SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q13228

- SBP1_HUMAN

UniProt

Q13228 - SBP1_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Selenium-binding protein 1

Gene
SELENBP1, SBP
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Selenium-binding protein which may be involved in the sensing of reactive xenobiotics in the cytoplasm. May be involved in intra-Golgi protein transport By similarity.

GO - Molecular functioni

  1. protein binding Source: IntAct
  2. selenium binding Source: ProtInc

GO - Biological processi

  1. protein transport Source: UniProtKB-KW
Complete GO annotation...

Keywords - Biological processi

Protein transport, Transport

Keywords - Ligandi

Selenium

Names & Taxonomyi

Protein namesi
Recommended name:
Selenium-binding protein 1
Alternative name(s):
56 kDa selenium-binding protein
Short name:
SBP56
Short name:
SP56
Gene namesi
Synonyms:SBP
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 1

Organism-specific databases

HGNCiHGNC:10719. SELENBP1.

Subcellular locationi

Nucleus. Cytoplasmcytosol. Membrane; Peripheral membrane protein By similarity
Note: May associate with Golgi membrane. May associate with the membrane of autophagosomes By similarity.2 Publications

GO - Cellular componenti

  1. cytosol Source: UniProtKB-SubCell
  2. extracellular space Source: UniProt
  3. extracellular vesicular exosome Source: UniProt
  4. membrane Source: UniProtKB-SubCell
  5. nucleus Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Membrane, Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA35641.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Initiator methioninei1 – 11Removed1 Publication
Chaini2 – 472471Selenium-binding protein 1PRO_0000174633Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei2 – 21N-acetylalanine1 Publication
Modified residuei467 – 4671Phosphoserine By similarity

Post-translational modificationi

Phosphorylated Inferred.1 Publication
The N-terminus is blocked By similarity.

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

MaxQBiQ13228.
PaxDbiQ13228.
PRIDEiQ13228.

2D gel databases

REPRODUCTION-2DPAGEIPI00012303.
Q13228.
UCD-2DPAGEQ13228.

Expressioni

Tissue specificityi

Highly expressed in liver, lung, colon, prostate, kidney and pancreas. In brain, present both in neurons and glia (at protein level). Down-regulated in lung adenocarcinoma, colorectal carcinoma and ovarian cancer. Two-fold up-regulated in brain and blood from schizophrenia patients.5 Publications

Inductioni

Down-regulated by androgen in prostate cancer cells.1 Publication

Gene expression databases

ArrayExpressiQ13228.
BgeeiQ13228.
CleanExiHS_SELENBP1.
GenevestigatoriQ13228.

Organism-specific databases

HPAiCAB008366.
HPA005741.
HPA011731.

Interactioni

Subunit structurei

Interacts with USP33.1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
USP33Q8TEY7-25EBI-711619,EBI-719307

Protein-protein interaction databases

BioGridi114472. 26 interactions.
IntActiQ13228. 11 interactions.
MINTiMINT-5005535.
STRINGi9606.ENSP00000357861.

Structurei

3D structure databases

ProteinModelPortaliQ13228.

Family & Domainsi

Sequence similaritiesi

Phylogenomic databases

eggNOGiNOG84363.
HOGENOMiHOG000263885.
HOVERGENiHBG017779.
InParanoidiQ13228.
KOiK17285.
OrthoDBiEOG76DTS8.
PhylomeDBiQ13228.
TreeFamiTF315241.

Family and domain databases

Gene3Di2.130.10.10. 2 hits.
InterProiIPR008826. Se-bd.
IPR015943. WD40/YVTN_repeat-like_dom.
[Graphical view]
PANTHERiPTHR23300. PTHR23300. 1 hit.
PfamiPF05694. SBP56. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q13228-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MATKCGNCGP GYSTPLEAMK GPREEIVYLP CIYRNTGTEA PDYLATVDVD    50
PKSPQYCQVI HRLPMPNLKD ELHHSGWNTC SSCFGDSTKS RTKLVLPSLI 100
SSRIYVVDVG SEPRAPKLHK VIEPKDIHAK CELAFLHTSH CLASGEVMIS 150
SLGDVKGNGK GGFVLLDGET FEVKGTWERP GGAAPLGYDF WYQPRHNVMI 200
STEWAAPNVL RDGFNPADVE AGLYGSHLYV WDWQRHEIVQ TLSLKDGLIP 250
LEIRFLHNPD AAQGFVGCAL SSTIQRFYKN EGGTWSVEKV IQVPPKKVKG 300
WLLPEMPGLI TDILLSLDDR FLYFSNWLHG DLRQYDISDP QRPRLTGQLF 350
LGGSIVKGGP VQVLEDEELK SQPEPLVVKG KRVAGGPQMI QLSLDGKRLY 400
ITTSLYSAWD KQFYPDLIRE GSVMLQVDVD TVKGGLKLNP NFLVDFGKEP 450
LGPALAHELR YPGGDCSSDI WI 472
Length:472
Mass (Da):52,391
Last modified:May 29, 2007 - v2
Checksum:i6DC68F9B45FEC1BC
GO
Isoform 2 (identifier: Q13228-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-64: Missing.

