Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Methanethiol oxidase

Gene

SELENBP1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Catalyzes the oxidation of methanethiol, an organosulfur compound known to be produced in substantial amounts by gut bacteria (PubMed:29255262). Selenium-binding protein which may be involved in the sensing of reactive xenobiotics in the cytoplasm. May be involved in intra-Golgi protein transport (By similarity).By similarity1 Publication

Catalytic activityi

Methanethiol + O2 + H2O = formaldehyde + H2S + H2O2.1 Publication

Kineticsi

  1. KM=4.8 nM for methanethiol1 Publication

    Pathwayi: Organosulfur degradation

    This protein is involved in Organosulfur degradation.1 Publication
    View all proteins of this organism that are known to be involved in Organosulfur degradation.

    GO - Molecular functioni

    • methanethiol oxidase activity Source: UniProtKB-EC
    • selenium binding Source: ProtInc

    GO - Biological processi

    Keywordsi

    Molecular functionOxidoreductase
    Biological processProtein transport, Transport
    LigandSelenium

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Methanethiol oxidase1 Publication (EC:1.8.3.41 Publication)
    Short name:
    MTO1 Publication
    Alternative name(s):
    56 kDa selenium-binding protein
    Short name:
    SBP56
    Short name:
    SP56
    Selenium-binding protein 1
    Gene namesi
    Name:SELENBP1
    Synonyms:SBP
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    Proteomesi
    • UP000005640 Componenti: Chromosome 1

    Organism-specific databases

    EuPathDBiHostDB:ENSG00000143416.20
    HGNCiHGNC:10719 SELENBP1
    MIMi604188 gene
    neXtProtiNX_Q13228

    Subcellular locationi

    Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

    Keywords - Cellular componenti

    Cytoplasm, Membrane, Nucleus

    Pathology & Biotechi

    Involvement in diseasei

    SELENBP1 mutations are responsible for an autosomal recessive malodor condition characterized by extraoral blood-borne halitosis resulting from the accumulation of sulfur-containing metabolites. In extraoral blood-borne halitosis, malodorant compounds are carried to the lungs, where they enter the breath. Affected individuals have a cabbage-like breath odor, high levels of methanethiol and dimethylsulfide in oral and nasal breath, and elevated urinary excretion of dimethylsulfoxide in the absence of intake of dimethylsulfide-containing food or use of sulfur-containing medication, lower-gastrointestinal problems, and known metabolic defects, such as methionine adenosyltransferase deficiency and tyrosinemia.1 Publication

    Keywords - Diseasei

    Disease mutation

    Organism-specific databases

    DisGeNETi8991
    OpenTargetsiENSG00000143416
    PharmGKBiPA35641

    Polymorphism and mutation databases

    BioMutaiSELENBP1
    DMDMi148840437

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    Initiator methionineiRemovedCombined sources
    ChainiPRO_00001746332 – 472Methanethiol oxidaseAdd BLAST471

    Amino acid modifications

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    Modified residuei2N-acetylalanineCombined sources1
    Modified residuei111PhosphoserineCombined sources1
    Modified residuei371PhosphoserineCombined sources1
    Modified residuei467PhosphoserineBy similarity1

    Post-translational modificationi

    Phosphorylated.1 Publication
    The N-terminus is blocked.By similarity

    Keywords - PTMi

    Acetylation, Phosphoprotein

    Proteomic databases

    EPDiQ13228
    PaxDbiQ13228
    PeptideAtlasiQ13228
    PRIDEiQ13228

    2D gel databases

    REPRODUCTION-2DPAGEiIPI00012303
    Q13228
    UCD-2DPAGEiQ13228

    PTM databases

    iPTMnetiQ13228
    PhosphoSitePlusiQ13228
    SwissPalmiQ13228

    Expressioni

    Tissue specificityi

    Widely expressed. Highly expressed in liver, lung, colon, prostate, kidney and pancreas. In brain, present both in neurons and glia (at protein level). Down-regulated in lung adenocarcinoma, colorectal carcinoma and ovarian cancer. Two-fold up-regulated in brain and blood from schizophrenia patients.6 Publications

    Inductioni

    Down-regulated by androgen in prostate cancer cells.1 Publication

    Gene expression databases

    BgeeiENSG00000143416
    CleanExiHS_SELENBP1
    ExpressionAtlasiQ13228 baseline and differential
    GenevisibleiQ13228 HS

    Organism-specific databases

    HPAiCAB008366
    HPA005741
    HPA011731

    Interactioni

    Subunit structurei

    Interacts with USP33.1 Publication

    Binary interactionsi

    Show more details

    Protein-protein interaction databases

    BioGridi11447278 interactors.
    CORUMiQ13228
    IntActiQ13228 12 interactors.
    MINTiQ13228
    STRINGi9606.ENSP00000357861

    Structurei

    3D structure databases

    ProteinModelPortaliQ13228
    SMRiQ13228
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the selenium-binding protein family.Curated

    Phylogenomic databases

    eggNOGiKOG0918 Eukaryota
    ENOG410XP4F LUCA
    GeneTreeiENSGT00390000014244
    HOGENOMiHOG000263885
    HOVERGENiHBG017779
    InParanoidiQ13228
    KOiK17285
    OMAiHVWDWQR
    OrthoDBiEOG091G061L
    PhylomeDBiQ13228
    TreeFamiTF315241

    Family and domain databases

    InterProiView protein in InterPro
    IPR008826 Se-bd
    PANTHERiPTHR23300 PTHR23300, 1 hit
    PfamiView protein in Pfam
    PF05694 SBP56, 1 hit

    Sequences (4)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

    Isoform 1 (identifier: Q13228-1) [UniParc]FASTAAdd to basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

            10         20         30         40         50
    MATKCGNCGP GYSTPLEAMK GPREEIVYLP CIYRNTGTEA PDYLATVDVD
    60 70 80 90 100
    PKSPQYCQVI HRLPMPNLKD ELHHSGWNTC SSCFGDSTKS RTKLVLPSLI
    110 120 130 140 150
    SSRIYVVDVG SEPRAPKLHK VIEPKDIHAK CELAFLHTSH CLASGEVMIS
    160 170 180 190 200
    SLGDVKGNGK GGFVLLDGET FEVKGTWERP GGAAPLGYDF WYQPRHNVMI
    210 220 230 240 250
    STEWAAPNVL RDGFNPADVE AGLYGSHLYV WDWQRHEIVQ TLSLKDGLIP
    260 270 280 290 300
    LEIRFLHNPD AAQGFVGCAL SSTIQRFYKN EGGTWSVEKV IQVPPKKVKG
    310 320 330 340 350
    WLLPEMPGLI TDILLSLDDR FLYFSNWLHG DLRQYDISDP QRPRLTGQLF
    360 370 380 390 400
    LGGSIVKGGP VQVLEDEELK SQPEPLVVKG KRVAGGPQMI QLSLDGKRLY
    410 420 430 440 450
    ITTSLYSAWD KQFYPDLIRE GSVMLQVDVD TVKGGLKLNP NFLVDFGKEP
    460 470
    LGPALAHELR YPGGDCSSDI WI
    Length:472
    Mass (Da):52,391
    Last modified:May 29, 2007 - v2
    Checksum:i6DC68F9B45FEC1BC
    GO
    Isoform 2 (identifier: Q13228-2) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-64: Missing.

    Show »
    Length:408
    Mass (Da):45,349
    Checksum:i7765636B7CE8ACA7
    GO
    Isoform 3 (identifier: Q13228-3) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         59-120: Missing.

