Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q13239

- SLAP1_HUMAN

UniProt

Q13239 - SLAP1_HUMAN

Protein

Src-like-adapter

Gene

SLA

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 130 (01 Oct 2014)
      Sequence version 3 (23 Jan 2007)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Adapter protein, which negatively regulates T-cell receptor (TCR) signaling. Inhibits T-cell antigen-receptor induced activation of nuclear factor of activated T-cells. Involved in the negative regulation of positive selection and mitosis of T-cells. May act by linking signaling proteins such as ZAP70 with CBL, leading to a CBL dependent degradation of signaling proteins.2 Publications

    GO - Molecular functioni

    1. protein binding Source: IntAct
    2. SH3/SH2 adaptor activity Source: ProtInc

    GO - Biological processi

    1. positive regulation of signal transduction Source: GOC

    Enzyme and pathway databases

    SignaLinkiQ13239.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Src-like-adapter
    Alternative name(s):
    Src-like-adapter protein 1
    Short name:
    SLAP-1
    Short name:
    hSLAP
    Gene namesi
    Name:SLA
    Synonyms:SLAP, SLAP1
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 8

    Organism-specific databases

    HGNCiHGNC:10902. SLA.

    Subcellular locationi

    Cytoplasm By similarity. Endosome By similarity
    Note: Colocalizes with endosomes.By similarity

    GO - Cellular componenti

    1. endosome Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Cytoplasm, Endosome

    Pathology & Biotechi

    Mutagenesis

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Mutagenesisi111 – 1111R → K: Strongly reduces interaction with ZAP70, CD3Z, SYK and LAT. 1 Publication
    Mutagenesisi218 – 2181L → S: Abolishes interaction with CBL. Does not affect dimerization; when associated with S-224 and S-229. 1 Publication
    Mutagenesisi224 – 2241L → S: Abolishes interaction with CBL. Does not affect dimerization; when associated with S-218 and S-229. 1 Publication
    Mutagenesisi229 – 2291L → S: Abolishes interaction with CBL. Does not affect dimerization; when associated with S-218 and S-224. 1 Publication
    Mutagenesisi237 – 2393LSL → QSQ: Abolishes interaction with CBL. Slightly affects dimerization.

    Organism-specific databases

    PharmGKBiPA35802.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Initiator methioninei1 – 11RemovedBy similarity
    Chaini2 – 276275Src-like-adapterPRO_0000071946Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Lipidationi2 – 21N-myristoyl glycineBy similarity
    Modified residuei273 – 2731PhosphotyrosineBy similarity

    Keywords - PTMi

    Lipoprotein, Myristate, Phosphoprotein

    Proteomic databases

    MaxQBiQ13239.
    PaxDbiQ13239.
    PRIDEiQ13239.

    PTM databases

    PhosphoSiteiQ13239.

    Expressioni

    Tissue specificityi

    Expressed in lung and fetal brain. Weakly expressed in heart, adult brain, placenta, liver, skeletal muscle, kidney and pancreas.1 Publication

    Inductioni

    By all-trans retinoic acid (ATRA). Induction is indirect and is mediated through other proteins.1 Publication

    Gene expression databases

    ArrayExpressiQ13239.
    BgeeiQ13239.
    CleanExiHS_SLA.
    GenevestigatoriQ13239.

    Organism-specific databases

    HPAiHPA012296.

    Interactioni

    Subunit structurei

    Interacts with EPHA2, VAV1, LCP2 and PDGFRB By similarity. Homodimer. Homodimerization and interaction with phosphorylated CBL occurs via its C-terminal domain. Interacts with phosphorylated proteins ZAP70, CD3Z, SYK and LAT via its SH2 domain.By similarity1 Publication

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    PDGFRBP096194EBI-726214,EBI-641237

    Protein-protein interaction databases

    BioGridi112394. 15 interactions.
    IntActiQ13239. 6 interactions.
    MINTiMINT-1404565.
    STRINGi9606.ENSP00000394049.

    Structurei

    Secondary structure

    1
    276
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Beta strandi20 – 223
    Beta strandi26 – 316
    Turni36 – 383
    Beta strandi48 – 558
    Beta strandi58 – 636
    Turni64 – 663
    Beta strandi69 – 735
    Helixi74 – 763
    Beta strandi77 – 804

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    2CUDNMR-A15-80[»]
    ProteinModelPortaliQ13239.
    SMRiQ13239. Positions 13-212.
    ModBaseiSearch...
    MobiDBiSearch...

    Miscellaneous databases

    EvolutionaryTraceiQ13239.

