Q13190 (STX5_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 121.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Syntaxin-5 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 355 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Mediates endoplasmic reticulum to Golgi transport By similarity. |
| Subunit structure | Part of a ternary complex containing STX5A, NSFL1C and VCP. Identified in a unique SNARE complex composed of the Golgi SNAREs GOSR1, GOSR2, YKT6 and VTI1A By similarity. Interacts with COG4. Ref.7 |
| Subcellular location | Endoplasmic reticulum-Golgi intermediate compartment membrane; Single-pass type IV membrane protein By similarity. Golgi apparatus membrane; Single-pass type IV membrane protein By similarity. |
| Sequence similarities | Belongs to the syntaxin family. Contains 1 t-SNARE coiled-coil homology domain. |
Ontologies
Alternative products
| This entry describes 3 isoforms produced by alternative splicing and alternative initiation. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q13190-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q13190-2) The sequence of this isoform differs from the canonical sequence as follows: 1-54: Missing. | ||||||
| Note: Produced by alternative initiation at Met-55 of isoform 1. | ||||||
| Isoform 3 (identifier: Q13190-3) The sequence of this isoform differs from the canonical sequence as follows: 1-54: Missing. 303-355: RIDENVLGAQLDVEAAHSEILKYFQSVTSNRWLMVKIFLILIVFFIIFVVFLA → SVLLFPLLPALSPGSTRTC | ||||||
| Note: Produced by alternative splicing and alternative initiation. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 355 | 355 | Syntaxin-5 | PRO_0000210205 | |||||||
Regions | |||||||||||
| Topological domain | 1 – 333 | 333 | Cytoplasmic Potential | ||||||||
| Transmembrane | 334 – 354 | 21 | Helical; Anchor for type IV membrane protein; Potential | ||||||||
| Topological domain | 355 | 1 | Vesicular Potential | ||||||||
| Domain | 263 – 325 | 63 | t-SNARE coiled-coil homology | ||||||||
| Coiled coil | 287 – 318 | 32 | Potential | ||||||||
Natural variations | |||||||||||
| Alternative sequence | 1 – 54 | 54 | Missing in isoform 2 and isoform 3. | VSP_020119 | |||||||
| Alternative sequence | 303 – 355 | 53 | RIDEN…VVFLA → SVLLFPLLPALSPGSTRTC in isoform 3. | VSP_020120 | |||||||
| Natural variant | 51 | 1 | P → L. Corresponds to variant rs3802945 [ dbSNP | Ensembl ]. | VAR_052248 | |||||||
| Natural variant | 72 | 1 | Q → H. Corresponds to variant rs11231241 [ dbSNP | Ensembl ]. | VAR_052249 | |||||||
| Natural variant | 79 | 1 | Q → H in a breast cancer sample; somatic mutation. Ref.9 | VAR_035642 | |||||||
Secondary structure | |||||||||||
Helix Strand Turn | |||||||||||
| Beta strand | 243 – 246 | 4 | |||||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Cloning and identification of human syntaxin 5 as a synaptobrevin/VAMP binding protein." Ravichandran V., Roche P.A. J. Mol. Neurosci. 8:159-161(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2). Tissue: B-cell. |
| [2] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Heart. |
| [3] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Umbilical cord blood. |
| [4] | "Cloning of human full-length CDSs in BD Creator(TM) system donor vector." Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A. Submitted (OCT-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3). Tissue: Kidney and Uterus. |
| [6] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. Tissue: Cervix carcinoma. |
| [7] | "Direct interaction between the COG complex and the SM protein, Sly1, is required for Golgi SNARE pairing." Laufman O., Kedan A., Hong W., Lev S. EMBO J. 28:2006-2017(2009) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH COG4. |
| [8] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [9] | "The consensus coding sequences of human breast and colorectal cancers." Sjoeblom T., Jones S., Wood L.D., Parsons D.W., Lin J., Barber T.D., Mandelker D., Leary R.J., Ptak J., Silliman N., Szabo S., Buckhaults P., Farrell C., Meeh P., Markowitz S.D., Willis J., Dawson D., Willson J.K.V. Velculescu V.E.Science 314:268-274(2006) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT [LARGE SCALE ANALYSIS] HIS-79. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | U26648 mRNA. Translation: AAC71078.1. BX537426 mRNA. Translation: CAD97668.1. AK313497 mRNA. Translation: BAG36279.1. BT019646 mRNA. Translation: AAV38452.1. BT019647 mRNA. Translation: AAV38453.1. BC002645 mRNA. Translation: AAH02645.1. BC012137 mRNA. Translation: AAH12137.2. | ||||||||||||
| IPI | IPI00386786. IPI00744834. IPI00784899. | ||||||||||||
| PIR | G01817. | ||||||||||||
| RefSeq | NP_001231595.1. NM_001244666.1. NP_003155.2. NM_003164.4. | ||||||||||||
| UniGene | Hs.654602. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | Q13190. | ||||||||||||
| SMR | Q13190. Positions 264-354. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| IntAct | Q13190. 10 interactions. | ||||||||||||
| MINT | MINT-1376120. | ||||||||||||
| STRING | 9606.ENSP00000294179. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | Q13190. | ||||||||||||
Polymorphism databases | |||||||||||||
| DMDM | 114152881. | ||||||||||||
Proteomic databases | |||||||||||||
| PaxDb | Q13190. | ||||||||||||
| PRIDE | Q13190. | ||||||||||||
Protocols and materials databases | |||||||||||||
| DNASU | 6811. | ||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENST00000294179; ENSP00000294179; ENSG00000162236. ENST00000394690; ENSP00000378182; ENSG00000162236. | ||||||||||||
| GeneID | 6811. | ||||||||||||
| KEGG | hsa:6811. | ||||||||||||
| UCSC | uc001nvh.3. human. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 6811. | ||||||||||||
| GeneCards | GC11M062574. | ||||||||||||
| HGNC | HGNC:11440. STX5. | ||||||||||||
| HPA | HPA001358. | ||||||||||||
| MIM | 603189. gene. | ||||||||||||
| neXtProt | NX_Q13190. | ||||||||||||
| PharmGKB | PA36237. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| eggNOG | NOG326964. | ||||||||||||
| HOGENOM | HOG000194860. | ||||||||||||
| HOVERGEN | HBG001973. | ||||||||||||
| InParanoid | Q13190. | ||||||||||||
| KO | K08490. | ||||||||||||
| OMA | AESHASK. | ||||||||||||
| OrthoDB | EOG4S7JQD. | ||||||||||||
Enzyme and pathway databases | |||||||||||||
| Reactome | REACT_116125. Disease. REACT_13685. Neuronal System. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | Q13190. | ||||||||||||
| Bgee | Q13190. | ||||||||||||
| CleanEx | HS_STX5. | ||||||||||||
| Genevestigator | Q13190. | ||||||||||||
| GermOnline | ENSG00000162236. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| InterPro | IPR006012. Syntaxin/epimorphin_CS. IPR006011. Syntaxin_N. IPR010989. t-SNARE. IPR000727. T_SNARE_dom. [Graphical view] | ||||||||||||
| Pfam | PF05739. SNARE. 1 hit. PF00804. Syntaxin. 1 hit. [Graphical view] | ||||||||||||
| SMART | SM00397. t_SNARE. 1 hit. [Graphical view] | ||||||||||||
| SUPFAM | SSF47661. t-snare. 1 hit. | ||||||||||||
| PROSITE | PS00914. SYNTAXIN. 1 hit. PS50192. T_SNARE. 1 hit. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| EvolutionaryTrace | Q13190. | ||||||||||||
| GenomeRNAi | 6811. | ||||||||||||
| NextBio | 26577. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | STX5_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q13190 Secondary accession number(s): B2R8T2 Q9BUG1 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 11 Human chromosome 11: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
