class I HLA-E molecules by NK cells and some cytotoxic T-cells.

Subunit structure

Can form disulfide-bonded heterodimer with NKG2 family members. Ref.8 Ref.9 Ref.10

Subcellular location

Membrane; Single-pass type II membrane protein.

Tissue specificity

Natural killer cells.

Sequence similarities

Contains 1 C-type lectin domain.

Alternative products

This entry describes 3 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q13241-1)

Also known as: CD94-A;

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q13241-2)

Also known as: CD94-B;

The sequence of this isoform differs from the canonical sequence as follows:
     105-105: L → LQ
Isoform 3 (identifier: Q13241-3)

Also known as: CD94 alt;

The sequence of this isoform differs from the canonical sequence as follows:
     1-34: MAVFKTTLWRLISGTLGIICLSLMSTLGILLKNS → MAA

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 179179Natural killer cells antigen CD94
PRO_0000046587

Regions

Topological domain1 – 1010Cytoplasmic Potential
Transmembrane11 – 3121Helical; Signal-anchor for type II membrane protein; Potential
Topological domain32 – 179148Extracellular Potential
Domain68 – 175108C-type lectin

Amino acid modifications

Glycosylation831N-linked (GlcNAc...) Potential
Glycosylation1321N-linked (GlcNAc...) Potential
Disulfide bond58 ↔ 70 Ref.7 Ref.8 Ref.9 Ref.10
Disulfide bond59Interchain (with C-116 in NGK2A) Ref.7 Ref.8 Ref.9 Ref.10
Disulfide bond61 ↔ 72 Ref.7 Ref.8 Ref.9 Ref.10
Disulfide bond89 ↔ 174 Ref.7 Ref.8 Ref.9 Ref.10
Disulfide bond152 ↔ 166 Ref.7 Ref.8 Ref.9 Ref.10

Natural variations

Alternative sequence1 – 3434MAVFK…LLKNS → MAA in isoform 3.
VSP_003052
Alternative sequence1051L → LQ in isoform 2.
VSP_003053
Natural variant251S → A. Ref.1 Ref.2 Ref.6
Corresponds to variant rs10772256 [ dbSNP | Ensembl ].
VAR_050103

Secondary structure

......................... 179
Helix Strand Turn

Details...

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 (CD94-A) [UniParc].

Last modified May 31, 2011. Version 2.
Checksum: 01634D3832D4B1A7

FASTA17920,513
        10         20         30         40         50         60 
MAVFKTTLWR LISGTLGIIC LSLMSTLGIL LKNSFTKLSI EPAFTPGPNI ELQKDSDCCS 

        70         80         90        100        110        120 
CQEKWVGYRC NCYFISSEQK TWNESRHLCA SQKSSLLQLQ NTDELDFMSS SQQFYWIGLS 

       130        140        150        160        170 
YSEEHTAWLW ENGSALSQYL FPSFETFNTK NCIAYNPNGN ALDESCEDKN RYICKQQLI 

« Hide

Isoform 2 (CD94-B) [UniParc].

Checksum: 2913D0532DAFA866
Show »

FASTA18020,641
Isoform 3 (CD94 alt) [UniParc].

Checksum: 2C3876E8A2337B44
Show »