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini22 – 8261SH3PROSITE-ProRule annotationAdd
    BLAST
    Domaini84 – 17592SH2PROSITE-ProRule annotationAdd
    BLAST

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni212 – 27665SLA C-terminalAdd
    BLAST

    Domaini

    The C-terminal domain is essential for the homodimerization and the interaction with CBL. While the interaction with CBL is apparently mediated via the hydrophobic region of this domain, the highly charged region is apparently required for the homodimerization.

    Sequence similaritiesi

    Contains 1 SH2 domain.PROSITE-ProRule annotation
    Contains 1 SH3 domain.PROSITE-ProRule annotation

    Keywords - Domaini

    SH2 domain, SH3 domain

    Phylogenomic databases

    eggNOGiNOG151065.
    HOGENOMiHOG000234240.
    HOVERGENiHBG054908.
    InParanoidiQ13239.
    OrthoDBiEOG7DVDBX.
    PhylomeDBiQ13239.

    Family and domain databases

    Gene3Di3.30.505.10. 1 hit.
    InterProiIPR000980. SH2.
    IPR001452. SH3_domain.
    [Graphical view]
    PfamiPF00017. SH2. 1 hit.
    PF00018. SH3_1. 1 hit.
    [Graphical view]
    PRINTSiPR00401. SH2DOMAIN.
    SMARTiSM00252. SH2. 1 hit.
    SM00326. SH3. 1 hit.
    [Graphical view]
    SUPFAMiSSF50044. SSF50044. 1 hit.
    SSF55550. SSF55550. 1 hit.
    PROSITEiPS50001. SH2. 1 hit.
    PS50002. SH3. 1 hit.
    [Graphical view]

    Sequences (5)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 5 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q13239-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MGNSMKSTPA PAERPLPNPE GLDSDFLAVL SDYPSPDISP PIFRRGEKLR    50
    VISDEGGWWK AISLSTGRES YIPGICVARV YHGWLFEGLG RDKAEELLQL 100
    PDTKVGSFMI RESETKKGFY SLSVRHRQVK HYRIFRLPNN WYYISPRLTF 150
    QCLEDLVNHY SEVADGLCCV LTTPCLTQST AAPAVRASSS PVTLRQKTVD 200
    WRRVSRLQED PEGTENPLGV DESLFSYGLR ESIASYLSLT SEDNTSFDRK 250
    KKSISLMYGG SKRKSSFFSS PPYFED 276
    Length:276
    Mass (Da):31,156
    Last modified:January 23, 2007 - v3
    Checksum:iB0FCC7D7B2ECA378
    GO
    Isoform 2 (identifier: Q13239-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-108: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:168
    Mass (Da):19,285
    Checksum:i0BC12A843F32869D
    GO
    Isoform 3 (identifier: Q13239-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MLHRLWASPAAPGKKKEM

    Note: No experimental confirmation available.

    Show »
    Length:293
    Mass (Da):33,059
    Checksum:i6721FE5A9562C6DC
    GO
    Isoform 4 (identifier: Q13239-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MLHRLWASPAAPGKKKEM
         118-161: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:249
    Mass (Da):27,558
    Checksum:iD072FF483DAA2778
    GO
    Isoform 5 (identifier: Q13239-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MLSKLGHSPLGGLRARLTFPVCLLYHRLWASPAAPGKKKEM

    Note: No experimental confirmation available.

    Show »
    Length:316
    Mass (Da):35,540
    Checksum:i93C3155474168A96
    GO

    Sequence cautioni

    The sequence AAH07042.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.
    The sequence BAG35478.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti71 – 711Y → D in CAB53536. (PubMed:11179692)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti15 – 151P → T.
    Corresponds to variant rs4486183 [ dbSNP | Ensembl ].
    VAR_061706

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 108108Missing in isoform 2. 1 PublicationVSP_055122Add
    BLAST
    Alternative sequencei1 – 11M → MLHRLWASPAAPGKKKEM in isoform 3 and isoform 4. 1 PublicationVSP_055123
    Alternative sequencei1 – 11M → MLSKLGHSPLGGLRARLTFP VCLLYHRLWASPAAPGKKKE M in isoform 5. 1 PublicationVSP_055124
    Alternative sequencei118 – 16144Missing in isoform 4. 1 PublicationVSP_055125Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U30473 mRNA. Translation: AAC50357.1.
    D89077 mRNA. Translation: BAA13758.1.
    U44403 mRNA. Translation: AAC27662.1.
    CR536537 mRNA. Translation: CAG38774.1.
    AK297423 mRNA. Translation: BAH12578.1.
    AK297519 mRNA. Translation: BAH12602.1.
    AK312584 mRNA. Translation: BAG35478.1. Different initiation.
    AF235100 Genomic DNA. No translation available.
    AF305872 Genomic DNA. No translation available.
    CH471060 Genomic DNA. Translation: EAW92159.1.
    BC007042 mRNA. Translation: AAH07042.1. Different initiation.
    AJ238591 mRNA. Translation: CAB53536.1.
    CCDSiCCDS47922.1. [Q13239-3]
    CCDS47923.1. [Q13239-5]
    CCDS6370.1. [Q13239-1]
    CCDS64977.1. [Q13239-2]
    CCDS64978.1. [Q13239-4]
    RefSeqiNP_001039021.1. NM_001045556.2.
    NP_001039022.2. NM_001045557.2.
    NP_001269893.1. NM_001282964.1.
    NP_001269894.1. NM_001282965.1.
    NP_006739.2. NM_006748.3.
    UniGeneiHs.75367.

