Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Selenium-binding protein 1

Gene

SELENBP1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Selenium-binding protein which may be involved in the sensing of reactive xenobiotics in the cytoplasm. May be involved in intra-Golgi protein transport (By similarity).By similarity

GO - Molecular functioni

  • selenium binding Source: ProtInc

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Protein transport, Transport

Keywords - Ligandi

Selenium

Names & Taxonomyi

Protein namesi
Recommended name:
Selenium-binding protein 1
Alternative name(s):
56 kDa selenium-binding protein
Short name:
SBP56
Short name:
SP56
Gene namesi
Name:SELENBP1
Synonyms:SBP
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640 Componenti: Chromosome 1

Organism-specific databases

HGNCiHGNC:10719. SELENBP1.

Subcellular locationi

GO - Cellular componenti

  • cytosol Source: UniProtKB-SubCell
  • extracellular exosome Source: UniProtKB
  • extracellular space Source: UniProtKB
  • membrane Source: UniProtKB-SubCell
  • nucleolus Source: HPA
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Membrane, Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA35641.

Polymorphism and mutation databases

BioMutaiSELENBP1.
DMDMi148840437.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Initiator methioninei1 – 11Removed1 Publication
Chaini2 – 472471Selenium-binding protein 1PRO_0000174633Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei2 – 21N-acetylalanine1 Publication
Modified residuei111 – 1111Phosphoserine1 Publication
Modified residuei371 – 3711Phosphoserine1 Publication
Modified residuei467 – 4671PhosphoserineBy similarity

Post-translational modificationi

Phosphorylated.1 Publication
The N-terminus is blocked.By similarity

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

PaxDbiQ13228.
PRIDEiQ13228.

2D gel databases

REPRODUCTION-2DPAGEIPI00012303.
Q13228.
UCD-2DPAGEQ13228.

Expressioni

Tissue specificityi

Highly expressed in liver, lung, colon, prostate, kidney and pancreas. In brain, present both in neurons and glia (at protein level). Down-regulated in lung adenocarcinoma, colorectal carcinoma and ovarian cancer. Two-fold up-regulated in brain and blood from schizophrenia patients.5 Publications

Inductioni

Down-regulated by androgen in prostate cancer cells.1 Publication

Gene expression databases

BgeeiQ13228.
CleanExiHS_SELENBP1.
ExpressionAtlasiQ13228. baseline and differential.
GenevisibleiQ13228. HS.

Organism-specific databases

HPAiCAB008366.
HPA005741.
HPA011731.

Interactioni

Subunit structurei

Interacts with USP33.1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
USP33Q8TEY7-25EBI-711619,EBI-719307

Protein-protein interaction databases

BioGridi114472. 48 interactions.
IntActiQ13228. 11 interactions.
MINTiMINT-5005535.
STRINGi9606.ENSP00000357861.

Structurei

3D structure databases

ProteinModelPortaliQ13228.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the selenium-binding protein family.Curated

Phylogenomic databases

eggNOGiNOG84363.
GeneTreeiENSGT00390000014244.
HOGENOMiHOG000263885.
HOVERGENiHBG017779.
InParanoidiQ13228.
KOiK17285.
OMAiRLVGQIF.
OrthoDBiEOG76DTS8.
PhylomeDBiQ13228.
TreeFamiTF315241.

Family and domain databases

Gene3Di2.130.10.10. 2 hits.
InterProiIPR008826. Se-bd.
IPR015943. WD40/YVTN_repeat-like_dom.
[Graphical view]
PANTHERiPTHR23300. PTHR23300. 1 hit.
PfamiPF05694. SBP56. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q13228-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MATKCGNCGP GYSTPLEAMK GPREEIVYLP CIYRNTGTEA PDYLATVDVD
60 70 80 90 100
PKSPQYCQVI HRLPMPNLKD ELHHSGWNTC SSCFGDSTKS RTKLVLPSLI
110 120 130 140 150
SSRIYVVDVG SEPRAPKLHK VIEPKDIHAK CELAFLHTSH CLASGEVMIS
160 170 180 190 200
SLGDVKGNGK GGFVLLDGET FEVKGTWERP GGAAPLGYDF WYQPRHNVMI
210 220 230 240 250
STEWAAPNVL RDGFNPADVE AGLYGSHLYV WDWQRHEIVQ TLSLKDGLIP
260 270 280 290 300
LEIRFLHNPD AAQGFVGCAL SSTIQRFYKN EGGTWSVEKV IQVPPKKVKG
310 320 330 340 350
WLLPEMPGLI TDILLSLDDR FLYFSNWLHG DLRQYDISDP QRPRLTGQLF
360 370 380 390 400
LGGSIVKGGP VQVLEDEELK SQPEPLVVKG KRVAGGPQMI QLSLDGKRLY
410 420 430 440 450
ITTSLYSAWD KQFYPDLIRE GSVMLQVDVD TVKGGLKLNP NFLVDFGKEP
460 470
LGPALAHELR YPGGDCSSDI WI
Length:472
Mass (Da):52,391
Last modified:May 29, 2007 - v2
Checksum:i6DC68F9B45FEC1BC
GO
Isoform 2 (identifier: Q13228-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-64: Missing.

Show »
Length:408
Mass (Da):45,349
Checksum:i7765636B7CE8ACA7
GO
Isoform 3 (identifier: Q13228-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     59-120: Missing.

Show »
Length:410
Mass (Da):45,469
Checksum:i966714583DDE49F3
GO
Isoform 4 (identifier: Q13228-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MRLEWGPRPAALPWPAGMCAAERAEGAFTLQSVAQPMRPIAST

Show »
Length:514
Mass (Da):56,866
Checksum:iB0D47E495DD73E67
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti80 – 801C → Y in AAB02395 (PubMed:9027582).Curated
Sequence conflicti92 – 921T → N in AAB02395 (PubMed:9027582).Curated
Sequence conflicti114 – 1163RAP → GPQ in AAB02395 (PubMed:9027582).Curated
Sequence conflicti135 – 1351F → C in AAB02395 (PubMed:9027582).Curated
Sequence conflicti260 – 2623DAA → SAT in AAB02395 (PubMed:9027582).Curated
Sequence conflicti270 – 2734LSST → SAPN in AAB02395 (PubMed:9027582).Curated
Sequence conflicti278 – 2781Y → C in BAG59258 (PubMed:14702039).Curated
Sequence conflicti280 – 2823NEG → TRE in AAB02395 (PubMed:9027582).Curated
Sequence conflicti305 – 3062EM → GV in AAB02395 (PubMed:9027582).Curated
Sequence conflicti410 – 4101D → E in AAB02395 (PubMed:9027582).Curated
Sequence conflicti442 – 4421F → C in AAB02395 (PubMed:9027582).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 6464Missing in isoform 2. 1 PublicationVSP_038440Add
BLAST
Alternative sequencei1 – 11M → MRLEWGPRPAALPWPAGMCA AERAEGAFTLQSVAQPMRPI AST in isoform 4. 1 PublicationVSP_055126
Alternative sequencei59 – 12062Missing in isoform 3. 1 PublicationVSP_045425Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U29091 mRNA. Translation: AAB02395.1.
CR456852 mRNA. Translation: CAG33133.1.
AK296661 mRNA. Translation: BAG59258.1.
AK303815 mRNA. Translation: BAG64765.1.
AK315643 mRNA. Translation: BAG38010.1.
AL391069 Genomic DNA. Translation: CAH70328.1.
CH471121 Genomic DNA. Translation: EAW53443.1.
CH471121 Genomic DNA. Translation: EAW53445.1.
BC009084 mRNA. Translation: AAH09084.1.
BC032997 mRNA. Translation: AAH32997.1.
CCDSiCCDS58027.1. [Q13228-3]
CCDS60266.1. [Q13228-4]
CCDS995.1. [Q13228-1]
PIRiG01872.
RefSeqiNP_001245217.1. NM_001258288.1. [Q13228-3]
NP_001245218.1. NM_001258289.1. [Q13228-4]
NP_003935.2. NM_003944.3. [Q13228-1]
UniGeneiHs.632460.

Genome annotation databases

EnsembliENST00000368868; ENSP00000357861; ENSG00000143416. [Q13228-1]
ENST00000426705; ENSP00000397261; ENSG00000143416. [Q13228-4]
ENST00000447402; ENSP00000413960; ENSG00000143416. [Q13228-3]
GeneIDi8991.
KEGGihsa:8991.
UCSCiuc001exx.4. human. [Q13228-1]
uc010pcz.3. human.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U29091 mRNA. Translation: AAB02395.1.
CR456852 mRNA. Translation: CAG33133.1.
AK296661 mRNA. Translation: BAG59258.1.
AK303815 mRNA. Translation: BAG64765.1.
AK315643 mRNA. Translation: BAG38010.1.
AL391069 Genomic DNA. Translation: CAH70328.1.
CH471121 Genomic DNA. Translation: EAW53443.1.
CH471121 Genomic DNA. Translation: EAW53445.1.
BC009084 mRNA. Translation: AAH09084.1.
BC032997 mRNA. Translation: AAH32997.1.
CCDSiCCDS58027.1. [Q13228-3]
CCDS60266.1. [Q13228-4]
CCDS995.1. [Q13228-1]
PIRiG01872.
RefSeqiNP_001245217.1. NM_001258288.1. [Q13228-3]
NP_001245218.1. NM_001258289.1. [Q13228-4]
NP_003935.2. NM_003944.3. [Q13228-1]
UniGeneiHs.632460.

3D structure databases

ProteinModelPortaliQ13228.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi114472. 48 interactions.
IntActiQ13228. 11 interactions.
MINTiMINT-5005535.
STRINGi9606.ENSP00000357861.

Polymorphism and mutation databases

BioMutaiSELENBP1.
DMDMi148840437.

2D gel databases

REPRODUCTION-2DPAGEIPI00012303.
Q13228.
UCD-2DPAGEQ13228.

Proteomic databases

PaxDbiQ13228.
PRIDEiQ13228.

Protocols and materials databases

DNASUi8991.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000368868; ENSP00000357861; ENSG00000143416. [Q13228-1]
ENST00000426705; ENSP00000397261; ENSG00000143416. [Q13228-4]
ENST00000447402; ENSP00000413960; ENSG00000143416. [Q13228-3]
GeneIDi8991.
KEGGihsa:8991.
UCSCiuc001exx.4. human. [Q13228-1]
uc010pcz.3. human.

Organism-specific databases

CTDi8991.
GeneCardsiGC01M151339.
HGNCiHGNC:10719. SELENBP1.
HPAiCAB008366.
HPA005741.
HPA011731.
MIMi604188. gene.
neXtProtiNX_Q13228.
PharmGKBiPA35641.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiNOG84363.
GeneTreeiENSGT00390000014244.
HOGENOMiHOG000263885.
HOVERGENiHBG017779.
InParanoidiQ13228.
KOiK17285.
OMAiRLVGQIF.
OrthoDBiEOG76DTS8.
PhylomeDBiQ13228.
TreeFamiTF315241.

Miscellaneous databases

ChiTaRSiSELENBP1. human.
GeneWikiiSELENBP1.
GenomeRNAii8991.
NextBioi33715.
PROiQ13228.
SOURCEiSearch...

Gene expression databases

BgeeiQ13228.
CleanExiHS_SELENBP1.
ExpressionAtlasiQ13228. baseline and differential.
GenevisibleiQ13228. HS.

Family and domain databases

Gene3Di2.130.10.10. 2 hits.
InterProiIPR008826. Se-bd.
IPR015943. WD40/YVTN_repeat-like_dom.
[Graphical view]
PANTHERiPTHR23300. PTHR23300. 1 hit.
PfamiPF05694. SBP56. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Isolation, characterization, and chromosomal mapping of a novel cDNA clone encoding human selenium binding protein."
    Chang P.W.G., Tsui S.K.W., Liew C., Lee C., Waye M.M.Y., Fung K.
    J. Cell. Biochem. 64:217-224(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Heart.
  2. "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)."
    Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
    Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
  3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 3 AND 4).
    Tissue: Colon, Lung and Synovial cell.
  4. "The DNA sequence and biological annotation of human chromosome 1."
    Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
    , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
    Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    Tissue: Colon and Testis.
  7. Lubec G., Vishwanath V.
    Submitted (MAR-2007) to UniProtKB
    Cited for: PROTEIN SEQUENCE OF 255-276, IDENTIFICATION BY MASS SPECTROMETRY.
    Tissue: Brain and Cajal-Retzius cell.
  8. "Differential expression and androgen regulation of the human selenium-binding protein gene hSP56 in prostate cancer cells."
    Yang M., Sytkowski A.J.
    Cancer Res. 58:3150-3153(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: TISSUE SPECIFICITY, INDUCTION.
  9. "Reduced selenium-binding protein 1 expression is associated with poor outcome in lung adenocarcinomas."
    Chen G., Wang H., Miller C.T., Thomas D.G., Gharib T.G., Misek D.E., Giordano T.J., Orringer M.B., Hanash S.M., Beer D.G.
    J. Pathol. 202:321-329(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: TISSUE SPECIFICITY, SUBCELLULAR LOCATION, PHOSPHORYLATION, IDENTIFICATION BY MASS SPECTROMETRY.
  10. "Comparative gene expression analysis of blood and brain provides concurrent validation of SELENBP1 up-regulation in schizophrenia."
    Glatt S.J., Everall I.P., Kremen W.S., Corbeil J., Sasik R., Khanlou N., Han M., Liew C.-C., Tsuang M.T.
    Proc. Natl. Acad. Sci. U.S.A. 102:15533-15538(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: TISSUE SPECIFICITY, SUBCELLULAR LOCATION.
  11. Cited for: TISSUE SPECIFICITY, IDENTIFICATION BY MASS SPECTROMETRY.
  12. "Suppression of human selenium-binding protein 1 is a late event in colorectal carcinogenesis and is associated with poor survival."
    Kim H., Kang H.J., You K.T., Kim S.H., Lee K.Y., Kim T.I., Kim C., Song S.Y., Kim H.-J., Lee C., Kim H.
    Proteomics 6:3466-3476(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: TISSUE SPECIFICITY, IDENTIFICATION BY MASS SPECTROMETRY.
  13. "Human selenium binding protein-1 (hSP56) interacts with VDU1 in a selenium-dependent manner."
    Jeong J.Y., Wang Y., Sytkowski A.J.
    Biochem. Biophys. Res. Commun. 379:583-588(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH USP33.
  14. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  15. Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS], CLEAVAGE OF INITIATOR METHIONINE [LARGE SCALE ANALYSIS].
  16. "An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome."
    Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.
    J. Proteomics 96:253-262(2014) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-111 AND SER-371, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Liver.

Entry informationi

Entry nameiSBP1_HUMAN
AccessioniPrimary (citable) accession number: Q13228
Secondary accession number(s): A6NML9
, A6PVW9, B2RDR3, B4DKP6, B4E1F3, Q49AQ8, Q96GX7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 15, 1999
Last sequence update: May 29, 2007
Last modified: June 24, 2015
This is version 128 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.