Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q13190 (STX5_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 131. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (6) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Syntaxin-5
Gene names
Name:STX5
Synonyms:STX5A
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length355 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Mediates endoplasmic reticulum to Golgi transport By similarity.

Subunit structure

Part of a ternary complex containing STX5A, NSFL1C and VCP. Identified in a unique SNARE complex composed of the Golgi SNAREs GOSR1, GOSR2, YKT6 and VTI1A By similarity. Interacts with COG4. Ref.8

Subcellular location

Endoplasmic reticulum-Golgi intermediate compartment membrane; Single-pass type IV membrane protein By similarity. Golgi apparatus membrane By similarity. Note: Localizes throughout the Golgi apparatus, but most abundant in the cis-most cisternae By similarity.

Sequence similarities

Belongs to the syntaxin family.

Contains 1 t-SNARE coiled-coil homology domain.

Ontologies

Keywords
   Biological processTransport
   Cellular componentGolgi apparatus
Membrane
   Coding sequence diversityAlternative initiation
Alternative splicing
Polymorphism
   DomainCoiled coil
Transmembrane
Transmembrane helix
   Technical term3D-structure
Complete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processER to Golgi vesicle-mediated transport

Inferred from electronic annotation. Source: Ensembl

intracellular protein transport

Inferred from electronic annotation. Source: InterPro

retrograde transport, endosome to Golgi

Inferred from direct assay PubMed 15215310. Source: HGNC

vesicle fusion with Golgi apparatus

Inferred from electronic annotation. Source: Ensembl

vesicle targeting

Traceable author statement Ref.1. Source: ProtInc

   Cellular_componentGolgi apparatus

Inferred from direct assay PubMed 15215310. Source: HGNC

Golgi membrane

Inferred from electronic annotation. Source: UniProtKB-SubCell

SNARE complex

Traceable author statement PubMed 15215310. Source: HGNC

endoplasmic reticulum

Inferred from electronic annotation. Source: Ensembl

endoplasmic reticulum-Golgi intermediate compartment membrane

Inferred from electronic annotation. Source: UniProtKB-SubCell

integral component of membrane

Inferred from electronic annotation. Source: UniProtKB-KW

nucleus

Inferred from direct assay. Source: HPA

   Molecular_functionSNAP receptor activity

Inferred from direct assay PubMed 15215310. Source: HGNC

protein N-terminus binding

Inferred from physical interaction Ref.8. Source: UniProtKB

protein binding

Inferred from physical interaction Ref.8. Source: IntAct

Complete GO annotation...

Binary interactions

With

Entry

#Exp.

IntAct

Notes

COG4Q9H9E32EBI-714206,EBI-368382

Alternative products

This entry describes 4 isoforms produced by alternative splicing and alternative initiation. [Align] [Select]
Isoform 1 (identifier: Q13190-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q13190-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1-54: Missing.
Note: Produced by alternative initiation at Met-55 of isoform 1.
Isoform 3 (identifier: Q13190-3)

The sequence of this isoform differs from the canonical sequence as follows:
     1-54: Missing.
     303-355: RIDENVLGAQLDVEAAHSEILKYFQSVTSNRWLMVKIFLILIVFFIIFVVFLA → SVLLFPLLPALSPGSTRTC
Note: Produced by alternative splicing and alternative initiation.
Isoform 4 (identifier: Q13190-4)

The sequence of this isoform differs from the canonical sequence as follows:
     303-355: RIDENVLGAQLDVEAAHSEILKYFQSVTSNRWLMVKIFLILIVFFIIFVVFLA → SVLLFPLLPALSPGSTRTC
Note: Gene prediction based on EST data.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 355355Syntaxin-5
PRO_0000210205

Regions

Topological domain1 – 333333Cytoplasmic Potential
Transmembrane334 – 35421Helical; Anchor for type IV membrane protein; Potential
Topological domain3551Vesicular Potential
Domain263 – 32563t-SNARE coiled-coil homology
Coiled coil287 – 31832 Potential