    Genome annotation databases

    EnsembliENST00000338087; ENSP00000337548; ENSG00000155926. [Q13239-1]
    ENST00000395352; ENSP00000378759; ENSG00000155926. [Q13239-3]
    ENST00000427060; ENSP00000394049; ENSG00000155926. [Q13239-5]
    ENST00000517648; ENSP00000428559; ENSG00000155926. [Q13239-4]
    ENST00000524345; ENSP00000427928; ENSG00000155926. [Q13239-2]
    GeneIDi6503.
    KEGGihsa:6503.
    UCSCiuc003ytz.3. human. [Q13239-1]

    Polymorphism databases

    DMDMi30173237.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U30473 mRNA. Translation: AAC50357.1 .
    D89077 mRNA. Translation: BAA13758.1 .
    U44403 mRNA. Translation: AAC27662.1 .
    CR536537 mRNA. Translation: CAG38774.1 .
    AK297423 mRNA. Translation: BAH12578.1 .
    AK297519 mRNA. Translation: BAH12602.1 .
    AK312584 mRNA. Translation: BAG35478.1 . Different initiation.
    AF235100 Genomic DNA. No translation available.
    AF305872 Genomic DNA. No translation available.
    CH471060 Genomic DNA. Translation: EAW92159.1 .
    BC007042 mRNA. Translation: AAH07042.1 . Different initiation.
    AJ238591 mRNA. Translation: CAB53536.1 .
    CCDSi CCDS47922.1. [Q13239-3 ]
    CCDS47923.1. [Q13239-5 ]
    CCDS6370.1. [Q13239-1 ]
    CCDS64977.1. [Q13239-2 ]
    CCDS64978.1. [Q13239-4 ]
    RefSeqi NP_001039021.1. NM_001045556.2.
    NP_001039022.2. NM_001045557.2.
    NP_001269893.1. NM_001282964.1.
    NP_001269894.1. NM_001282965.1.
    NP_006739.2. NM_006748.3.
    UniGenei Hs.75367.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    2CUD NMR - A 15-80 [» ]
    ProteinModelPortali Q13239.
    SMRi Q13239. Positions 13-212.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 112394. 15 interactions.
    IntActi Q13239. 6 interactions.
    MINTi MINT-1404565.
    STRINGi 9606.ENSP00000394049.

    PTM databases

    PhosphoSitei Q13239.

    Polymorphism databases

    DMDMi 30173237.

    Proteomic databases

    MaxQBi Q13239.
    PaxDbi Q13239.
    PRIDEi Q13239.

    Protocols and materials databases

    DNASUi 6503.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000338087 ; ENSP00000337548 ; ENSG00000155926 . [Q13239-1 ]
    ENST00000395352 ; ENSP00000378759 ; ENSG00000155926 . [Q13239-3 ]
    ENST00000427060 ; ENSP00000394049 ; ENSG00000155926 . [Q13239-5 ]
    ENST00000517648 ; ENSP00000428559 ; ENSG00000155926 . [Q13239-4 ]
    ENST00000524345 ; ENSP00000427928 ; ENSG00000155926 . [Q13239-2 ]
    GeneIDi 6503.
    KEGGi hsa:6503.
    UCSCi uc003ytz.3. human. [Q13239-1 ]

    Organism-specific databases

    CTDi 6503.
    GeneCardsi GC08M134118.
    HGNCi HGNC:10902. SLA.
    HPAi HPA012296.
    MIMi 601099. gene.
    neXtProti NX_Q13239.
    PharmGKBi PA35802.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG151065.
    HOGENOMi HOG000234240.
    HOVERGENi HBG054908.
    InParanoidi Q13239.
    OrthoDBi EOG7DVDBX.
    PhylomeDBi Q13239.

    Enzyme and pathway databases

    SignaLinki Q13239.

    Miscellaneous databases

    EvolutionaryTracei Q13239.
    GenomeRNAii 6503.
    NextBioi 25281.
    PROi Q13239.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q13239.
    Bgeei Q13239.
    CleanExi HS_SLA.
    Genevestigatori Q13239.

