Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Src-like-adapter

Gene

SLA

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Adapter protein, which negatively regulates T-cell receptor (TCR) signaling. Inhibits T-cell antigen-receptor induced activation of nuclear factor of activated T-cells. Involved in the negative regulation of positive selection and mitosis of T-cells. May act by linking signaling proteins such as ZAP70 with CBL, leading to a CBL dependent degradation of signaling proteins.2 Publications

GO - Molecular functioni

  • SH3/SH2 adaptor activity Source: ProtInc
Complete GO annotation...

Enzyme and pathway databases

BioCyciZFISH:ENSG00000155926-MONOMER.
SignaLinkiQ13239.

Names & Taxonomyi

Protein namesi
Recommended name:
Src-like-adapter
Alternative name(s):
Src-like-adapter protein 1
Short name:
SLAP-1
Short name:
hSLAP
Gene namesi
Name:SLA
Synonyms:SLAP, SLAP1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 8

Organism-specific databases

HGNCiHGNC:10902. SLA.

Subcellular locationi

  • Cytoplasm By similarity
  • Endosome By similarity

  • Note: Colocalizes with endosomes.By similarity

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Endosome

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi111R → K: Strongly reduces interaction with ZAP70, CD3Z, SYK and LAT. 1 Publication1
Mutagenesisi218L → S: Abolishes interaction with CBL. Does not affect dimerization; when associated with S-224 and S-229. 1 Publication1
Mutagenesisi224L → S: Abolishes interaction with CBL. Does not affect dimerization; when associated with S-218 and S-229. 1 Publication1
Mutagenesisi229L → S: Abolishes interaction with CBL. Does not affect dimerization; when associated with S-218 and S-224. 1 Publication1
Mutagenesisi237 – 239LSL → QSQ: Abolishes interaction with CBL. Slightly affects dimerization. 1 Publication3

Organism-specific databases

DisGeNETi6503.
MalaCardsiSLA.
OpenTargetsiENSG00000155926.
PharmGKBiPA35802.

Polymorphism and mutation databases

BioMutaiSLA.
DMDMi30173237.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedBy similarity
ChainiPRO_00000719462 – 276Src-like-adapterAdd BLAST275

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Lipidationi2N-myristoyl glycineBy similarity1
Modified residuei253PhosphoserineBy similarity1
Modified residuei273PhosphotyrosineBy similarity1

Keywords - PTMi

Lipoprotein, Myristate, Phosphoprotein

Proteomic databases

PaxDbiQ13239.
PeptideAtlasiQ13239.
PRIDEiQ13239.

PTM databases

iPTMnetiQ13239.
PhosphoSitePlusiQ13239.

Expressioni

Tissue specificityi

Expressed in lung and fetal brain. Weakly expressed in heart, adult brain, placenta, liver, skeletal muscle, kidney and pancreas.1 Publication

Inductioni

By all-trans retinoic acid (ATRA). Induction is indirect and is mediated through other proteins.1 Publication

Gene expression databases

BgeeiENSG00000155926.
CleanExiHS_SLA.
ExpressionAtlasiQ13239. baseline and differential.
GenevisibleiQ13239. HS.

Organism-specific databases

HPAiHPA012296.

Interactioni

Subunit structurei

Interacts with EPHA2, VAV1, LCP2 and PDGFRB (By similarity). Homodimer. Homodimerization and interaction with phosphorylated CBL occurs via its C-terminal domain. Interacts with phosphorylated proteins ZAP70, CD3Z, SYK and LAT via its SH2 domain.By similarity1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
EGFRP005332EBI-726214,EBI-297353
PDGFRBP096194EBI-726214,EBI-641237

GO - Molecular functioni

  • SH3/SH2 adaptor activity Source: ProtInc

Protein-protein interaction databases

BioGridi112394. 16 interactors.
IntActiQ13239. 6 interactors.
MINTiMINT-1404565.
STRINGi9606.ENSP00000394049.

Structurei

Secondary structure

1276
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi20 – 22Combined sources3
Beta strandi26 – 31Combined sources6
Turni36 – 38Combined sources3
Beta strandi48 – 55Combined sources8
Beta strandi58 – 63Combined sources6
Turni64 – 66Combined sources3
Beta strandi69 – 73Combined sources5
Helixi74 – 76Combined sources3
Beta strandi77 – 80Combined sources4

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2CUDNMR-A15-80[»]
ProteinModelPortaliQ13239.
SMRiQ13239.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ13239.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini22 – 82SH3PROSITE-ProRule annotationAdd BLAST61
Domaini84 – 175SH2PROSITE-ProRule annotationAdd BLAST92

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni212 – 276SLA C-terminalAdd BLAST65

Domaini

The C-terminal domain is essential for the homodimerization and the interaction with CBL. While the interaction with CBL is apparently mediated via the hydrophobic region of this domain, the highly charged region is apparently required for the homodimerization.

