Q13241 (KLRD1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 29, 2013.
Version 123.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Natural killer cells antigen CD94 Alternative name(s): KP43 Killer cell lectin-like receptor subfamily D member 1 NK cell receptor CD_antigen=CD94 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 179 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Plays a role as a receptor for the recognition of MHC class I HLA-E molecules by NK cells and some cytotoxic T-cells. |
| Subunit structure | Can form disulfide-bonded heterodimer with NKG2 family members. Ref.8 Ref.9 Ref.10 |
| Subcellular location | |
| Tissue specificity | Natural killer cells. |
| Sequence similarities | Contains 1 C-type lectin domain. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Membrane |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Signal-anchor Transmembrane Transmembrane helix |
| Ligand | Lectin |
| Molecular function | Receptor |
| PTM | Disulfide bond Glycoprotein |
| Technical term | 3D-structure Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | cell surface receptor signaling pathway Traceable author statement Ref.1. Source: ProtInc innate immune responseTraceable author statement. Source: Reactome regulation of immune responseTraceable author statement. Source: Reactome |
| Cellular_component | external side of plasma membrane Inferred from electronic annotation. Source: Compara integral to membraneInferred from electronic annotation. Source: UniProtKB-KW plasma membraneTraceable author statement. Source: Reactome |
| Molecular_function | carbohydrate binding Inferred from electronic annotation. Source: InterPro transmembrane signaling receptor activityTraceable author statement Ref.1. Source: ProtInc |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q13241-1) Also known as: CD94-A; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q13241-2) Also known as: CD94-B; The sequence of this isoform differs from the canonical sequence as follows: 105-105: L → LQ | ||||||
| Isoform 3 (identifier: Q13241-3) Also known as: CD94 alt; The sequence of this isoform differs from the canonical sequence as follows: 1-34: MAVFKTTLWRLISGTLGIICLSLMSTLGILLKNS → MAA |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 179 | 179 | Natural killer cells antigen CD94 | PRO_0000046587 | |||||||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||||||
| Topological domain | 1 – 10 | 10 | Cytoplasmic Potential | ||||||||||||||||||||||||||||||
| Transmembrane | 11 – 31 | 21 | Helical; Signal-anchor for type II membrane protein; Potential | ||||||||||||||||||||||||||||||
| Topological domain | 32 – 179 | 148 | Extracellular Potential | ||||||||||||||||||||||||||||||
| Domain | 68 – 175 | 108 | C-type lectin | ||||||||||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||||||||||
| Glycosylation | 83 | 1 | N-linked (GlcNAc...) Potential | ||||||||||||||||||||||||||||||
| Glycosylation | 132 | 1 | N-linked (GlcNAc...) Potential | ||||||||||||||||||||||||||||||
| Disulfide bond | 58 ↔ 70 | Ref.7 Ref.8 Ref.9 Ref.10 | |||||||||||||||||||||||||||||||
| Disulfide bond | 59 | Interchain (with C-116 in NGK2A) Ref.7 Ref.8 Ref.9 Ref.10 | |||||||||||||||||||||||||||||||
| Disulfide bond | 61 ↔ 72 | Ref.7 Ref.8 Ref.9 Ref.10 | |||||||||||||||||||||||||||||||
| Disulfide bond | 89 ↔ 174 | Ref.7 Ref.8 Ref.9 Ref.10 | |||||||||||||||||||||||||||||||
| Disulfide bond | 152 ↔ 166 | Ref.7 Ref.8 Ref.9 Ref.10 | |||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 34 | 34 | MAVFK…LLKNS → MAA in isoform 3. | VSP_003052 | |||||||||||||||||||||||||||||
| Alternative sequence | 105 | 1 | L → LQ in isoform 2. | VSP_003053 | |||||||||||||||||||||||||||||
| Natural variant | 25 | 1 | S → A. Ref.1 Ref.2 Ref.6 Corresponds to variant rs10772256 [ dbSNP | Ensembl ]. | VAR_050103 | |||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||
| Turn | 62 – 64 | 3 | |||||||||||||||||||||||||||||||
