Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q13190

- STX5_HUMAN

UniProt

Q13190 - STX5_HUMAN

Protein

Syntaxin-5

Gene

STX5

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 133 (01 Oct 2014)
      Sequence version 2 (05 Sep 2006)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Mediates endoplasmic reticulum to Golgi transport.By similarity

    GO - Molecular functioni

    1. protein binding Source: IntAct
    2. protein N-terminus binding Source: UniProtKB
    3. SNAP receptor activity Source: HGNC

    GO - Biological processi

    1. ER to Golgi vesicle-mediated transport Source: Ensembl
    2. intracellular protein transport Source: InterPro
    3. retrograde transport, endosome to Golgi Source: HGNC
    4. vesicle fusion with Golgi apparatus Source: Ensembl
    5. vesicle targeting Source: ProtInc

    Keywords - Biological processi

    Transport

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Syntaxin-5
    Gene namesi
    Name:STX5
    Synonyms:STX5A
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 11

    Organism-specific databases

    HGNCiHGNC:11440. STX5.

    Subcellular locationi

    Endoplasmic reticulum-Golgi intermediate compartment membrane By similarity; Single-pass type IV membrane protein By similarity. Golgi apparatus membrane By similarity
    Note: Localizes throughout the Golgi apparatus, but most abundant in the cis-most cisternae.By similarity

    GO - Cellular componenti

    1. endoplasmic reticulum Source: Ensembl
    2. endoplasmic reticulum-Golgi intermediate compartment membrane Source: UniProtKB-SubCell
    3. Golgi apparatus Source: HGNC
    4. Golgi membrane Source: UniProtKB-SubCell
    5. integral component of membrane Source: UniProtKB-KW
    6. nucleus Source: HPA
    7. SNARE complex Source: HGNC

    Keywords - Cellular componenti

    Golgi apparatus, Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA36237.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 355355Syntaxin-5PRO_0000210205Add
    BLAST

    Proteomic databases

    MaxQBiQ13190.
    PaxDbiQ13190.
    PRIDEiQ13190.

    PTM databases

    PhosphoSiteiQ13190.

    Expressioni

    Gene expression databases

    ArrayExpressiQ13190.
    BgeeiQ13190.
    CleanExiHS_STX5.
    GenevestigatoriQ13190.

    Organism-specific databases

    HPAiHPA001358.

    Interactioni

    Subunit structurei

    Part of a ternary complex containing STX5A, NSFL1C and VCP. Identified in a unique SNARE complex composed of the Golgi SNAREs GOSR1, GOSR2, YKT6 and VTI1A By similarity. Interacts with COG4.By similarity1 Publication

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    COG4Q9H9E32EBI-714206,EBI-368382

    Protein-protein interaction databases

    BioGridi112680. 28 interactions.
    DIPiDIP-56987N.
    IntActiQ13190. 11 interactions.
    MINTiMINT-1376120.
    STRINGi9606.ENSP00000294179.

    Structurei

    Secondary structure

    1
    355
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Beta strandi243 – 2464

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    3EFOX-ray2.70C242-248[»]
    ProteinModelPortaliQ13190.
    SMRiQ13190. Positions 263-354.
    ModBaseiSearch...
    MobiDBiSearch...

    Miscellaneous databases

    EvolutionaryTraceiQ13190.

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini1 – 333333CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini355 – 3551VesicularSequence Analysis

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei334 – 35421Helical; Anchor for type IV membrane proteinSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini263 – 32563t-SNARE coiled-coil homologyPROSITE-ProRule annotationAdd
    BLAST

    Coiled coil

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Coiled coili287 – 31832Sequence AnalysisAdd
    BLAST

    Sequence similaritiesi

    Belongs to the syntaxin family.Curated
    Contains 1 t-SNARE coiled-coil homology domain.PROSITE-ProRule annotation

    Keywords - Domaini

    Coiled coil, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG326964.
    HOGENOMiHOG000194860.
    HOVERGENiHBG001973.
    InParanoidiQ13190.
    KOiK08490.
    OMAiMEEAQTN.
    PhylomeDBiQ13190.
    TreeFamiTF315068.

    Family and domain databases

    InterProiIPR006012. Syntaxin/epimorphin_CS.
    IPR006011. Syntaxin_N.
    IPR010989. t-SNARE.
    IPR000727. T_SNARE_dom.
    [Graphical view]
    PfamiPF05739. SNARE. 1 hit.
    PF00804. Syntaxin. 1 hit.
    [Graphical view]
    SMARTiSM00397. t_SNARE. 1 hit.
    [Graphical view]
    SUPFAMiSSF47661. SSF47661. 1 hit.
    PROSITEiPS00914. SYNTAXIN. 1 hit.
    PS50192. T_SNARE. 1 hit.
    [Graphical view]

    Sequences (4)i

    Sequence statusi: Complete.