Sequence similaritiesi

Contains 1 SH2 domain.PROSITE-ProRule annotation
Contains 1 SH3 domain.PROSITE-ProRule annotation

Keywords - Domaini

SH2 domain, SH3 domain

Phylogenomic databases

eggNOGiENOG410IFZ7. Eukaryota.
ENOG4111KT3. LUCA.
GeneTreeiENSGT00390000001681.
HOGENOMiHOG000234240.
HOVERGENiHBG054908.
InParanoidiQ13239.
OMAiRQKTVDW.
OrthoDBiEOG091G0DST.
PhylomeDBiQ13239.

Family and domain databases

Gene3Di3.30.505.10. 1 hit.
InterProiIPR000980. SH2.
IPR001452. SH3_domain.
[Graphical view]
PfamiPF00017. SH2. 1 hit.
PF00018. SH3_1. 1 hit.
[Graphical view]
PRINTSiPR00401. SH2DOMAIN.
SMARTiSM00252. SH2. 1 hit.
SM00326. SH3. 1 hit.
[Graphical view]
SUPFAMiSSF50044. SSF50044. 1 hit.
SSF55550. SSF55550. 1 hit.
PROSITEiPS50001. SH2. 1 hit.
PS50002. SH3. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q13239-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGNSMKSTPA PAERPLPNPE GLDSDFLAVL SDYPSPDISP PIFRRGEKLR
60 70 80 90 100
VISDEGGWWK AISLSTGRES YIPGICVARV YHGWLFEGLG RDKAEELLQL
110 120 130 140 150
PDTKVGSFMI RESETKKGFY SLSVRHRQVK HYRIFRLPNN WYYISPRLTF
160 170 180 190 200
QCLEDLVNHY SEVADGLCCV LTTPCLTQST AAPAVRASSS PVTLRQKTVD
210 220 230 240 250
WRRVSRLQED PEGTENPLGV DESLFSYGLR ESIASYLSLT SEDNTSFDRK
260 270
KKSISLMYGG SKRKSSFFSS PPYFED
Length:276
Mass (Da):31,156
Last modified:January 23, 2007 - v3
Checksum:iB0FCC7D7B2ECA378
GO
Isoform 2 (identifier: Q13239-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-108: Missing.

Note: No experimental confirmation available.
Show »
Length:168
Mass (Da):19,285
Checksum:i0BC12A843F32869D
GO
Isoform 3 (identifier: Q13239-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MLHRLWASPAAPGKKKEM

Note: No experimental confirmation available.
Show »
Length:293
Mass (Da):33,059
Checksum:i6721FE5A9562C6DC
GO
Isoform 4 (identifier: Q13239-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MLHRLWASPAAPGKKKEM
     118-161: Missing.

Note: No experimental confirmation available.
Show »
Length:249
Mass (Da):27,558
Checksum:iD072FF483DAA2778
GO
Isoform 5 (identifier: Q13239-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MLSKLGHSPLGGLRARLTFPVCLLYHRLWASPAAPGKKKEM

Note: No experimental confirmation available.
Show »
Length:316
Mass (Da):35,540
Checksum:i93C3155474168A96
GO

Sequence cautioni

The sequence AAH07042 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence BAG35478 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti71Y → D in CAB53536 (PubMed:11179692).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_06170615P → T.Corresponds to variant rs4486183dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0551221 – 108Missing in isoform 2. 1 PublicationAdd BLAST108
Alternative sequenceiVSP_0551231M → MLHRLWASPAAPGKKKEM in isoform 3 and isoform 4. 1 Publication1
Alternative sequenceiVSP_0551241M → MLSKLGHSPLGGLRARLTFP VCLLYHRLWASPAAPGKKKE M in isoform 5. 1 Publication1
Alternative sequenceiVSP_055125118 – 161Missing in isoform 4. 1 PublicationAdd BLAST44

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U30473 mRNA. Translation: AAC50357.1.
D89077 mRNA. Translation: BAA13758.1.
U44403 mRNA. Translation: AAC27662.1.
CR536537 mRNA. Translation: CAG38774.1.
AK297423 mRNA. Translation: BAH12578.1.
AK297519 mRNA. Translation: BAH12602.1.
AK312584 mRNA. Translation: BAG35478.1. Different initiation.
AF235100 Genomic DNA. No translation available.
AF305872 Genomic DNA. No translation available.
CH471060 Genomic DNA. Translation: EAW92159.1.
BC007042 mRNA. Translation: AAH07042.1. Different initiation.
AJ238591 mRNA. Translation: CAB53536.1.
CCDSiCCDS47922.1. [Q13239-3]
CCDS47923.1. [Q13239-5]
CCDS6370.1. [Q13239-1]
CCDS64977.1. [Q13239-2]
CCDS64978.1. [Q13239-4]
RefSeqiNP_001039021.1. NM_001045556.2. [Q13239-1]
NP_001039022.2. NM_001045557.2. [Q13239-3]
NP_001269893.1. NM_001282964.1. [Q13239-4]
NP_001269894.1. NM_001282965.1. [Q13239-2]
NP_006739.2. NM_006748.3. [Q13239-5]
XP_016869228.1. XM_017013739.1. [Q13239-2]
UniGeneiHs.75367.

