SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q13241

- KLRD1_HUMAN

UniProt

Q13241 - KLRD1_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Natural killer cells antigen CD94
Gene
KLRD1, CD94
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Plays a role as a receptor for the recognition of MHC class I HLA-E molecules by NK cells and some cytotoxic T-cells.

GO - Molecular functioni

  1. carbohydrate binding Source: InterPro
  2. protein binding Source: UniProt
  3. transmembrane signaling receptor activity Source: ProtInc

GO - Biological processi

  1. cell surface receptor signaling pathway Source: ProtInc
  2. innate immune response Source: Reactome
  3. regulation of immune response Source: Reactome
Complete GO annotation...

Keywords - Molecular functioni

Receptor

Keywords - Ligandi

Lectin

Enzyme and pathway databases

ReactomeiREACT_11152. Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell.
REACT_147694. DAP12 interactions.
REACT_147814. DAP12 signaling.

Names & Taxonomyi

Protein namesi
Recommended name:
Natural killer cells antigen CD94
Alternative name(s):
KP43
Killer cell lectin-like receptor subfamily D member 1
NK cell receptor
CD_antigen: CD94
Gene namesi
Name:KLRD1
Synonyms:CD94
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 12

Organism-specific databases

HGNCiHGNC:6378. KLRD1.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 1010Cytoplasmic Reviewed prediction
Transmembranei11 – 3121Helical; Signal-anchor for type II membrane protein; Reviewed prediction
Add
BLAST
Topological domaini32 – 179148Extracellular Reviewed prediction
Add
BLAST

GO - Cellular componenti

  1. external side of plasma membrane Source: Ensembl
  2. integral component of membrane Source: UniProtKB-KW
  3. plasma membrane Source: Reactome
Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA30167.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 179179Natural killer cells antigen CD94
PRO_0000046587Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi58 ↔ 704 Publications
Disulfide bondi59 – 59Interchain (with C-116 in NGK2A)4 Publications
Disulfide bondi61 ↔ 724 Publications
Glycosylationi83 – 831N-linked (GlcNAc...) Reviewed prediction
Disulfide bondi89 ↔ 1744 Publications
Glycosylationi132 – 1321N-linked (GlcNAc...) Reviewed prediction
Disulfide bondi152 ↔ 1664 Publications

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiQ13241.
PRIDEiQ13241.

PTM databases

PhosphoSiteiQ13241.

Expressioni

Tissue specificityi

Natural killer cells.

Gene expression databases

ArrayExpressiQ13241.
BgeeiQ13241.
CleanExiHS_KLRD1.
GenevestigatoriQ13241.

Interactioni

Subunit structurei

Can form disulfide-bonded heterodimer with NKG2 family members.3 Publications

Protein-protein interaction databases

BioGridi110023. 4 interactions.
STRINGi9606.ENSP00000338130.

Structurei

Secondary structure

Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Turni62 – 643
Beta strandi66 – 683
Beta strandi71 – 755
Helixi82 – 9110
Helixi102 – 1087
Beta strandi118 – 1225
Turni123 – 1264
Beta strandi127 – 1304
Turni138 – 1403
Helixi142 – 1465
Beta strandi151 – 1566
Turni157 – 1593
Beta strandi160 – 1645
Beta strandi170 – 1767

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
1B6EX-ray2.60A52-179[»]
3BDWX-ray2.50A/C57-179[»]
3CDGX-ray3.40E/J57-179[»]
3CIIX-ray4.41G/I59-179[»]
ProteinModelPortaliQ13241.
SMRiQ13241. Positions 57-179.

Miscellaneous databases

EvolutionaryTraceiQ13241.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini68 – 175108C-type lectin
Add
BLAST

Sequence similaritiesi

Keywords - Domaini

Signal-anchor, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG256912.
HOGENOMiHOG000220925.
HOVERGENiHBG099800.
KOiK06516.
OMAiVWIFTAF.
TreeFamiTF336674.

