SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q13228

- SBP1_HUMAN

UniProt

Q13228 - SBP1_HUMAN

Protein

Selenium-binding protein 1

Gene

SELENBP1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 120 (01 Oct 2014)
      Sequence version 2 (29 May 2007)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Selenium-binding protein which may be involved in the sensing of reactive xenobiotics in the cytoplasm. May be involved in intra-Golgi protein transport By similarity.By similarity

    GO - Molecular functioni

    1. protein binding Source: IntAct
    2. selenium binding Source: ProtInc

    GO - Biological processi

    1. protein transport Source: UniProtKB-KW

    Keywords - Biological processi

    Protein transport, Transport

    Keywords - Ligandi

    Selenium

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Selenium-binding protein 1
    Alternative name(s):
    56 kDa selenium-binding protein
    Short name:
    SBP56
    Short name:
    SP56
    Gene namesi
    Name:SELENBP1
    Synonyms:SBP
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

    Organism-specific databases

    HGNCiHGNC:10719. SELENBP1.

    Subcellular locationi

    Nucleus. Cytoplasmcytosol. Membrane By similarity; Peripheral membrane protein By similarity
    Note: May associate with Golgi membrane. May associate with the membrane of autophagosomes By similarity.By similarity

    GO - Cellular componenti

    1. cytosol Source: UniProtKB-SubCell
    2. extracellular space Source: UniProt
    3. extracellular vesicular exosome Source: UniProt
    4. membrane Source: UniProtKB-SubCell
    5. nucleus Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Cytoplasm, Membrane, Nucleus

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA35641.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Initiator methioninei1 – 11Removed1 Publication
    Chaini2 – 472471Selenium-binding protein 1PRO_0000174633Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei2 – 21N-acetylalanine1 Publication
    Modified residuei467 – 4671PhosphoserineBy similarity

    Post-translational modificationi

    Phosphorylated.1 Publication
    The N-terminus is blocked.By similarity

    Keywords - PTMi

    Acetylation, Phosphoprotein

    Proteomic databases

    MaxQBiQ13228.
    PaxDbiQ13228.
    PRIDEiQ13228.

    2D gel databases

    REPRODUCTION-2DPAGEIPI00012303.
    Q13228.
    UCD-2DPAGEQ13228.

    Expressioni

    Tissue specificityi

    Highly expressed in liver, lung, colon, prostate, kidney and pancreas. In brain, present both in neurons and glia (at protein level). Down-regulated in lung adenocarcinoma, colorectal carcinoma and ovarian cancer. Two-fold up-regulated in brain and blood from schizophrenia patients.5 Publications

    Inductioni

    Down-regulated by androgen in prostate cancer cells.1 Publication

    Gene expression databases

    ArrayExpressiQ13228.
    BgeeiQ13228.
    CleanExiHS_SELENBP1.
    GenevestigatoriQ13228.

    Organism-specific databases

    HPAiCAB008366.
    HPA005741.
    HPA011731.

    Interactioni

    Subunit structurei

    Interacts with USP33.1 Publication

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    USP33Q8TEY7-25EBI-711619,EBI-719307

    Protein-protein interaction databases

    BioGridi114472. 26 interactions.
    IntActiQ13228. 11 interactions.
    MINTiMINT-5005535.
    STRINGi9606.ENSP00000357861.

    Structurei

    3D structure databases

    ProteinModelPortaliQ13228.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the selenium-binding protein family.Curated

    Phylogenomic databases

    eggNOGiNOG84363.
    HOGENOMiHOG000263885.
    HOVERGENiHBG017779.
    InParanoidiQ13228.
    KOiK17285.
    OrthoDBiEOG76DTS8.
    PhylomeDBiQ13228.
    TreeFamiTF315241.

    Family and domain databases

    Gene3Di2.130.10.10. 2 hits.
    InterProiIPR008826. Se-bd.
    IPR015943. WD40/YVTN_repeat-like_dom.
    [Graphical view]
    PANTHERiPTHR23300. PTHR23300. 1 hit.
    PfamiPF05694. SBP56. 1 hit.
    [Graphical view]
    ProtoNetiSearch...

    Sequences (4)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 4 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q13228-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MATKCGNCGP GYSTPLEAMK GPREEIVYLP CIYRNTGTEA PDYLATVDVD    50
    PKSPQYCQVI HRLPMPNLKD ELHHSGWNTC SSCFGDSTKS RTKLVLPSLI 100
    SSRIYVVDVG SEPRAPKLHK VIEPKDIHAK CELAFLHTSH CLASGEVMIS 150
    SLGDVKGNGK GGFVLLDGET FEVKGTWERP GGAAPLGYDF WYQPRHNVMI 200
    STEWAAPNVL RDGFNPADVE AGLYGSHLYV WDWQRHEIVQ TLSLKDGLIP 250
    LEIRFLHNPD AAQGFVGCAL SSTIQRFYKN EGGTWSVEKV IQVPPKKVKG 300
    WLLPEMPGLI TDILLSLDDR FLYFSNWLHG DLRQYDISDP QRPRLTGQLF 350
    LGGSIVKGGP VQVLEDEELK SQPEPLVVKG KRVAGGPQMI QLSLDGKRLY 400
    ITTSLYSAWD KQFYPDLIRE GSVMLQVDVD TVKGGLKLNP NFLVDFGKEP 450
    LGPALAHELR YPGGDCSSDI WI 472
    Length:472
    Mass (Da):52,391
    Last modified:May 29, 2007 - v2
    Checksum:i6DC68F9B45FEC1BC
    GO
    Isoform 2 (identifier: Q13228-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-64: Missing.

    Show »
    Length:408
    Mass (Da):45,349
    Checksum:i7765636B7CE8ACA7
    GO
    Isoform 3 (identifier: Q13228-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         59-120: Missing.

    Show »
    Length:410
    Mass (Da):45,469
    Checksum:i966714583DDE49F3
    GO
    Isoform 4 (identifier: Q13228-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MRLEWGPRPAALPWPAGMCAAERAEGAFTLQSVAQPMRPIAST

    Show »
    Length:514
    Mass (Da):56,866
    Checksum:iB0D47E495DD73E67
    GO

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 6464Missing in isoform 2. 1 PublicationVSP_038440Add
    BLAST
    Alternative sequencei1 – 11M → MRLEWGPRPAALPWPAGMCA AERAEGAFTLQSVAQPMRPI AST in isoform 4. 1 PublicationVSP_055126
    Alternative sequencei59 – 12062Missing in isoform 3. 1 PublicationVSP_045425Add
    BLAST

    Sequence conflict

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti80 – 801C → Y in AAB02395. (PubMed:9027582)Curated
    Sequence conflicti92 – 921T → N in AAB02395. (PubMed:9027582)Curated
    Sequence conflicti114 – 1163RAP → GPQ in AAB02395. (PubMed:9027582)Curated
    Sequence conflicti135 – 1351F → C in AAB02395. (PubMed:9027582)Curated
    Sequence conflicti260 – 2623DAA → SAT in AAB02395. (PubMed:9027582)Curated
    Sequence conflicti270 – 2734LSST → SAPN in AAB02395. (PubMed:9027582)Curated
    Sequence conflicti278 – 2781Y → C in BAG59258. (PubMed:14702039)Curated
    Sequence conflicti280 – 2823NEG → TRE in AAB02395. (PubMed:9027582)Curated
    Sequence conflicti305 – 3062EM → GV in AAB02395. (PubMed:9027582)Curated
    Sequence conflicti410 – 4101D → E in AAB02395. (PubMed:9027582)Curated
    Sequence conflicti442 – 4421F → C in AAB02395. (PubMed:9027582)Curated

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U29091 mRNA. Translation: AAB02395.1.
    CR456852 mRNA. Translation: CAG33133.1.
    AK296661 mRNA. Translation: BAG59258.1.
    AK303815 mRNA. Translation: BAG64765.1.
    AK315643 mRNA. Translation: BAG38010.1.
    AL391069 Genomic DNA. Translation: CAH70328.1.
    CH471121 Genomic DNA. Translation: EAW53443.1.
    CH471121 Genomic DNA. Translation: EAW53445.1.
    BC009084 mRNA. Translation: AAH09084.1.
    BC032997 mRNA. Translation: AAH32997.1.
    CCDSiCCDS58027.1. [Q13228-3]
    CCDS60266.1. [Q13228-4]
    CCDS995.1. [Q13228-1]
    PIRiG01872.
    RefSeqiNP_001245217.1. NM_001258288.1. [Q13228-3]
    NP_001245218.1. NM_001258289.1.
    NP_003935.2. NM_003944.3. [Q13228-1]
    UniGeneiHs.632460.

    Genome annotation databases

    EnsembliENST00000368868; ENSP00000357861; ENSG00000143416. [Q13228-1]
    ENST00000426705; ENSP00000397261; ENSG00000143416. [Q13228-4]
    ENST00000447402; ENSP00000413960; ENSG00000143416. [Q13228-3]
    GeneIDi8991.
    KEGGihsa:8991.
    UCSCiuc001exx.4. human. [Q13228-1]

    Polymorphism databases

    DMDMi148840437.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U29091 mRNA. Translation: AAB02395.1 .
    CR456852 mRNA. Translation: CAG33133.1 .
    AK296661 mRNA. Translation: BAG59258.1 .
    AK303815 mRNA. Translation: BAG64765.1 .
    AK315643 mRNA. Translation: BAG38010.1 .
    AL391069 Genomic DNA. Translation: CAH70328.1 .
    CH471121 Genomic DNA. Translation: EAW53443.1 .
    CH471121 Genomic DNA. Translation: EAW53445.1 .
    BC009084 mRNA. Translation: AAH09084.1 .
    BC032997 mRNA. Translation: AAH32997.1 .
    CCDSi CCDS58027.1. [Q13228-3 ]
    CCDS60266.1. [Q13228-4 ]
    CCDS995.1. [Q13228-1 ]
    PIRi G01872.
    RefSeqi NP_001245217.1. NM_001258288.1. [Q13228-3 ]
    NP_001245218.1. NM_001258289.1.
    NP_003935.2. NM_003944.3. [Q13228-1 ]
    UniGenei Hs.632460.

    3D structure databases

    ProteinModelPortali Q13228.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 114472. 26 interactions.
    IntActi Q13228. 11 interactions.
    MINTi MINT-5005535.
    STRINGi 9606.ENSP00000357861.

    Polymorphism databases

    DMDMi 148840437.

    2D gel databases

    REPRODUCTION-2DPAGE IPI00012303.
    Q13228.
    UCD-2DPAGE Q13228.

    Proteomic databases

    MaxQBi Q13228.
    PaxDbi Q13228.
    PRIDEi Q13228.

    Protocols and materials databases

    DNASUi 8991.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000368868 ; ENSP00000357861 ; ENSG00000143416 . [Q13228-1 ]
    ENST00000426705 ; ENSP00000397261 ; ENSG00000143416 . [Q13228-4 ]
    ENST00000447402 ; ENSP00000413960 ; ENSG00000143416 . [Q13228-3 ]
    GeneIDi 8991.
    KEGGi hsa:8991.
    UCSCi uc001exx.4. human. [Q13228-1 ]

    Organism-specific databases

    CTDi 8991.
    GeneCardsi GC01M151339.
    HGNCi HGNC:10719. SELENBP1.
    HPAi CAB008366.
    HPA005741.
    HPA011731.
    MIMi 604188. gene.
    neXtProti NX_Q13228.
    PharmGKBi PA35641.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG84363.
    HOGENOMi HOG000263885.
    HOVERGENi HBG017779.
    InParanoidi Q13228.
    KOi K17285.
    OrthoDBi EOG76DTS8.
    PhylomeDBi Q13228.
    TreeFami TF315241.

    Miscellaneous databases

    ChiTaRSi SELENBP1. human.
    GeneWikii SELENBP1.
    GenomeRNAii 8991.
    NextBioi 33715.
    PROi Q13228.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q13228.
    Bgeei Q13228.
    CleanExi HS_SELENBP1.
    Genevestigatori Q13228.

    Family and domain databases

    Gene3Di 2.130.10.10. 2 hits.
    InterProi IPR008826. Se-bd.
    IPR015943. WD40/YVTN_repeat-like_dom.
    [Graphical view ]
    PANTHERi PTHR23300. PTHR23300. 1 hit.
    Pfami PF05694. SBP56. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Isolation, characterization, and chromosomal mapping of a novel cDNA clone encoding human selenium binding protein."
      Chang P.W.G., Tsui S.K.W., Liew C., Lee C., Waye M.M.Y., Fung K.
      J. Cell. Biochem. 64:217-224(1997) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
      Tissue: Heart.
    2. "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)."
      Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
      Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 3 AND 4).
      Tissue: Colon, Lung and Synovial cell.
    4. "The DNA sequence and biological annotation of human chromosome 1."
      Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
      , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
      Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
      Tissue: Colon and Testis.
    7. Lubec G., Vishwanath V.
      Submitted (MAR-2007) to UniProtKB
      Cited for: PROTEIN SEQUENCE OF 255-276, IDENTIFICATION BY MASS SPECTROMETRY.
      Tissue: Brain and Cajal-Retzius cell.
    8. "Differential expression and androgen regulation of the human selenium-binding protein gene hSP56 in prostate cancer cells."
      Yang M., Sytkowski A.J.
      Cancer Res. 58:3150-3153(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: TISSUE SPECIFICITY, INDUCTION.
    9. "Reduced selenium-binding protein 1 expression is associated with poor outcome in lung adenocarcinomas."
      Chen G., Wang H., Miller C.T., Thomas D.G., Gharib T.G., Misek D.E., Giordano T.J., Orringer M.B., Hanash S.M., Beer D.G.
      J. Pathol. 202:321-329(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: TISSUE SPECIFICITY, SUBCELLULAR LOCATION, PHOSPHORYLATION, IDENTIFICATION BY MASS SPECTROMETRY.
    10. "Comparative gene expression analysis of blood and brain provides concurrent validation of SELENBP1 up-regulation in schizophrenia."
      Glatt S.J., Everall I.P., Kremen W.S., Corbeil J., Sasik R., Khanlou N., Han M., Liew C.-C., Tsuang M.T.
      Proc. Natl. Acad. Sci. U.S.A. 102:15533-15538(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: TISSUE SPECIFICITY, SUBCELLULAR LOCATION.
    11. Cited for: TISSUE SPECIFICITY, IDENTIFICATION BY MASS SPECTROMETRY.
    12. "Suppression of human selenium-binding protein 1 is a late event in colorectal carcinogenesis and is associated with poor survival."
      Kim H., Kang H.J., You K.T., Kim S.H., Lee K.Y., Kim T.I., Kim C., Song S.Y., Kim H.-J., Lee C., Kim H.
      Proteomics 6:3466-3476(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: TISSUE SPECIFICITY, IDENTIFICATION BY MASS SPECTROMETRY.
    13. "Human selenium binding protein-1 (hSP56) interacts with VDU1 in a selenium-dependent manner."
      Jeong J.Y., Wang Y., Sytkowski A.J.
      Biochem. Biophys. Res. Commun. 379:583-588(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH USP33.
    14. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    15. Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS], CLEAVAGE OF INITIATOR METHIONINE [LARGE SCALE ANALYSIS].

    Entry informationi

    Entry nameiSBP1_HUMAN
    AccessioniPrimary (citable) accession number: Q13228
    Secondary accession number(s): A6NML9
    , A6PVW9, B2RDR3, B4DKP6, B4E1F3, Q49AQ8, Q96GX7
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: July 15, 1999
    Last sequence update: May 29, 2007
    Last modified: October 1, 2014
    This is version 120 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Direct protein sequencing, Reference proteome

    Documents

    1. Human chromosome 1
      Human chromosome 1: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3

    Similar proteinsi