FASTA14817,109

References

« Hide 'large scale' references
[1]"Molecular characterization of human CD94: a type II membrane glycoprotein related to the C-type lectin superfamily."
Chang C., Rodriguez A., Carretero M., Lopez-Botet M., Phillips J.H., Lanier L.L.
Eur. J. Immunol. 25:2433-2437(1995) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT ALA-25.
Tissue: Blood.
[2]"Structure of the human CD94 C-type lectin gene."
Rodriguez A., Carretero M., Glienke J., Bellon T., Ramirez A., Lehrach H., Francis F., Lopez-Botet M.
Immunogenetics 47:305-309(1998) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANT ALA-25.
Tissue: Placenta.
[3]Biassoni R.
Submitted (JUN-1997) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE (ISOFORM 2).
[4]"A alternatively spliced form of the human CD94 gene."
Furukawa H., Yabe T., Watanabe K., Miyamoto R., Akaza T., Tadokoro K., Tohma S., Inoue T., Yamamoto K., Juji T.
Immunogenetics 48:87-88(1998) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORM 3).
[5]"The finished DNA sequence of human chromosome 12."
Scherer S.E., Muzny D.M., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R. expand/collapse author list , Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Montgomery K.T., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Lovering R.C., Wheeler D.A., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clerc-Blankenburg K.P., Davis C., Delgado O., Dinh H.H., Draper H., Gonzalez-Garay M.L., Havlak P., Jackson L.R., Jacob L.S., Kelly S.H., Li L., Li Z., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Pasternak S., Perez L.M., Plopper F.J.H., Santibanez J., Shen H., Tabor P.E., Verduzco D., Waldron L., Wang Q., Williams G.A., Zhang J., Zhou J., Allen C.C., Amin A.G., Anyalebechi V., Bailey M., Barbaria J.A., Bimage K.E., Bryant N.P., Burch P.E., Burkett C.E., Burrell K.L., Calderon E., Cardenas V., Carter K., Casias K., Cavazos I., Cavazos S.R., Ceasar H., Chacko J., Chan S.N., Chavez D., Christopoulos C., Chu J., Cockrell R., Cox C.D., Dang M., Dathorne S.R., David R., Davis C.M., Davy-Carroll L., Deshazo D.R., Donlin J.E., D'Souza L., Eaves K.A., Egan A., Emery-Cohen A.J., Escotto M., Flagg N., Forbes L.D., Gabisi A.M., Garza M., Hamilton C., Henderson N., Hernandez O., Hines S., Hogues M.E., Huang M., Idlebird D.G., Johnson R., Jolivet A., Jones S., Kagan R., King L.M., Leal B., Lebow H., Lee S., LeVan J.M., Lewis L.C., London P., Lorensuhewa L.M., Loulseged H., Lovett D.A., Lucier A., Lucier R.L., Ma J., Madu R.C., Mapua P., Martindale A.D., Martinez E., Massey E., Mawhiney S., Meador M.G., Mendez S., Mercado C., Mercado I.C., Merritt C.E., Miner Z.L., Minja E., Mitchell T., Mohabbat F., Mohabbat K., Montgomery B., Moore N., Morris S., Munidasa M., Ngo R.N., Nguyen N.B., Nickerson E., Nwaokelemeh O.O., Nwokenkwo S., Obregon M., Oguh M., Oragunye N., Oviedo R.J., Parish B.J., Parker D.N., Parrish J., Parks K.L., Paul H.A., Payton B.A., Perez A., Perrin W., Pickens A., Primus E.L., Pu L.-L., Puazo M., Quiles M.M., Quiroz J.B., Rabata D., Reeves K., Ruiz S.J., Shao H., Sisson I., Sonaike T., Sorelle R.P., Sutton A.E., Svatek A.F., Svetz L.A., Tamerisa K.S., Taylor T.R., Teague B., Thomas N., Thorn R.D., Trejos Z.Y., Trevino B.K., Ukegbu O.N., Urban J.B., Vasquez L.I., Vera V.A., Villasana D.M., Wang L., Ward-Moore S., Warren J.T., Wei X., White F., Williamson A.L., Wleczyk R., Wooden H.S., Wooden S.H., Yen J., Yoon L., Yoon V., Zorrilla S.E., Nelson D., Kucherlapati R., Weinstock G., Gibbs R.A.
Nature 440:346-351(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[6]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT ALA-25.
Tissue: Blood.
[7]"Structure of CD94 reveals a novel C-type lectin fold: implications for the NK cell-associated CD94/NKG2 receptors."
Boyington J.C., Riaz A.N., Patamawenu A., Coligan J.E., Brooks A.G., Sun P.D.
Immunity 10:75-82(1999) [PubMed] [Europe PMC] [Abstract]
Cited for: X-RAY CRYSTALLOGRAPHY (2.6 ANGSTROMS) OF 52-179, DISULFIDE BONDS.
[8]"The heterodimeric assembly of the CD94-NKG2 receptor family and implications for human leukocyte antigen-E recognition."
Sullivan L.C., Clements C.S., Beddoe T., Johnson D., Hoare H.L., Lin J., Huyton T., Hopkins E.J., Reid H.H., Wilce M.C., Kabat J., Borrego F., Coligan J.E., Rossjohn J., Brooks A.G.
Immunity 27:900-911(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: X-RAY CRYSTALLOGRAPHY (2.5 ANGSTROMS) OF 57-179 IN COMPLEX WITH NGK2A, SUBUNIT, DISULFIDE BONDS.
[9]"Structural basis for NKG2A/CD94 recognition of HLA-E."
Kaiser B.K., Pizarro J.C., Kerns J., Strong R.K.
Proc. Natl. Acad. Sci. U.S.A. 105:6696-6701(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: X-RAY CRYSTALLOGRAPHY (4.41 ANGSTROMS) OF 59-179 IN COMPLEX WITH NGK2A, SUBUNIT, DISULFIDE BONDS.
[10]"CD94-NKG2A recognition of human leukocyte antigen (HLA)-E bound to an HLA class I leader sequence."
Petrie E.J., Clements C.S., Lin J., Sullivan L.C., Johnson D., Huyton T., Heroux A., Hoare H.L., Beddoe T., Reid H.H., Wilce M.C., Brooks A.G., Rossjohn J.
J. Exp. Med. 205:725-735(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: X-RAY CRYSTALLOGRAPHY (3.4 ANGSTROMS) OF 57-179 IN COMPLEX WITH NGK2A, SUBUNIT, DISULFIDE BONDS.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
U30610 mRNA. Translation: AAC50291.1.
Y14287, Y14288 Genomic DNA. Translation: CAA74663.1.
AJ000673 Genomic DNA. Translation: CAA04230.1.
AJ000001 mRNA. Translation: CAA03845.1.
AB009597 mRNA. Translation: BAA24450.1.
AB010084 Genomic DNA. Translation: BAA24451.1.
AC022075 Genomic DNA. No translation available.
BC028009 mRNA. Translation: AAH28009.1.
CCDSCCDS8621.1. [Q13241-1]
CCDS8622.1. [Q13241-3]
RefSeqNP_001107868.1. NM_001114396.1.
NP_002253.1. NM_002262.3.
NP_031360.1. NM_007334.2. [Q13241-3]
XP_005253420.1. XM_005253363.2. [Q13241-2]
UniGeneHs.562457.

3D structure databases

PDBe
RCSB-PDB
PDBj
EntryMethodResolution (Å)ChainPositionsPDBsum
1B6EX-ray2.60A52-179[»]
3BDWX-ray2.50A/C57-179[»]
3CDGX-ray3.40E/J57-179[»]
3CIIX-ray4.41G/I59-179[»]
ProteinModelPortalQ13241.
SMRQ13241. Positions 57-179.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid110023. 4 interactions.
STRING9606.ENSP00000338130.

PTM databases

PhosphoSiteQ13241.

Polymorphism databases

DMDM334302835.

Proteomic databases

PaxDbQ13241.
PRIDEQ13241.

Protocols and materials databases

DNASU3824.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000336164; ENSP00000338130; ENSG00000134539. [Q13241-1]
ENST00000350274; ENSP00000310929; ENSG00000134539. [Q13241-3]
ENST00000381907; ENSP00000371332; ENSG00000134539. [Q13241-1]
ENST00000381908; ENSP00000371333; ENSG00000134539. [Q13241-2]
GeneID3824.
KEGGhsa:3824.
UCSCuc001qxy.4. human. [Q13241-3]
uc001qxz.4. human. [Q13241-2]
uc009zhi.3. human. [Q13241-1]

Organism-specific databases

CTD3824.
GeneCardsGC12P010378.
HGNCHGNC:6378. KLRD1.
MIM602894. gene.
neXtProtNX_Q13241.
PharmGKBPA30167.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG256912.
HOGENOMHOG000220925.
HOVERGENHBG099800.
KOK06516.
OMAVWIFTAF.
TreeFamTF336674.

Enzyme and pathway databases

ReactomeREACT_6900. Immune System.

Gene expression databases

ArrayExpressQ13241.
BgeeQ13241.
CleanExHS_KLRD1.
GenevestigatorQ13241.

Family and domain databases

Gene3D3.10.100.10. 1 hit.
InterProIPR001304. C-type_lectin.
IPR016186. C-type_lectin-like.
IPR016187. C-type_lectin_fold.
[Graphical view]
PfamPF00059. Lectin_C. 1 hit.
[Graphical view]
SMARTSM00034. CLECT. 1 hit.
[Graphical view]
SUPFAMSSF56436. SSF56436. 1 hit.
PROSITEPS50041. C_TYPE_LECTIN_2. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

EvolutionaryTraceQ13241.
GeneWikiKLRD1.
GenomeRNAi3824.
NextBio15039.
PROQ13241.
SOURCESearch...

Entry information

Entry nameKLRD1_HUMAN
AccessionPrimary (citable) accession number: Q13241
Secondary accession number(s): O43321 expand/collapse secondary AC list , O43773, Q9UBE3, Q9UEQ0
Entry history
Integrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: May 31, 2011
Last modified: July 9, 2014
This is version 132 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

PDB cross-references

Index of Protein Data Bank (PDB) cross-references

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 12

Human chromosome 12: entries, gene names and cross-references to MIM

Human cell differentiation molecules

CD nomenclature of surface proteins of human leucocytes and list of entries