Family and domain databases

Gene3Di3.10.100.10. 1 hit.
InterProiIPR001304. C-type_lectin.
IPR016186. C-type_lectin-like.
IPR016187. C-type_lectin_fold.
[Graphical view]
PfamiPF00059. Lectin_C. 1 hit.
[Graphical view]
SMARTiSM00034. CLECT. 1 hit.
[Graphical view]
SUPFAMiSSF56436. SSF56436. 1 hit.
PROSITEiPS50041. C_TYPE_LECTIN_2. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q13241-1) [UniParc]FASTAAdd to Basket

Also known as: CD94-A

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MAVFKTTLWR LISGTLGIIC LSLMSTLGIL LKNSFTKLSI EPAFTPGPNI    50
ELQKDSDCCS CQEKWVGYRC NCYFISSEQK TWNESRHLCA SQKSSLLQLQ 100
NTDELDFMSS SQQFYWIGLS YSEEHTAWLW ENGSALSQYL FPSFETFNTK 150
NCIAYNPNGN ALDESCEDKN RYICKQQLI 179
Length:179
Mass (Da):20,513
Last modified:May 31, 2011 - v2
Checksum:i01634D3832D4B1A7
GO
Isoform 2 (identifier: Q13241-2) [UniParc]FASTAAdd to Basket

Also known as: CD94-B

The sequence of this isoform differs from the canonical sequence as follows:
     105-105: L → LQ

Show »
Length:180
Mass (Da):20,641
Checksum:i2913D0532DAFA866
GO
Isoform 3 (identifier: Q13241-3) [UniParc]FASTAAdd to Basket

Also known as: CD94 alt

The sequence of this isoform differs from the canonical sequence as follows:
     1-34: MAVFKTTLWRLISGTLGIICLSLMSTLGILLKNS → MAA

Show »
Length:148
Mass (Da):17,109
Checksum:i2C3876E8A2337B44
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti25 – 251S → A.3 Publications
Corresponds to variant rs10772256 [ dbSNP | Ensembl ].
VAR_050103

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 3434MAVFK…LLKNS → MAA in isoform 3.
VSP_003052Add
BLAST
Alternative sequencei105 – 1051L → LQ in isoform 2.
VSP_003053

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U30610 mRNA. Translation: AAC50291.1.
Y14287, Y14288 Genomic DNA. Translation: CAA74663.1.
AJ000673 Genomic DNA. Translation: CAA04230.1.
AJ000001 mRNA. Translation: CAA03845.1.
AB009597 mRNA. Translation: BAA24450.1.
AB010084 Genomic DNA. Translation: BAA24451.1.
AC022075 Genomic DNA. No translation available.
BC028009 mRNA. Translation: AAH28009.1.
CCDSiCCDS8621.1. [Q13241-1]
CCDS8622.1. [Q13241-3]
RefSeqiNP_001107868.1. NM_001114396.1.
NP_002253.1. NM_002262.3.
NP_031360.1. NM_007334.2. [Q13241-3]
XP_005253420.1. XM_005253363.2. [Q13241-2]
UniGeneiHs.562457.

Genome annotation databases

EnsembliENST00000336164; ENSP00000338130; ENSG00000134539. [Q13241-1]
ENST00000350274; ENSP00000310929; ENSG00000134539. [Q13241-3]
ENST00000381907; ENSP00000371332; ENSG00000134539. [Q13241-1]
ENST00000381908; ENSP00000371333; ENSG00000134539. [Q13241-2]
GeneIDi3824.
KEGGihsa:3824.
UCSCiuc001qxy.4. human. [Q13241-3]
uc001qxz.4. human. [Q13241-2]
uc009zhi.3. human. [Q13241-1]

Polymorphism databases

DMDMi334302835.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

Functional Glycomics Gateway - Glycan Binding

CD94

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U30610 mRNA. Translation: AAC50291.1 .
Y14287 , Y14288 Genomic DNA. Translation: CAA74663.1 .
AJ000673 Genomic DNA. Translation: CAA04230.1 .
AJ000001 mRNA. Translation: CAA03845.1 .
AB009597 mRNA. Translation: BAA24450.1 .
AB010084 Genomic DNA. Translation: BAA24451.1 .
AC022075 Genomic DNA. No translation available.
BC028009 mRNA. Translation: AAH28009.1 .
CCDSi CCDS8621.1. [Q13241-1 ]
CCDS8622.1. [Q13241-3 ]
RefSeqi NP_001107868.1. NM_001114396.1.
NP_002253.1. NM_002262.3.
NP_031360.1. NM_007334.2. [Q13241-3 ]
XP_005253420.1. XM_005253363.2. [Q13241-2 ]
UniGenei Hs.562457.