| Beta strand | 66 – 68 | 3 | |||||||||||||||||||||||||||||||
| Beta strand | 71 – 75 | 5 | |||||||||||||||||||||||||||||||
| Helix | 82 – 91 | 10 | |||||||||||||||||||||||||||||||
| Helix | 102 – 108 | 7 | |||||||||||||||||||||||||||||||
| Beta strand | 118 – 122 | 5 | |||||||||||||||||||||||||||||||
| Turn | 123 – 126 | 4 | |||||||||||||||||||||||||||||||
| Beta strand | 127 – 130 | 4 | |||||||||||||||||||||||||||||||
| Turn | 138 – 140 | 3 | |||||||||||||||||||||||||||||||
| Helix | 142 – 146 | 5 | |||||||||||||||||||||||||||||||
| Beta strand | 151 – 156 | 6 | |||||||||||||||||||||||||||||||
| Turn | 157 – 159 | 3 | |||||||||||||||||||||||||||||||
| Beta strand | 160 – 164 | 5 | |||||||||||||||||||||||||||||||
| Beta strand | 170 – 176 | 7 | |||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Molecular characterization of human CD94: a type II membrane glycoprotein related to the C-type lectin superfamily." Chang C., Rodriguez A., Carretero M., Lopez-Botet M., Phillips J.H., Lanier L.L. Eur. J. Immunol. 25:2433-2437(1995) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT ALA-25. Tissue: Blood. |
| [2] | "Structure of the human CD94 C-type lectin gene." Rodriguez A., Carretero M., Glienke J., Bellon T., Ramirez A., Lehrach H., Francis F., Lopez-Botet M. Immunogenetics 47:305-309(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANT ALA-25. Tissue: Placenta. |
| [3] | Biassoni R. Submitted (JUN-1997) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE (ISOFORM 2). |
| [4] | "A alternatively spliced form of the human CD94 gene." Furukawa H., Yabe T., Watanabe K., Miyamoto R., Akaza T., Tadokoro K., Tohma S., Inoue T., Yamamoto K., Juji T. Immunogenetics 48:87-88(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORM 3). |
| [5] | "The finished DNA sequence of human chromosome 12." Scherer S.E., Muzny D.M., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R. Gibbs R.A.Nature 440:346-351(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT ALA-25. Tissue: Blood. |
| [7] | "Structure of CD94 reveals a novel C-type lectin fold: implications for the NK cell-associated CD94/NKG2 receptors." Boyington J.C., Riaz A.N., Patamawenu A., Coligan J.E., Brooks A.G., Sun P.D. Immunity 10:75-82(1999) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.6 ANGSTROMS) OF 52-179, DISULFIDE BONDS. |
| [8] | "The heterodimeric assembly of the CD94-NKG2 receptor family and implications for human leukocyte antigen-E recognition." Sullivan L.C., Clements C.S., Beddoe T., Johnson D., Hoare H.L., Lin J., Huyton T., Hopkins E.J., Reid H.H., Wilce M.C., Kabat J., Borrego F., Coligan J.E., Rossjohn J., Brooks A.G. Immunity 27:900-911(2007) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.5 ANGSTROMS) OF 57-179 IN COMPLEX WITH NGK2A, SUBUNIT, DISULFIDE BONDS. |
| [9] | "Structural basis for NKG2A/CD94 recognition of HLA-E." Kaiser B.K., Pizarro J.C., Kerns J., Strong R.K. Proc. Natl. Acad. Sci. U.S.A. 105:6696-6701(2008) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (4.41 ANGSTROMS) OF 59-179 IN COMPLEX WITH NGK2A, SUBUNIT, DISULFIDE BONDS. |
| [10] | "CD94-NKG2A recognition of human leukocyte antigen (HLA)-E bound to an HLA class I leader sequence." Petrie E.J., Clements C.S., Lin J., Sullivan L.C., Johnson D., Huyton T., Heroux A., Hoare H.L., Beddoe T., Reid H.H., Wilce M.C., Brooks A.G., Rossjohn J. J. Exp. Med. 205:725-735(2008) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (3.4 ANGSTROMS) OF 57-179 IN COMPLEX WITH NGK2A, SUBUNIT, DISULFIDE BONDS. |
| + | Additional computationally mapped references. |
Web resources
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | U30610 mRNA. Translation: AAC50291.1. Y14287, Y14288 Genomic DNA. Translation: CAA74663.1. AJ000673 Genomic DNA. Translation: CAA04230.1. AJ000001 mRNA. Translation: CAA03845.1. AB009597 mRNA. Translation: BAA24450.1. AB010084 Genomic DNA. Translation: BAA24451.1. AC022075 Genomic DNA. No translation available. BC028009 mRNA. Translation: AAH28009.1. | ||||||||||||||||||||||||||||||