    Family and domain databases

    Gene3Di 3.30.505.10. 1 hit.
    InterProi IPR000980. SH2.
    IPR001452. SH3_domain.
    [Graphical view ]
    Pfami PF00017. SH2. 1 hit.
    PF00018. SH3_1. 1 hit.
    [Graphical view ]
    PRINTSi PR00401. SH2DOMAIN.
    SMARTi SM00252. SH2. 1 hit.
    SM00326. SH3. 1 hit.
    [Graphical view ]
    SUPFAMi SSF50044. SSF50044. 1 hit.
    SSF55550. SSF55550. 1 hit.
    PROSITEi PS50001. SH2. 1 hit.
    PS50002. SH3. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Chromosomal localization of the mouse Src-like adapter protein (Slap) gene and its putative human homolog SLA."
      Angrist M., Wells D.E., Chakravarti A., Pandey A.
      Genomics 30:623-625(1995) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    2. "Expression of Src-like adapter protein mRNA is induced by all-trans retinoic acid."
      Ohtsuki T., Hatake K., Ikeda M., Tomizuka H., Terui Y., Uwai M., Miura Y.
      Biochem. Biophys. Res. Commun. 230:81-84(1997) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), INDUCTION BY ATRA.
      Tissue: Histiocytic lymphoma.
    3. "The gene for the human Src-like adaptor protein (hSLAP) is located within the 64-kb intron of the thyroglobulin gene."
      Meijerink P.H.S., Yanakiev P., Zorn I., Grierson A.J., Bikker H., Dye D., Kalaydjieva L., Baas F.
      Eur. J. Biochem. 254:297-303(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY.
      Tissue: Fetal brain.
    4. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION.
    5. "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)."
      Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
      Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    6. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2; 3 AND 4).
      Tissue: Brain.
    7. "DNA sequence and analysis of human chromosome 8."
      Nusbaum C., Mikkelsen T.S., Zody M.C., Asakawa S., Taudien S., Garber M., Kodira C.D., Schueler M.G., Shimizu A., Whittaker C.A., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Yang X., Allen N.R., Anderson S., Asakawa T.
      , Blechschmidt K., Bloom T., Borowsky M.L., Butler J., Cook A., Corum B., DeArellano K., DeCaprio D., Dooley K.T., Dorris L. III, Engels R., Gloeckner G., Hafez N., Hagopian D.S., Hall J.L., Ishikawa S.K., Jaffe D.B., Kamat A., Kudoh J., Lehmann R., Lokitsang T., Macdonald P., Major J.E., Matthews C.D., Mauceli E., Menzel U., Mihalev A.H., Minoshima S., Murayama Y., Naylor J.W., Nicol R., Nguyen C., O'Leary S.B., O'Neill K., Parker S.C.J., Polley A., Raymond C.K., Reichwald K., Rodriguez J., Sasaki T., Schilhabel M., Siddiqui R., Smith C.L., Sneddon T.P., Talamas J.A., Tenzin P., Topham K., Venkataraman V., Wen G., Yamazaki S., Young S.K., Zeng Q., Zimmer A.R., Rosenthal A., Birren B.W., Platzer M., Shimizu N., Lander E.S.
      Nature 439:331-335(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    8. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    9. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 5).
      Tissue: Bone marrow.
    10. "Characterization of promoter region and genomic structure of the murine and human genes encoding Src like adapter protein."
      Kratchmarova I., Sosinowski T., Weiss A., Witter K., Vincenz C., Pandey A.
      Gene 262:267-273(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-72.
    11. "SLAP, a dimeric adapter protein, plays a functional role in T cell receptor signaling."
      Tang J., Sawasdikosol S., Chang J.-H., Burakoff S.J.
      Proc. Natl. Acad. Sci. U.S.A. 96:9775-9780(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, HOMODIMERIZATION, PHOSPHORYLATION, INTERACTION WITH CBL; ZAP70; CD3Z; SYK AND LAT, MUTAGENESIS OF ARG-111; LEU-218; LEU-224; LEU-229 AND 237-LEU--LEU-239.
    12. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Platelet.
    13. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
      Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
      Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Leukemic T-cell.
    14. "Solution structure of the SH3 domain of the human Src-like adapter protein (SLAP)."
      RIKEN structural genomics initiative (RSGI)
      Submitted (NOV-2005) to the PDB data bank
      Cited for: STRUCTURE BY NMR OF 15-80.

    Entry informationi

    Entry nameiSLAP1_HUMAN
    AccessioniPrimary (citable) accession number: Q13239
    Secondary accession number(s): B7Z4J2
    , B7Z4L6, Q6FI01, Q9UMQ8
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: April 23, 2003
    Last sequence update: January 23, 2007
    Last modified: October 1, 2014
    This is version 130 of the entry and version 3 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. Human chromosome 8
      Human chromosome 8: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    6. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3