    Show »
    Length:410
    Mass (Da):45,469
    Checksum:i966714583DDE49F3
    GO
    Isoform 4 (identifier: Q13228-4) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MRLEWGPRPAALPWPAGMCAAERAEGAFTLQSVAQPMRPIAST

    Show »
    Length:514
    Mass (Da):56,866
    Checksum:iB0D47E495DD73E67
    GO

    Experimental Info

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    Sequence conflicti80C → Y in AAB02395 (PubMed:9027582).Curated1
    Sequence conflicti92T → N in AAB02395 (PubMed:9027582).Curated1
    Sequence conflicti114 – 116RAP → GPQ in AAB02395 (PubMed:9027582).Curated3
    Sequence conflicti135F → C in AAB02395 (PubMed:9027582).Curated1
    Sequence conflicti260 – 262DAA → SAT in AAB02395 (PubMed:9027582).Curated3
    Sequence conflicti270 – 273LSST → SAPN in AAB02395 (PubMed:9027582).Curated4
    Sequence conflicti278Y → C in BAG59258 (PubMed:14702039).Curated1
    Sequence conflicti280 – 282NEG → TRE in AAB02395 (PubMed:9027582).Curated3
    Sequence conflicti305 – 306EM → GV in AAB02395 (PubMed:9027582).Curated2
    Sequence conflicti410D → E in AAB02395 (PubMed:9027582).Curated1
    Sequence conflicti442F → C in AAB02395 (PubMed:9027582).Curated1

    Natural variant

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    Natural variantiVAR_080207225G → W Probable disease-associated mutation found in a family with extraoral halitosis; loss of methanethiol oxidation in patient cells. 1 Publication1
    Natural variantiVAR_080208329H → Y Probable disease-associated mutation found in a family with extraoral halitosis; loss of methanethiol oxidation in patient cells. 1 Publication1
    Natural variantiVAR_080209347 – 472Missing Probable disease-associated mutation found in a family with extraoral halitosis; loss of methanethiol oxidation in patient cells. 1 PublicationAdd BLAST126

    Alternative sequence

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    Alternative sequenceiVSP_0384401 – 64Missing in isoform 2. 1 PublicationAdd BLAST64
    Alternative sequenceiVSP_0551261M → MRLEWGPRPAALPWPAGMCA AERAEGAFTLQSVAQPMRPI AST in isoform 4. 1 Publication1
    Alternative sequenceiVSP_04542559 – 120Missing in isoform 3. 1 PublicationAdd BLAST62

    Sequence databases

    Select the link destinations:
    EMBLi
    GenBanki
    DDBJi
    Links Updated
    U29091 mRNA Translation: AAB02395.1
    CR456852 mRNA Translation: CAG33133.1
    AK296661 mRNA Translation: BAG59258.1
    AK303815 mRNA Translation: BAG64765.1
    AK315643 mRNA Translation: BAG38010.1
    AL391069 Genomic DNA No translation available.
    CH471121 Genomic DNA Translation: EAW53443.1
    CH471121 Genomic DNA Translation: EAW53445.1
    BC009084 mRNA Translation: AAH09084.1
    BC032997 mRNA Translation: AAH32997.1
    CCDSiCCDS58027.1 [Q13228-3]
    CCDS60266.1 [Q13228-4]
    CCDS995.1 [Q13228-1]
    PIRiG01872
    RefSeqiNP_001245217.1, NM_001258288.1 [Q13228-3]
    NP_001245218.1, NM_001258289.1 [Q13228-4]
    NP_003935.2, NM_003944.3 [Q13228-1]
    UniGeneiHs.632460

    Genome annotation databases

    EnsembliENST00000368868; ENSP00000357861; ENSG00000143416 [Q13228-1]
    ENST00000426705; ENSP00000397261; ENSG00000143416 [Q13228-4]
    ENST00000447402; ENSP00000413960; ENSG00000143416 [Q13228-3]
    GeneIDi8991
    KEGGihsa:8991
    UCSCiuc010pcy.4 human [Q13228-1]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Similar proteinsi

    Entry informationi

    Entry nameiSBP1_HUMAN
    AccessioniPrimary (citable) accession number: Q13228
    Secondary accession number(s): A6NML9
    , A6PVW9, B2RDR3, B4DKP6, B4E1F3, Q49AQ8, Q96GX7
    Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 15, 1999
    Last sequence update: May 29, 2007
    Last modified: April 25, 2018
    This is version 152 of the entry and version 2 of the sequence. See complete history.
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Direct protein sequencing, Reference proteome