| IPI | IPI00012338. IPI00221061. IPI00221062. | ||||||||||||||||||||||||||||||
| RefSeq | NP_001107868.1. NM_001114396.1. NP_002253.1. NM_002262.3. NP_031360.1. NM_007334.2. | ||||||||||||||||||||||||||||||
| UniGene | Hs.562457. | ||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||||||||
| ProteinModelPortal | Q13241. | ||||||||||||||||||||||||||||||
| SMR | Q13241. Positions 57-179. | ||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||
| STRING | 9606.ENSP00000338130. | ||||||||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||||||||
| PhosphoSite | Q13241. | ||||||||||||||||||||||||||||||
Polymorphism databases | |||||||||||||||||||||||||||||||
| DMDM | 2497634. | ||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||
| PaxDb | Q13241. | ||||||||||||||||||||||||||||||
| PRIDE | Q13241. | ||||||||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||||||||
| DNASU | 3824. | ||||||||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||
| Ensembl | ENST00000336164; ENSP00000338130; ENSG00000134539. ENST00000350274; ENSP00000310929; ENSG00000134539. ENST00000381907; ENSP00000371332; ENSG00000134539. ENST00000381908; ENSP00000371333; ENSG00000134539. | ||||||||||||||||||||||||||||||
| GeneID | 3824. | ||||||||||||||||||||||||||||||
| KEGG | hsa:3824. | ||||||||||||||||||||||||||||||
| UCSC | uc001qxy.4. human. uc001qxz.4. human. uc009zhi.3. human. | ||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||
| CTD | 3824. | ||||||||||||||||||||||||||||||
| GeneCards | GC12P010378. | ||||||||||||||||||||||||||||||
| HGNC | HGNC:6378. KLRD1. | ||||||||||||||||||||||||||||||
| MIM | 602894. gene. | ||||||||||||||||||||||||||||||
| neXtProt | NX_Q13241. | ||||||||||||||||||||||||||||||
| PharmGKB | PA30167. | ||||||||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||
| eggNOG | NOG256912. | ||||||||||||||||||||||||||||||
| HOGENOM | HOG000220925. | ||||||||||||||||||||||||||||||
| HOVERGEN | HBG099800. | ||||||||||||||||||||||||||||||
| KO | K06516. | ||||||||||||||||||||||||||||||
| OMA | WVGYRCN. | ||||||||||||||||||||||||||||||
| PhylomeDB | Q13241. | ||||||||||||||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||||||||||||||
| Reactome | REACT_6900. Immune System. | ||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||
| ArrayExpress | Q13241. | ||||||||||||||||||||||||||||||
| Bgee | Q13241. | ||||||||||||||||||||||||||||||
| CleanEx | HS_KLRD1. | ||||||||||||||||||||||||||||||
| Genevestigator | Q13241. | ||||||||||||||||||||||||||||||
| GermOnline | ENSG00000134539. Homo sapiens. | ||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||
| Gene3D | 3.10.100.10. 1 hit. | ||||||||||||||||||||||||||||||
| InterPro | IPR001304. C-type_lectin. IPR016186. C-type_lectin-like. IPR016187. C-type_lectin_fold. [Graphical view] | ||||||||||||||||||||||||||||||
| Pfam | PF00059. Lectin_C. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||
| SMART | SM00034. CLECT. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||
| SUPFAM | SSF56436. C-type_lectin_fold. 1 hit. | ||||||||||||||||||||||||||||||
| PROSITE | PS00615. C_TYPE_LECTIN_1. False negative. PS50041. C_TYPE_LECTIN_2. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||
Other | |||||||||||||||||||||||||||||||
| EvolutionaryTrace | Q13241. | ||||||||||||||||||||||||||||||
| GenomeRNAi | 3824. | ||||||||||||||||||||||||||||||
| NextBio | 15039. | ||||||||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||||||||
Entry information
| Entry name | KLRD1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q13241 Secondary accession number(s): O43321 Q9UEQ0 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human cell differentiation molecules CD nomenclature of surface proteins of human leucocytes and list of entries |
| Human chromosome 12 Human chromosome 12: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