Genome annotation databases

EnsembliENST00000338087; ENSP00000337548; ENSG00000155926. [Q13239-1]
ENST00000395352; ENSP00000378759; ENSG00000155926. [Q13239-3]
ENST00000427060; ENSP00000394049; ENSG00000155926. [Q13239-5]
ENST00000517648; ENSP00000428559; ENSG00000155926. [Q13239-4]
ENST00000524345; ENSP00000427928; ENSG00000155926. [Q13239-2]
GeneIDi6503.
KEGGihsa:6503.
UCSCiuc003ytz.4. human. [Q13239-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U30473 mRNA. Translation: AAC50357.1.
D89077 mRNA. Translation: BAA13758.1.
U44403 mRNA. Translation: AAC27662.1.
CR536537 mRNA. Translation: CAG38774.1.
AK297423 mRNA. Translation: BAH12578.1.
AK297519 mRNA. Translation: BAH12602.1.
AK312584 mRNA. Translation: BAG35478.1. Different initiation.
AF235100 Genomic DNA. No translation available.
AF305872 Genomic DNA. No translation available.
CH471060 Genomic DNA. Translation: EAW92159.1.
BC007042 mRNA. Translation: AAH07042.1. Different initiation.
AJ238591 mRNA. Translation: CAB53536.1.
CCDSiCCDS47922.1. [Q13239-3]
CCDS47923.1. [Q13239-5]
CCDS6370.1. [Q13239-1]
CCDS64977.1. [Q13239-2]
CCDS64978.1. [Q13239-4]
RefSeqiNP_001039021.1. NM_001045556.2. [Q13239-1]
NP_001039022.2. NM_001045557.2. [Q13239-3]
NP_001269893.1. NM_001282964.1. [Q13239-4]
NP_001269894.1. NM_001282965.1. [Q13239-2]
NP_006739.2. NM_006748.3. [Q13239-5]
XP_016869228.1. XM_017013739.1. [Q13239-2]
UniGeneiHs.75367.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2CUDNMR-A15-80[»]
ProteinModelPortaliQ13239.
SMRiQ13239.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi112394. 16 interactors.
IntActiQ13239. 6 interactors.
MINTiMINT-1404565.
STRINGi9606.ENSP00000394049.

PTM databases

iPTMnetiQ13239.
PhosphoSitePlusiQ13239.

Polymorphism and mutation databases

BioMutaiSLA.
DMDMi30173237.

Proteomic databases

PaxDbiQ13239.
PeptideAtlasiQ13239.
PRIDEiQ13239.

Protocols and materials databases

DNASUi6503.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000338087; ENSP00000337548; ENSG00000155926. [Q13239-1]
ENST00000395352; ENSP00000378759; ENSG00000155926. [Q13239-3]
ENST00000427060; ENSP00000394049; ENSG00000155926. [Q13239-5]
ENST00000517648; ENSP00000428559; ENSG00000155926. [Q13239-4]
ENST00000524345; ENSP00000427928; ENSG00000155926. [Q13239-2]
GeneIDi6503.
KEGGihsa:6503.
UCSCiuc003ytz.4. human. [Q13239-1]

Organism-specific databases

CTDi6503.
DisGeNETi6503.
GeneCardsiSLA.
HGNCiHGNC:10902. SLA.
HPAiHPA012296.
MalaCardsiSLA.
MIMi601099. gene.
neXtProtiNX_Q13239.
OpenTargetsiENSG00000155926.
PharmGKBiPA35802.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IFZ7. Eukaryota.
ENOG4111KT3. LUCA.
GeneTreeiENSGT00390000001681.
HOGENOMiHOG000234240.
HOVERGENiHBG054908.
InParanoidiQ13239.
OMAiRQKTVDW.
OrthoDBiEOG091G0DST.
PhylomeDBiQ13239.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000155926-MONOMER.
SignaLinkiQ13239.

Miscellaneous databases

EvolutionaryTraceiQ13239.
GenomeRNAii6503.
PROiQ13239.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000155926.
CleanExiHS_SLA.
ExpressionAtlasiQ13239. baseline and differential.
GenevisibleiQ13239. HS.

Family and domain databases

Gene3Di3.30.505.10. 1 hit.
InterProiIPR000980. SH2.
IPR001452. SH3_domain.
[Graphical view]
PfamiPF00017. SH2. 1 hit.
PF00018. SH3_1. 1 hit.
[Graphical view]
PRINTSiPR00401. SH2DOMAIN.
SMARTiSM00252. SH2. 1 hit.
SM00326. SH3. 1 hit.
[Graphical view]
SUPFAMiSSF50044. SSF50044. 1 hit.
SSF55550. SSF55550. 1 hit.
PROSITEiPS50001. SH2. 1 hit.
PS50002. SH3. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiSLAP1_HUMAN
AccessioniPrimary (citable) accession number: Q13239
Secondary accession number(s): B7Z4J2
, B7Z4L6, Q6FI01, Q9UMQ8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 23, 2003
Last sequence update: January 23, 2007
Last modified: November 2, 2016
This is version 151 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 8
    Human chromosome 8: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.