Natural variations

Alternative sequence1 – 5454Missing in isoform 2 and isoform 3.
VSP_020119
Alternative sequence303 – 35553RIDEN…VVFLA → SVLLFPLLPALSPGSTRTC in isoform 3 and isoform 4.
VSP_020120
Natural variant511P → L.
Corresponds to variant rs3802945 [ dbSNP | Ensembl ].
VAR_052248
Natural variant721Q → H.
Corresponds to variant rs11231241 [ dbSNP | Ensembl ].
VAR_052249
Natural variant791Q → H in a breast cancer sample; somatic mutation. Ref.10
VAR_035642

Secondary structure

... 355
Helix Strand Turn

Details...

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified September 5, 2006. Version 2.
Checksum: EE8616A226888501

FASTA35539,673
        10         20         30         40         50         60 
MIPRKRYGSK NTDQGVYLGL SKTQVLSPAT AGSSSSDIAP LPPPVTLVPP PPDTMSCRDR 

        70         80         90        100        110        120 
TQEFLSACKS LQTRQNGIQT NKPALRAVRQ RSEFTLMAKR IGKDLSNTFA KLEKLTILAK 

       130        140        150        160        170        180 
RKSLFDDKAV EIEELTYIIK QDINSLNKQI AQLQDFVRAK GSQSGRHLQT HSNTIVVSLQ 

       190        200        210        220        230        240 
SKLASMSNDF KSVLEVRTEN LKQQRSRREQ FSRAPVSALP LAPNHLGGGA VVLGAESHAS 

       250        260        270        280        290        300 
KDVAIDMMDS RTSQQLQLID EQDSYIQSRA DTMQNIESTI VELGSIFQQL AHMVKEQEET 

       310        320        330        340        350 
IQRIDENVLG AQLDVEAAHS EILKYFQSVT SNRWLMVKIF LILIVFFIIF VVFLA 

« Hide

Isoform 2 [UniParc].

Checksum: C531C6BCCFA466B2
Show »

FASTA30134,086
Isoform 3 [UniParc].

Checksum: F9C4A7DAACB83BD7
Show »

FASTA26729,887
Isoform 4 [UniParc].

Checksum: 846547400C331556
Show »

FASTA32135,474

References

« Hide 'large scale' references
[1]"Cloning and identification of human syntaxin 5 as a synaptobrevin/VAMP binding protein."
Ravichandran V., Roche P.A.
J. Mol. Neurosci. 8:159-161(1997) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
Tissue: B-cell.
[2]"The full-ORF clone resource of the German cDNA consortium."
Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I.
BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Heart.
[3]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
Tissue: Umbilical cord blood.
[4]"Cloning of human full-length CDSs in BD Creator(TM) system donor vector."
Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A.
Submitted (OCT-2004) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
[5]"Human chromosome 11 DNA sequence and analysis including novel gene identification."
Taylor T.D., Noguchi H., Totoki Y., Toyoda A., Kuroki Y., Dewar K., Lloyd C., Itoh T., Takeda T., Kim D.-W., She X., Barlow K.F., Bloom T., Bruford E., Chang J.L., Cuomo C.A., Eichler E., FitzGerald M.G. expand/collapse author list , Jaffe D.B., LaButti K., Nicol R., Park H.-S., Seaman C., Sougnez C., Yang X., Zimmer A.R., Zody M.C., Birren B.W., Nusbaum C., Fujiyama A., Hattori M., Rogers J., Lander E.S., Sakaki Y.
Nature 440:497-500(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[6]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3).
Tissue: Kidney and Uterus.
[7]"A quantitative atlas of mitotic phosphorylation."
Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P.
Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[8]"Direct interaction between the COG complex and the SM protein, Sly1, is required for Golgi SNARE pairing."
Laufman O., Kedan A., Hong W., Lev S.
EMBO J. 28:2006-2017(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: INTERACTION WITH COG4.
[9]"Initial characterization of the human central proteome."
Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.
BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
[10]"The consensus coding sequences of human breast and colorectal cancers."
Sjoeblom T., Jones S., Wood L.D., Parsons D.W., Lin J., Barber T.D., Mandelker D., Leary R.J., Ptak J., Silliman N., Szabo S., Buckhaults P., Farrell C., Meeh P., Markowitz S.D., Willis J., Dawson D., Willson J.K.V. expand/collapse author list , Gazdar A.F., Hartigan J., Wu L., Liu C., Parmigiani G., Park B.H., Bachman K.E., Papadopoulos N., Vogelstein B., Kinzler K.W., Velculescu V.E.
Science 314:268-274(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: VARIANT [LARGE SCALE ANALYSIS] HIS-79.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
U26648 mRNA. Translation: AAC71078.1.
BX537426 mRNA. Translation: CAD97668.1.
AK313497 mRNA. Translation: BAG36279.1.
BT019646 mRNA. Translation: AAV38452.1.
BT019647 mRNA. Translation: AAV38453.1.
AP001160 Genomic DNA. No translation available.
BC002645 mRNA. Translation: AAH02645.1.
BC012137 mRNA. Translation: AAH12137.2.
CCDSCCDS8038.2. [Q13190-1]
PIRG01817.
RefSeqNP_001231595.1. NM_001244666.1. [Q13190-4]
NP_003155.2. NM_003164.4. [Q13190-1]
UniGeneHs.654602.

3D structure databases

PDBe
RCSB-PDB
PDBj
EntryMethodResolution (Å)ChainPositionsPDBsum
3EFOX-ray2.70C242-248[»]
ProteinModelPortalQ13190.
SMRQ13190. Positions 263-354.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid112680. 28 interactions.
IntActQ13190. 11 interactions.
MINTMINT-1376120.
STRING9606.ENSP00000294179.

PTM databases

PhosphoSiteQ13190.

Polymorphism databases

DMDM114152881.

Proteomic databases

MaxQBQ13190.
PaxDbQ13190.
PRIDEQ13190.

Protocols and materials databases

DNASU6811.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000294179; ENSP00000294179; ENSG00000162236. [Q13190-1]
ENST00000377897; ENSP00000367129; ENSG00000162236.
ENST00000394690; ENSP00000378182; ENSG00000162236. [Q13190-2]
GeneID6811.
KEGGhsa:6811.
UCSCuc001nvh.3. human. [Q13190-1]

Organism-specific databases

CTD6811.
GeneCardsGC11M062574.
HGNCHGNC:11440. STX5.
HPAHPA001358.
MIM603189. gene.
neXtProtNX_Q13190.
PharmGKBPA36237.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG326964.
HOGENOMHOG000194860.
HOVERGENHBG001973.
InParanoidQ13190.
KOK08490.
OMAMEEAQTN.
PhylomeDBQ13190.
TreeFamTF315068.

Gene expression databases

ArrayExpressQ13190.
BgeeQ13190.
CleanExHS_STX5.
GenevestigatorQ13190.

Family and domain databases

InterProIPR006012. Syntaxin/epimorphin_CS.
IPR006011. Syntaxin_N.
IPR010989. t-SNARE.
IPR000727. T_SNARE_dom.
[Graphical view]
PfamPF05739. SNARE. 1 hit.
PF00804. Syntaxin. 1 hit.
[Graphical view]
SMARTSM00397. t_SNARE. 1 hit.
[Graphical view]
SUPFAMSSF47661. SSF47661. 1 hit.
PROSITEPS00914. SYNTAXIN. 1 hit.
PS50192. T_SNARE. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

EvolutionaryTraceQ13190.
GeneWikiSTX5.
GenomeRNAi6811.
NextBio26577.
PROQ13190.
SOURCESearch...

Entry information

Entry nameSTX5_HUMAN
AccessionPrimary (citable) accession number: Q13190
Secondary accession number(s): B2R8T2 expand/collapse secondary AC list , F8W8Q9, Q5U0D4, Q7Z3T6, Q9BUG1
Entry history
Integrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: September 5, 2006
Last modified: July 9, 2014
This is version 131 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

PDB cross-references

Index of Protein Data Bank (PDB) cross-references

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 11

Human chromosome 11: entries, gene names and cross-references to MIM