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
1B6E X-ray 2.60 A 52-179 [» ]
3BDW X-ray 2.50 A/C 57-179 [» ]
3CDG X-ray 3.40 E/J 57-179 [» ]
3CII X-ray 4.41 G/I 59-179 [» ]
ProteinModelPortali Q13241.
SMRi Q13241. Positions 57-179.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 110023. 4 interactions.
STRINGi 9606.ENSP00000338130.

PTM databases

PhosphoSitei Q13241.

Polymorphism databases

DMDMi 334302835.

Proteomic databases

PaxDbi Q13241.
PRIDEi Q13241.

Protocols and materials databases

DNASUi 3824.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000336164 ; ENSP00000338130 ; ENSG00000134539 . [Q13241-1 ]
ENST00000350274 ; ENSP00000310929 ; ENSG00000134539 . [Q13241-3 ]
ENST00000381907 ; ENSP00000371332 ; ENSG00000134539 . [Q13241-1 ]
ENST00000381908 ; ENSP00000371333 ; ENSG00000134539 . [Q13241-2 ]
GeneIDi 3824.
KEGGi hsa:3824.
UCSCi uc001qxy.4. human. [Q13241-3 ]
uc001qxz.4. human. [Q13241-2 ]
uc009zhi.3. human. [Q13241-1 ]

Organism-specific databases

CTDi 3824.
GeneCardsi GC12P010378.
HGNCi HGNC:6378. KLRD1.
MIMi 602894. gene.
neXtProti NX_Q13241.
PharmGKBi PA30167.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG256912.
HOGENOMi HOG000220925.
HOVERGENi HBG099800.
KOi K06516.
OMAi VWIFTAF.
TreeFami TF336674.

Enzyme and pathway databases

Reactomei REACT_11152. Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell.
REACT_147694. DAP12 interactions.
REACT_147814. DAP12 signaling.

Miscellaneous databases

EvolutionaryTracei Q13241.
GeneWikii KLRD1.
GenomeRNAii 3824.
NextBioi 15039.
PROi Q13241.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q13241.
Bgeei Q13241.
CleanExi HS_KLRD1.
Genevestigatori Q13241.