Show »
Length:408
Mass (Da):45,349
Checksum:i7765636B7CE8ACA7
GO
Isoform 3 (identifier: Q13228-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     59-120: Missing.

Show »
Length:410
Mass (Da):45,469
Checksum:i966714583DDE49F3
GO
Isoform 4 (identifier: Q13228-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MRLEWGPRPAALPWPAGMCAAERAEGAFTLQSVAQPMRPIAST

Show »
Length:514
Mass (Da):56,866
Checksum:iB0D47E495DD73E67
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 6464Missing in isoform 2. VSP_038440Add
BLAST
Alternative sequencei1 – 11M → MRLEWGPRPAALPWPAGMCA AERAEGAFTLQSVAQPMRPI AST in isoform 4. VSP_055126
Alternative sequencei59 – 12062Missing in isoform 3. VSP_045425Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti80 – 801C → Y in AAB02395. 1 Publication
Sequence conflicti92 – 921T → N in AAB02395. 1 Publication
Sequence conflicti114 – 1163RAP → GPQ in AAB02395. 1 Publication
Sequence conflicti135 – 1351F → C in AAB02395. 1 Publication
Sequence conflicti260 – 2623DAA → SAT in AAB02395. 1 Publication
Sequence conflicti270 – 2734LSST → SAPN in AAB02395. 1 Publication
Sequence conflicti278 – 2781Y → C in BAG59258. 1 Publication
Sequence conflicti280 – 2823NEG → TRE in AAB02395. 1 Publication
Sequence conflicti305 – 3062EM → GV in AAB02395. 1 Publication
Sequence conflicti410 – 4101D → E in AAB02395. 1 Publication
Sequence conflicti442 – 4421F → C in AAB02395. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U29091 mRNA. Translation: AAB02395.1.
CR456852 mRNA. Translation: CAG33133.1.
AK296661 mRNA. Translation: BAG59258.1.
AK303815 mRNA. Translation: BAG64765.1.
AK315643 mRNA. Translation: BAG38010.1.
AL391069 Genomic DNA. Translation: CAH70328.1.
CH471121 Genomic DNA. Translation: EAW53443.1.
CH471121 Genomic DNA. Translation: EAW53445.1.
BC009084 mRNA. Translation: AAH09084.1.
BC032997 mRNA. Translation: AAH32997.1.
CCDSiCCDS58027.1. [Q13228-3]
CCDS995.1. [Q13228-1]
PIRiG01872.
RefSeqiNP_001245217.1. NM_001258288.1. [Q13228-3]
NP_001245218.1. NM_001258289.1.
NP_003935.2. NM_003944.3. [Q13228-1]
UniGeneiHs.632460.

Genome annotation databases

EnsembliENST00000368868; ENSP00000357861; ENSG00000143416. [Q13228-1]
ENST00000426705; ENSP00000397261; ENSG00000143416.
ENST00000435071; ENSP00000408263; ENSG00000143416. [Q13228-2]
ENST00000447402; ENSP00000413960; ENSG00000143416. [Q13228-3]
GeneIDi8991.
KEGGihsa:8991.
UCSCiuc001exx.4. human. [Q13228-1]

Polymorphism databases

DMDMi148840437.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U29091 mRNA. Translation: AAB02395.1 .
CR456852 mRNA. Translation: CAG33133.1 .
AK296661 mRNA. Translation: BAG59258.1 .
AK303815 mRNA. Translation: BAG64765.1 .
AK315643 mRNA. Translation: BAG38010.1 .
AL391069 Genomic DNA. Translation: CAH70328.1 .
CH471121 Genomic DNA. Translation: EAW53443.1 .
CH471121 Genomic DNA. Translation: EAW53445.1 .
BC009084 mRNA. Translation: AAH09084.1 .
BC032997 mRNA. Translation: AAH32997.1 .
CCDSi CCDS58027.1. [Q13228-3 ]
CCDS995.1. [Q13228-1 ]
PIRi G01872.
RefSeqi NP_001245217.1. NM_001258288.1. [Q13228-3 ]
NP_001245218.1. NM_001258289.1.
NP_003935.2. NM_003944.3. [Q13228-1 ]
UniGenei Hs.632460.

3D structure databases

ProteinModelPortali Q13228.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 114472. 26 interactions.
IntActi Q13228. 11 interactions.
MINTi MINT-5005535.
STRINGi 9606.ENSP00000357861.

Polymorphism databases

DMDMi 148840437.

2D gel databases

REPRODUCTION-2DPAGE IPI00012303.
Q13228.
UCD-2DPAGE Q13228.

Proteomic databases

MaxQBi Q13228.
PaxDbi Q13228.
PRIDEi Q13228.

Protocols and materials databases

DNASUi 8991.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000368868 ; ENSP00000357861 ; ENSG00000143416 . [Q13228-1 ]
ENST00000426705 ; ENSP00000397261 ; ENSG00000143416 .
ENST00000435071 ; ENSP00000408263 ; ENSG00000143416 . [Q13228-2 ]
ENST00000447402 ; ENSP00000413960 ; ENSG00000143416 . [Q13228-3 ]
GeneIDi 8991.
KEGGi hsa:8991.
UCSCi uc001exx.4. human. [Q13228-1 ]

Organism-specific databases

CTDi 8991.
GeneCardsi GC01M151339.
HGNCi HGNC:10719. SELENBP1.
HPAi CAB008366.
HPA005741.
HPA011731.
MIMi 604188. gene.
neXtProti NX_Q13228.
PharmGKBi PA35641.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG84363.
HOGENOMi HOG000263885.
HOVERGENi HBG017779.
InParanoidi Q13228.
KOi K17285.
OrthoDBi EOG76DTS8.
PhylomeDBi Q13228.
TreeFami TF315241.

Miscellaneous databases

ChiTaRSi SELENBP1. human.
GeneWikii SELENBP1.
GenomeRNAii 8991.
NextBioi 33715.
PROi Q13228.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q13228.
Bgeei Q13228.
CleanExi HS_SELENBP1.
Genevestigatori Q13228.

Family and domain databases

Gene3Di 2.130.10.10. 2 hits.
InterProi IPR008826. Se-bd.
IPR015943. WD40/YVTN_repeat-like_dom.
[Graphical view ]
PANTHERi PTHR23300. PTHR23300. 1 hit.
Pfami PF05694. SBP56. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Isolation, characterization, and chromosomal mapping of a novel cDNA clone encoding human selenium binding protein."
    Chang P.W.G., Tsui S.K.W., Liew C., Lee C., Waye M.M.Y., Fung K.
    J. Cell. Biochem. 64:217-224(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Heart.
  2. "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)."
    Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
    Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
  3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 3 AND 4).
    Tissue: Colon, Lung and Synovial cell.
  4. "The DNA sequence and biological annotation of human chromosome 1."
    Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
    , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
    Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    Tissue: Colon and Testis.
  7. Lubec G., Vishwanath V.
    Submitted (MAR-2007) to UniProtKB
    Cited for: PROTEIN SEQUENCE OF 255-276, IDENTIFICATION BY MASS SPECTROMETRY.
    Tissue: Brain and Cajal-Retzius cell.
  8. "Differential expression and androgen regulation of the human selenium-binding protein gene hSP56 in prostate cancer cells."
    Yang M., Sytkowski A.J.
    Cancer Res. 58:3150-3153(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: TISSUE SPECIFICITY, INDUCTION.
  9. "Reduced selenium-binding protein 1 expression is associated with poor outcome in lung adenocarcinomas."
    Chen G., Wang H., Miller C.T., Thomas D.G., Gharib T.G., Misek D.E., Giordano T.J., Orringer M.B., Hanash S.M., Beer D.G.
    J. Pathol. 202:321-329(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: TISSUE SPECIFICITY, SUBCELLULAR LOCATION, PHOSPHORYLATION, IDENTIFICATION BY MASS SPECTROMETRY.
  10. "Comparative gene expression analysis of blood and brain provides concurrent validation of SELENBP1 up-regulation in schizophrenia."
    Glatt S.J., Everall I.P., Kremen W.S., Corbeil J., Sasik R., Khanlou N., Han M., Liew C.-C., Tsuang M.T.
    Proc. Natl. Acad. Sci. U.S.A. 102:15533-15538(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: TISSUE SPECIFICITY, SUBCELLULAR LOCATION.
  11. Cited for: TISSUE SPECIFICITY, IDENTIFICATION BY MASS SPECTROMETRY.
  12. "Suppression of human selenium-binding protein 1 is a late event in colorectal carcinogenesis and is associated with poor survival."
    Kim H., Kang H.J., You K.T., Kim S.H., Lee K.Y., Kim T.I., Kim C., Song S.Y., Kim H.-J., Lee C., Kim H.
    Proteomics 6:3466-3476(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: TISSUE SPECIFICITY, IDENTIFICATION BY MASS SPECTROMETRY.
  13. "Human selenium binding protein-1 (hSP56) interacts with VDU1 in a selenium-dependent manner."
    Jeong J.Y., Wang Y., Sytkowski A.J.
    Biochem. Biophys. Res. Commun. 379:583-588(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH USP33.
  14. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  15. Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS], CLEAVAGE OF INITIATOR METHIONINE [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiSBP1_HUMAN
AccessioniPrimary (citable) accession number: Q13228
Secondary accession number(s): A6NML9
, A6PVW9, B2RDR3, B4DKP6, B4E1F3, Q49AQ8, Q96GX7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 15, 1999
Last sequence update: May 29, 2007
Last modified: September 3, 2014
This is version 119 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi