Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q13190

- STX5_HUMAN

UniProt

Q13190 - STX5_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Syntaxin-5

Gene

STX5

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Mediates endoplasmic reticulum to Golgi transport.By similarity

GO - Molecular functioni

  1. protein N-terminus binding Source: UniProtKB
  2. SNAP receptor activity Source: HGNC

GO - Biological processi

  1. ER to Golgi vesicle-mediated transport Source: Ensembl
  2. intracellular protein transport Source: InterPro
  3. retrograde transport, endosome to Golgi Source: HGNC
  4. vesicle fusion with Golgi apparatus Source: Ensembl
  5. vesicle targeting Source: ProtInc
Complete GO annotation...

Keywords - Biological processi

Transport

Names & Taxonomyi

Protein namesi
Recommended name:
Syntaxin-5
Gene namesi
Name:STX5
Synonyms:STX5A
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 11

Organism-specific databases

HGNCiHGNC:11440. STX5.

Subcellular locationi

Endoplasmic reticulum-Golgi intermediate compartment membrane By similarity; Single-pass type IV membrane protein By similarity. Golgi apparatus membrane By similarity
Note: Localizes throughout the Golgi apparatus, but most abundant in the cis-most cisternae.By similarity

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 333333CytoplasmicSequence AnalysisAdd
BLAST
Transmembranei334 – 35421Helical; Anchor for type IV membrane proteinSequence AnalysisAdd
BLAST
Topological domaini355 – 3551VesicularSequence Analysis

GO - Cellular componenti

  1. endoplasmic reticulum Source: Ensembl
  2. Golgi apparatus Source: HGNC
  3. Golgi membrane Source: Ensembl
  4. integral component of membrane Source: UniProtKB-KW
  5. nucleus Source: HPA
  6. SNARE complex Source: HGNC
Complete GO annotation...

Keywords - Cellular componenti

Golgi apparatus, Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA36237.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 355355Syntaxin-5PRO_0000210205Add
BLAST

Proteomic databases

MaxQBiQ13190.
PaxDbiQ13190.
PRIDEiQ13190.

PTM databases

PhosphoSiteiQ13190.

Expressioni

Gene expression databases

BgeeiQ13190.
CleanExiHS_STX5.
ExpressionAtlasiQ13190. baseline.
GenevestigatoriQ13190.

Organism-specific databases

HPAiHPA001358.

Interactioni

Subunit structurei

Part of a ternary complex containing STX5A, NSFL1C and VCP. Identified in a unique SNARE complex composed of the Golgi SNAREs GOSR1, GOSR2, YKT6 and VTI1A (By similarity). Interacts with COG4.By similarity1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
COG4Q9H9E32EBI-714206,EBI-368382

Protein-protein interaction databases

BioGridi112680. 46 interactions.
DIPiDIP-56987N.
IntActiQ13190. 11 interactions.
MINTiMINT-1376120.
STRINGi9606.ENSP00000294179.

Structurei

Secondary structure

1
355
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi243 – 2464Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
3EFOX-ray2.70C242-248[»]
ProteinModelPortaliQ13190.
SMRiQ13190. Positions 263-354.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ13190.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini263 – 32563t-SNARE coiled-coil homologyPROSITE-ProRule annotationAdd
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili287 – 31832Sequence AnalysisAdd
BLAST

Sequence similaritiesi

Belongs to the syntaxin family.Curated
Contains 1 t-SNARE coiled-coil homology domain.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG326964.
GeneTreeiENSGT00390000000652.
HOGENOMiHOG000194860.
HOVERGENiHBG001973.
InParanoidiQ13190.
KOiK08490.
OMAiMEEAQTN.
PhylomeDBiQ13190.
TreeFamiTF315068.

Family and domain databases

InterProiIPR006012. Syntaxin/epimorphin_CS.
IPR006011. Syntaxin_N.
IPR010989. t-SNARE.
IPR000727. T_SNARE_dom.
[Graphical view]
PfamiPF05739. SNARE. 1 hit.
PF00804. Syntaxin. 1 hit.
[Graphical view]
SMARTiSM00397. t_SNARE. 1 hit.
[Graphical view]
SUPFAMiSSF47661. SSF47661. 1 hit.
PROSITEiPS00914. SYNTAXIN. 1 hit.
PS50192. T_SNARE. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing and alternative initiation. Align

Isoform 1 (identifier: Q13190-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MIPRKRYGSK NTDQGVYLGL SKTQVLSPAT AGSSSSDIAP LPPPVTLVPP
60 70 80 90 100
PPDTMSCRDR TQEFLSACKS LQTRQNGIQT NKPALRAVRQ RSEFTLMAKR
110 120 130 140 150
IGKDLSNTFA KLEKLTILAK RKSLFDDKAV EIEELTYIIK QDINSLNKQI
160 170 180 190 200
AQLQDFVRAK GSQSGRHLQT HSNTIVVSLQ SKLASMSNDF KSVLEVRTEN
210 220 230 240 250
LKQQRSRREQ FSRAPVSALP LAPNHLGGGA VVLGAESHAS KDVAIDMMDS
260 270 280 290 300
RTSQQLQLID EQDSYIQSRA DTMQNIESTI VELGSIFQQL AHMVKEQEET
310 320 330 340 350
IQRIDENVLG AQLDVEAAHS EILKYFQSVT SNRWLMVKIF LILIVFFIIF

VVFLA
Length:355
Mass (Da):39,673
Last modified:September 5, 2006 - v2
Checksum:iEE8616A226888501
GO
Isoform 2 (identifier: Q13190-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-54: Missing.

Note: Produced by alternative initiation at Met-55 of isoform 1.

Show »
Length:301
Mass (Da):34,086
Checksum:iC531C6BCCFA466B2
GO
Isoform 3 (identifier: Q13190-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-54: Missing.
     303-355: RIDENVLGAQLDVEAAHSEILKYFQSVTSNRWLMVKIFLILIVFFIIFVVFLA → SVLLFPLLPALSPGSTRTC

Note: Produced by alternative splicing and alternative initiation.

Show »
Length:267
Mass (Da):29,887
Checksum:iF9C4A7DAACB83BD7
GO
Isoform 4 (identifier: Q13190-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     303-355: RIDENVLGAQLDVEAAHSEILKYFQSVTSNRWLMVKIFLILIVFFIIFVVFLA → SVLLFPLLPALSPGSTRTC

Note: Gene prediction based on EST data.

Show »
Length:321
Mass (Da):35,474
Checksum:i846547400C331556
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti51 – 511P → L.
Corresponds to variant rs3802945 [ dbSNP | Ensembl ].
VAR_052248
Natural varianti72 – 721Q → H.
Corresponds to variant rs11231241 [ dbSNP | Ensembl ].
VAR_052249
Natural varianti79 – 791Q → H in a breast cancer sample; somatic mutation. 1 Publication
VAR_035642

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 5454Missing in isoform 2 and isoform 3. 4 PublicationsVSP_020119Add
BLAST
Alternative sequencei303 – 35553RIDEN…VVFLA → SVLLFPLLPALSPGSTRTC in isoform 3 and isoform 4. 1 PublicationVSP_020120Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U26648 mRNA. Translation: AAC71078.1.
BX537426 mRNA. Translation: CAD97668.1.
AK313497 mRNA. Translation: BAG36279.1.
BT019646 mRNA. Translation: AAV38452.1.
BT019647 mRNA. Translation: AAV38453.1.
AP001160 Genomic DNA. No translation available.
BC002645 mRNA. Translation: AAH02645.1.
BC012137 mRNA. Translation: AAH12137.2.
CCDSiCCDS58140.1. [Q13190-4]
CCDS8038.2. [Q13190-1]
PIRiG01817.
RefSeqiNP_001231595.1. NM_001244666.1. [Q13190-4]
NP_003155.2. NM_003164.4. [Q13190-1]
UniGeneiHs.654602.

Genome annotation databases

EnsembliENST00000294179; ENSP00000294179; ENSG00000162236. [Q13190-1]
ENST00000377897; ENSP00000367129; ENSG00000162236. [Q13190-4]
ENST00000394690; ENSP00000378182; ENSG00000162236. [Q13190-2]
GeneIDi6811.
KEGGihsa:6811.
UCSCiuc001nvh.3. human. [Q13190-1]

Polymorphism databases

DMDMi114152881.

Keywords - Coding sequence diversityi

Alternative initiation, Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U26648 mRNA. Translation: AAC71078.1 .
BX537426 mRNA. Translation: CAD97668.1 .
AK313497 mRNA. Translation: BAG36279.1 .
BT019646 mRNA. Translation: AAV38452.1 .
BT019647 mRNA. Translation: AAV38453.1 .
AP001160 Genomic DNA. No translation available.
BC002645 mRNA. Translation: AAH02645.1 .
BC012137 mRNA. Translation: AAH12137.2 .
CCDSi CCDS58140.1. [Q13190-4 ]
CCDS8038.2. [Q13190-1 ]
PIRi G01817.
RefSeqi NP_001231595.1. NM_001244666.1. [Q13190-4 ]
NP_003155.2. NM_003164.4. [Q13190-1 ]
UniGenei Hs.654602.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
3EFO X-ray 2.70 C 242-248 [» ]
ProteinModelPortali Q13190.
SMRi Q13190. Positions 263-354.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 112680. 46 interactions.
DIPi DIP-56987N.
IntActi Q13190. 11 interactions.
MINTi MINT-1376120.
STRINGi 9606.ENSP00000294179.

PTM databases

PhosphoSitei Q13190.

Polymorphism databases

DMDMi 114152881.

Proteomic databases

MaxQBi Q13190.
PaxDbi Q13190.
PRIDEi Q13190.

Protocols and materials databases

DNASUi 6811.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000294179 ; ENSP00000294179 ; ENSG00000162236 . [Q13190-1 ]
ENST00000377897 ; ENSP00000367129 ; ENSG00000162236 . [Q13190-4 ]
ENST00000394690 ; ENSP00000378182 ; ENSG00000162236 . [Q13190-2 ]
GeneIDi 6811.
KEGGi hsa:6811.
UCSCi uc001nvh.3. human. [Q13190-1 ]

Organism-specific databases

CTDi 6811.
GeneCardsi GC11M062574.
HGNCi HGNC:11440. STX5.
HPAi HPA001358.
MIMi 603189. gene.
neXtProti NX_Q13190.
PharmGKBi PA36237.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG326964.
GeneTreei ENSGT00390000000652.
HOGENOMi HOG000194860.
HOVERGENi HBG001973.
InParanoidi Q13190.
KOi K08490.
OMAi MEEAQTN.
PhylomeDBi Q13190.
TreeFami TF315068.

Miscellaneous databases

ChiTaRSi STX5. human.
EvolutionaryTracei Q13190.
GeneWikii STX5.
GenomeRNAii 6811.
NextBioi 26577.
PROi Q13190.
SOURCEi Search...

Gene expression databases

Bgeei Q13190.
CleanExi HS_STX5.
ExpressionAtlasi Q13190. baseline.
Genevestigatori Q13190.

Family and domain databases

InterProi IPR006012. Syntaxin/epimorphin_CS.
IPR006011. Syntaxin_N.
IPR010989. t-SNARE.
IPR000727. T_SNARE_dom.
[Graphical view ]
Pfami PF05739. SNARE. 1 hit.
PF00804. Syntaxin. 1 hit.
[Graphical view ]
SMARTi SM00397. t_SNARE. 1 hit.
[Graphical view ]
SUPFAMi SSF47661. SSF47661. 1 hit.
PROSITEi PS00914. SYNTAXIN. 1 hit.
PS50192. T_SNARE. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Cloning and identification of human syntaxin 5 as a synaptobrevin/VAMP binding protein."
    Ravichandran V., Roche P.A.
    J. Mol. Neurosci. 8:159-161(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
    Tissue: B-cell.
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Heart.
  3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Umbilical cord blood.
  4. "Cloning of human full-length CDSs in BD Creator(TM) system donor vector."
    Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A.
    Submitted (OCT-2004) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3).
    Tissue: Kidney and Uterus.
  7. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  8. "Direct interaction between the COG complex and the SM protein, Sly1, is required for Golgi SNARE pairing."
    Laufman O., Kedan A., Hong W., Lev S.
    EMBO J. 28:2006-2017(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH COG4.
  9. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  10. Cited for: VARIANT [LARGE SCALE ANALYSIS] HIS-79.

Entry informationi

Entry nameiSTX5_HUMAN
AccessioniPrimary (citable) accession number: Q13190
Secondary accession number(s): B2R8T2
, F8W8Q9, Q5U0D4, Q7Z3T6, Q9BUG1
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: September 5, 2006
Last modified: November 26, 2014
This is version 135 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3