Family and domain databases

Gene3Di 3.10.100.10. 1 hit.
InterProi IPR001304. C-type_lectin.
IPR016186. C-type_lectin-like.
IPR016187. C-type_lectin_fold.
[Graphical view ]
Pfami PF00059. Lectin_C. 1 hit.
[Graphical view ]
SMARTi SM00034. CLECT. 1 hit.
[Graphical view ]
SUPFAMi SSF56436. SSF56436. 1 hit.
PROSITEi PS50041. C_TYPE_LECTIN_2. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Molecular characterization of human CD94: a type II membrane glycoprotein related to the C-type lectin superfamily."
    Chang C., Rodriguez A., Carretero M., Lopez-Botet M., Phillips J.H., Lanier L.L.
    Eur. J. Immunol. 25:2433-2437(1995) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT ALA-25.
    Tissue: Blood.
  2. Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANT ALA-25.
    Tissue: Placenta.
  3. Biassoni R.
    Submitted (JUN-1997) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE (ISOFORM 2).
  4. Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORM 3).
  5. "The finished DNA sequence of human chromosome 12."
    Scherer S.E., Muzny D.M., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R.
    , Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Montgomery K.T., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Lovering R.C., Wheeler D.A., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clerc-Blankenburg K.P., Davis C., Delgado O., Dinh H.H., Draper H., Gonzalez-Garay M.L., Havlak P., Jackson L.R., Jacob L.S., Kelly S.H., Li L., Li Z., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Pasternak S., Perez L.M., Plopper F.J.H., Santibanez J., Shen H., Tabor P.E., Verduzco D., Waldron L., Wang Q., Williams G.A., Zhang J., Zhou J., Allen C.C., Amin A.G., Anyalebechi V., Bailey M., Barbaria J.A., Bimage K.E., Bryant N.P., Burch P.E., Burkett C.E., Burrell K.L., Calderon E., Cardenas V., Carter K., Casias K., Cavazos I., Cavazos S.R., Ceasar H., Chacko J., Chan S.N., Chavez D., Christopoulos C., Chu J., Cockrell R., Cox C.D., Dang M., Dathorne S.R., David R., Davis C.M., Davy-Carroll L., Deshazo D.R., Donlin J.E., D'Souza L., Eaves K.A., Egan A., Emery-Cohen A.J., Escotto M., Flagg N., Forbes L.D., Gabisi A.M., Garza M., Hamilton C., Henderson N., Hernandez O., Hines S., Hogues M.E., Huang M., Idlebird D.G., Johnson R., Jolivet A., Jones S., Kagan R., King L.M., Leal B., Lebow H., Lee S., LeVan J.M., Lewis L.C., London P., Lorensuhewa L.M., Loulseged H., Lovett D.A., Lucier A., Lucier R.L., Ma J., Madu R.C., Mapua P., Martindale A.D., Martinez E., Massey E., Mawhiney S., Meador M.G., Mendez S., Mercado C., Mercado I.C., Merritt C.E., Miner Z.L., Minja E., Mitchell T., Mohabbat F., Mohabbat K., Montgomery B., Moore N., Morris S., Munidasa M., Ngo R.N., Nguyen N.B., Nickerson E., Nwaokelemeh O.O., Nwokenkwo S., Obregon M., Oguh M., Oragunye N., Oviedo R.J., Parish B.J., Parker D.N., Parrish J., Parks K.L., Paul H.A., Payton B.A., Perez A., Perrin W., Pickens A., Primus E.L., Pu L.-L., Puazo M., Quiles M.M., Quiroz J.B., Rabata D., Reeves K., Ruiz S.J., Shao H., Sisson I., Sonaike T., Sorelle R.P., Sutton A.E., Svatek A.F., Svetz L.A., Tamerisa K.S., Taylor T.R., Teague B., Thomas N., Thorn R.D., Trejos Z.Y., Trevino B.K., Ukegbu O.N., Urban J.B., Vasquez L.I., Vera V.A., Villasana D.M., Wang L., Ward-Moore S., Warren J.T., Wei X., White F., Williamson A.L., Wleczyk R., Wooden H.S., Wooden S.H., Yen J., Yoon L., Yoon V., Zorrilla S.E., Nelson D., Kucherlapati R., Weinstock G., Gibbs R.A.
    Nature 440:346-351(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT ALA-25.
    Tissue: Blood.
  7. "Structure of CD94 reveals a novel C-type lectin fold: implications for the NK cell-associated CD94/NKG2 receptors."
    Boyington J.C., Riaz A.N., Patamawenu A., Coligan J.E., Brooks A.G., Sun P.D.
    Immunity 10:75-82(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: X-RAY CRYSTALLOGRAPHY (2.6 ANGSTROMS) OF 52-179, DISULFIDE BONDS.
  8. "The heterodimeric assembly of the CD94-NKG2 receptor family and implications for human leukocyte antigen-E recognition."
    Sullivan L.C., Clements C.S., Beddoe T., Johnson D., Hoare H.L., Lin J., Huyton T., Hopkins E.J., Reid H.H., Wilce M.C., Kabat J., Borrego F., Coligan J.E., Rossjohn J., Brooks A.G.
    Immunity 27:900-911(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: X-RAY CRYSTALLOGRAPHY (2.5 ANGSTROMS) OF 57-179 IN COMPLEX WITH NGK2A, SUBUNIT, DISULFIDE BONDS.
  9. Cited for: X-RAY CRYSTALLOGRAPHY (4.41 ANGSTROMS) OF 59-179 IN COMPLEX WITH NGK2A, SUBUNIT, DISULFIDE BONDS.
  10. "CD94-NKG2A recognition of human leukocyte antigen (HLA)-E bound to an HLA class I leader sequence."
    Petrie E.J., Clements C.S., Lin J., Sullivan L.C., Johnson D., Huyton T., Heroux A., Hoare H.L., Beddoe T., Reid H.H., Wilce M.C., Brooks A.G., Rossjohn J.
    J. Exp. Med. 205:725-735(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: X-RAY CRYSTALLOGRAPHY (3.4 ANGSTROMS) OF 57-179 IN COMPLEX WITH NGK2A, SUBUNIT, DISULFIDE BONDS.

Entry informationi

Entry nameiKLRD1_HUMAN
AccessioniPrimary (citable) accession number: Q13241
Secondary accession number(s): O43321
, O43773, Q9UBE3, Q9UEQ0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: May 31, 2011
Last modified: September 3, 2014
This is version 133 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human cell differentiation molecules
    CD nomenclature of surface proteins of human leucocytes and list of entries
  2. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  7. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi