Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Natural killer cells antigen CD94

Gene

KLRD1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Plays a role as a receptor for the recognition of MHC class I HLA-E molecules by NK cells and some cytotoxic T-cells.

GO - Molecular functioni

  • carbohydrate binding Source: UniProtKB-KW
  • MHC class Ib protein binding, via antigen binding groove Source: UniProtKB
  • MHC class I protein complex binding Source: UniProtKB
  • protein antigen binding Source: UniProtKB
  • transmembrane signaling receptor activity Source: ProtInc

GO - Biological processi

  • cell surface receptor signaling pathway Source: ProtInc
  • innate immune response Source: Reactome
  • natural killer cell mediated immunity Source: UniProtKB
  • regulation of immune response Source: Reactome
Complete GO annotation...

Keywords - Molecular functioni

Receptor

Keywords - Ligandi

Lectin

Enzyme and pathway databases

BioCyciZFISH:ENSG00000134539-MONOMER.
ReactomeiR-HSA-198933. Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell.
R-HSA-2172127. DAP12 interactions.
R-HSA-2424491. DAP12 signaling.

Names & Taxonomyi

Protein namesi
Recommended name:
Natural killer cells antigen CD94
Alternative name(s):
KP43
Killer cell lectin-like receptor subfamily D member 1
NK cell receptor
CD_antigen: CD94
Gene namesi
Name:KLRD1
Synonyms:CD94
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 12

Organism-specific databases

HGNCiHGNC:6378. KLRD1.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 10CytoplasmicSequence analysis10
Transmembranei11 – 31Helical; Signal-anchor for type II membrane proteinSequence analysisAdd BLAST21
Topological domaini32 – 179ExtracellularSequence analysisAdd BLAST148

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi3824.
OpenTargetsiENSG00000134539.
PharmGKBiPA30167.

Polymorphism and mutation databases

BioMutaiKLRD1.
DMDMi334302835.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000465871 – 179Natural killer cells antigen CD94Add BLAST179

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi58 ↔ 70
Disulfide bondi59Interchain (with C-116 in NGK2A)
Disulfide bondi61 ↔ 72
Glycosylationi83N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi89 ↔ 174
Glycosylationi132N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi152 ↔ 166

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiQ13241.
PeptideAtlasiQ13241.
PRIDEiQ13241.

PTM databases

iPTMnetiQ13241.
PhosphoSitePlusiQ13241.

Expressioni

Tissue specificityi

Natural killer cells.

Gene expression databases

BgeeiENSG00000134539.
CleanExiHS_KLRD1.
ExpressionAtlasiQ13241. baseline and differential.
GenevisibleiQ13241. HS.

Organism-specific databases

HPAiHPA069688.

Interactioni

Subunit structurei

Can form disulfide-bonded heterodimer with NKG2 family members.3 Publications

GO - Molecular functioni

  • MHC class Ib protein binding, via antigen binding groove Source: UniProtKB
  • MHC class I protein complex binding Source: UniProtKB
  • protein antigen binding Source: UniProtKB

Protein-protein interaction databases

BioGridi110023. 4 interactors.
STRINGi9606.ENSP00000338130.

Structurei

Secondary structure

1179
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Turni62 – 64Combined sources3
Beta strandi66 – 68Combined sources3
Beta strandi71 – 75Combined sources5
Helixi82 – 91Combined sources10
Helixi102 – 108Combined sources7
Beta strandi118 – 122Combined sources5
Turni123 – 126Combined sources4
Beta strandi127 – 130Combined sources4
Turni138 – 140Combined sources3
Helixi142 – 146Combined sources5
Beta strandi151 – 156Combined sources6
Turni157 – 159Combined sources3
Beta strandi160 – 164Combined sources5
Beta strandi170 – 176Combined sources7

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1B6EX-ray2.60A52-179[»]
3BDWX-ray2.50A/C57-179[»]
3CDGX-ray3.40E/J57-179[»]
3CIIX-ray4.41G/I59-179[»]
ProteinModelPortaliQ13241.
SMRiQ13241.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ13241.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini68 – 175C-type lectinPROSITE-ProRule annotationAdd BLAST108

Sequence similaritiesi

Contains 1 C-type lectin domain.PROSITE-ProRule annotation

Keywords - Domaini

Signal-anchor, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG4297. Eukaryota.
ENOG410XPJ1. LUCA.
GeneTreeiENSGT00730000110282.
HOGENOMiHOG000220925.
HOVERGENiHBG099800.
InParanoidiQ13241.
KOiK06516.
OMAiNESRHLC.
OrthoDBiEOG091G0RZF.
TreeFamiTF336674.

Family and domain databases

Gene3Di3.10.100.10. 1 hit.
InterProiIPR001304. C-type_lectin-like.
IPR016186. C-type_lectin-like/link.
IPR016187. CTDL_fold.
[Graphical view]
PfamiPF00059. Lectin_C. 1 hit.
[Graphical view]
SMARTiSM00034. CLECT. 1 hit.
[Graphical view]
SUPFAMiSSF56436. SSF56436. 1 hit.
PROSITEiPS50041. C_TYPE_LECTIN_2. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q13241-1) [UniParc]FASTAAdd to basket
Also known as: CD94-A

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAVFKTTLWR LISGTLGIIC LSLMSTLGIL LKNSFTKLSI EPAFTPGPNI
60 70 80 90 100
ELQKDSDCCS CQEKWVGYRC NCYFISSEQK TWNESRHLCA SQKSSLLQLQ
110 120 130 140 150
NTDELDFMSS SQQFYWIGLS YSEEHTAWLW ENGSALSQYL FPSFETFNTK
160 170
NCIAYNPNGN ALDESCEDKN RYICKQQLI
Length:179
Mass (Da):20,513
Last modified:May 31, 2011 - v2
Checksum:i01634D3832D4B1A7
GO
Isoform 2 (identifier: Q13241-2) [UniParc]FASTAAdd to basket
Also known as: CD94-B

The sequence of this isoform differs from the canonical sequence as follows:
     105-105: L → LQ

Show »
Length:180
Mass (Da):20,641
Checksum:i2913D0532DAFA866
GO
Isoform 3 (identifier: Q13241-3) [UniParc]FASTAAdd to basket
Also known as: CD94 alt

The sequence of this isoform differs from the canonical sequence as follows:
     1-34: MAVFKTTLWRLISGTLGIICLSLMSTLGILLKNS → MAA

Show »
Length:148
Mass (Da):17,109
Checksum:i2C3876E8A2337B44
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_05010325S → A.3 PublicationsCorresponds to variant rs10772256dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0030521 – 34MAVFK…LLKNS → MAA in isoform 3. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_003053105L → LQ in isoform 2. Curated1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U30610 mRNA. Translation: AAC50291.1.
Y14287, Y14288 Genomic DNA. Translation: CAA74663.1.
AJ000673 Genomic DNA. Translation: CAA04230.1.
AJ000001 mRNA. Translation: CAA03845.1.
AB009597 mRNA. Translation: BAA24450.1.
AB010084 Genomic DNA. Translation: BAA24451.1.
AC022075 Genomic DNA. No translation available.
BC028009 mRNA. Translation: AAH28009.1.
CCDSiCCDS8621.1. [Q13241-1]
CCDS8622.1. [Q13241-3]
RefSeqiNP_001107868.1. NM_001114396.1.
NP_002253.1. NM_002262.3.
NP_031360.1. NM_007334.2. [Q13241-3]
XP_016874780.1. XM_017019291.1. [Q13241-1]
UniGeneiHs.562457.

Genome annotation databases

EnsembliENST00000336164; ENSP00000338130; ENSG00000134539. [Q13241-1]
ENST00000350274; ENSP00000310929; ENSG00000134539. [Q13241-3]
ENST00000381908; ENSP00000371333; ENSG00000134539. [Q13241-1]
GeneIDi3824.
KEGGihsa:3824.
UCSCiuc001qxw.5. human. [Q13241-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

Functional Glycomics Gateway - Glycan Binding

CD94

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U30610 mRNA. Translation: AAC50291.1.
Y14287, Y14288 Genomic DNA. Translation: CAA74663.1.
AJ000673 Genomic DNA. Translation: CAA04230.1.
AJ000001 mRNA. Translation: CAA03845.1.
AB009597 mRNA. Translation: BAA24450.1.
AB010084 Genomic DNA. Translation: BAA24451.1.
AC022075 Genomic DNA. No translation available.
BC028009 mRNA. Translation: AAH28009.1.
CCDSiCCDS8621.1. [Q13241-1]
CCDS8622.1. [Q13241-3]
RefSeqiNP_001107868.1. NM_001114396.1.
NP_002253.1. NM_002262.3.
NP_031360.1. NM_007334.2. [Q13241-3]
XP_016874780.1. XM_017019291.1. [Q13241-1]
UniGeneiHs.562457.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1B6EX-ray2.60A52-179[»]
3BDWX-ray2.50A/C57-179[»]
3CDGX-ray3.40E/J57-179[»]
3CIIX-ray4.41G/I59-179[»]
ProteinModelPortaliQ13241.
SMRiQ13241.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi110023. 4 interactors.
STRINGi9606.ENSP00000338130.

PTM databases

iPTMnetiQ13241.
PhosphoSitePlusiQ13241.

Polymorphism and mutation databases

BioMutaiKLRD1.
DMDMi334302835.

Proteomic databases

PaxDbiQ13241.
PeptideAtlasiQ13241.
PRIDEiQ13241.

Protocols and materials databases

DNASUi3824.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000336164; ENSP00000338130; ENSG00000134539. [Q13241-1]
ENST00000350274; ENSP00000310929; ENSG00000134539. [Q13241-3]
ENST00000381908; ENSP00000371333; ENSG00000134539. [Q13241-1]
GeneIDi3824.
KEGGihsa:3824.
UCSCiuc001qxw.5. human. [Q13241-1]

Organism-specific databases

CTDi3824.
DisGeNETi3824.
GeneCardsiKLRD1.
HGNCiHGNC:6378. KLRD1.
HPAiHPA069688.
MIMi602894. gene.
neXtProtiNX_Q13241.
OpenTargetsiENSG00000134539.
PharmGKBiPA30167.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG4297. Eukaryota.
ENOG410XPJ1. LUCA.
GeneTreeiENSGT00730000110282.
HOGENOMiHOG000220925.
HOVERGENiHBG099800.
InParanoidiQ13241.
KOiK06516.
OMAiNESRHLC.
OrthoDBiEOG091G0RZF.
TreeFamiTF336674.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000134539-MONOMER.
ReactomeiR-HSA-198933. Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell.
R-HSA-2172127. DAP12 interactions.
R-HSA-2424491. DAP12 signaling.

Miscellaneous databases

EvolutionaryTraceiQ13241.
GeneWikiiKLRD1.
GenomeRNAii3824.
PROiQ13241.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000134539.
CleanExiHS_KLRD1.
ExpressionAtlasiQ13241. baseline and differential.
GenevisibleiQ13241. HS.

Family and domain databases

Gene3Di3.10.100.10. 1 hit.
InterProiIPR001304. C-type_lectin-like.
IPR016186. C-type_lectin-like/link.
IPR016187. CTDL_fold.
[Graphical view]
PfamiPF00059. Lectin_C. 1 hit.
[Graphical view]
SMARTiSM00034. CLECT. 1 hit.
[Graphical view]
SUPFAMiSSF56436. SSF56436. 1 hit.
PROSITEiPS50041. C_TYPE_LECTIN_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiKLRD1_HUMAN
AccessioniPrimary (citable) accession number: Q13241
Secondary accession number(s): O43321
, O43773, Q9UBE3, Q9UEQ0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: May 31, 2011
Last modified: November 30, 2016
This is version 151 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human cell differentiation molecules
    CD nomenclature of surface proteins of human leucocytes and list of entries
  2. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  7. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.