    This entry describes 4 isoformsi produced by alternative splicing and alternative initiation. Align

    Isoform 1 (identifier: Q13190-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MIPRKRYGSK NTDQGVYLGL SKTQVLSPAT AGSSSSDIAP LPPPVTLVPP    50
    PPDTMSCRDR TQEFLSACKS LQTRQNGIQT NKPALRAVRQ RSEFTLMAKR 100
    IGKDLSNTFA KLEKLTILAK RKSLFDDKAV EIEELTYIIK QDINSLNKQI 150
    AQLQDFVRAK GSQSGRHLQT HSNTIVVSLQ SKLASMSNDF KSVLEVRTEN 200
    LKQQRSRREQ FSRAPVSALP LAPNHLGGGA VVLGAESHAS KDVAIDMMDS 250
    RTSQQLQLID EQDSYIQSRA DTMQNIESTI VELGSIFQQL AHMVKEQEET 300
    IQRIDENVLG AQLDVEAAHS EILKYFQSVT SNRWLMVKIF LILIVFFIIF 350
    VVFLA 355
    Length:355
    Mass (Da):39,673
    Last modified:September 5, 2006 - v2
    Checksum:iEE8616A226888501
    GO
    Isoform 2 (identifier: Q13190-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-54: Missing.

    Note: Produced by alternative initiation at Met-55 of isoform 1.

    Show »
    Length:301
    Mass (Da):34,086
    Checksum:iC531C6BCCFA466B2
    GO
    Isoform 3 (identifier: Q13190-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-54: Missing.
         303-355: RIDENVLGAQLDVEAAHSEILKYFQSVTSNRWLMVKIFLILIVFFIIFVVFLA → SVLLFPLLPALSPGSTRTC

    Note: Produced by alternative splicing and alternative initiation.

    Show »
    Length:267
    Mass (Da):29,887
    Checksum:iF9C4A7DAACB83BD7
    GO
    Isoform 4 (identifier: Q13190-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         303-355: RIDENVLGAQLDVEAAHSEILKYFQSVTSNRWLMVKIFLILIVFFIIFVVFLA → SVLLFPLLPALSPGSTRTC

    Note: Gene prediction based on EST data.

    Show »
    Length:321
    Mass (Da):35,474
    Checksum:i846547400C331556
    GO

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti51 – 511P → L.
    Corresponds to variant rs3802945 [ dbSNP | Ensembl ].
    VAR_052248
    Natural varianti72 – 721Q → H.
    Corresponds to variant rs11231241 [ dbSNP | Ensembl ].
    VAR_052249
    Natural varianti79 – 791Q → H in a breast cancer sample; somatic mutation. 1 Publication
    VAR_035642

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 5454Missing in isoform 2 and isoform 3. 4 PublicationsVSP_020119Add
    BLAST
    Alternative sequencei303 – 35553RIDEN…VVFLA → SVLLFPLLPALSPGSTRTC in isoform 3 and isoform 4. 1 PublicationVSP_020120Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U26648 mRNA. Translation: AAC71078.1.
    BX537426 mRNA. Translation: CAD97668.1.
    AK313497 mRNA. Translation: BAG36279.1.
    BT019646 mRNA. Translation: AAV38452.1.
    BT019647 mRNA. Translation: AAV38453.1.
    AP001160 Genomic DNA. No translation available.
    BC002645 mRNA. Translation: AAH02645.1.
    BC012137 mRNA. Translation: AAH12137.2.
    CCDSiCCDS58140.1. [Q13190-4]
    CCDS8038.2. [Q13190-1]
    PIRiG01817.
    RefSeqiNP_001231595.1. NM_001244666.1. [Q13190-4]
    NP_003155.2. NM_003164.4. [Q13190-1]
    UniGeneiHs.654602.

    Genome annotation databases

    EnsembliENST00000294179; ENSP00000294179; ENSG00000162236. [Q13190-1]
    ENST00000377897; ENSP00000367129; ENSG00000162236. [Q13190-4]
    ENST00000394690; ENSP00000378182; ENSG00000162236. [Q13190-2]
    GeneIDi6811.
    KEGGihsa:6811.
    UCSCiuc001nvh.3. human. [Q13190-1]

    Polymorphism databases

    DMDMi114152881.

    Keywords - Coding sequence diversityi

    Alternative initiation, Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U26648 mRNA. Translation: AAC71078.1 .
    BX537426 mRNA. Translation: CAD97668.1 .
    AK313497 mRNA. Translation: BAG36279.1 .
    BT019646 mRNA. Translation: AAV38452.1 .
    BT019647 mRNA. Translation: AAV38453.1 .
    AP001160 Genomic DNA. No translation available.
    BC002645 mRNA. Translation: AAH02645.1 .
    BC012137 mRNA. Translation: AAH12137.2 .
    CCDSi CCDS58140.1. [Q13190-4 ]
    CCDS8038.2. [Q13190-1 ]
    PIRi G01817.
    RefSeqi NP_001231595.1. NM_001244666.1. [Q13190-4 ]
    NP_003155.2. NM_003164.4. [Q13190-1 ]
    UniGenei Hs.654602.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    3EFO X-ray 2.70 C 242-248 [» ]
    ProteinModelPortali Q13190.
    SMRi Q13190. Positions 263-354.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 112680. 28 interactions.
    DIPi DIP-56987N.
    IntActi Q13190. 11 interactions.
    MINTi MINT-1376120.
    STRINGi 9606.ENSP00000294179.

    PTM databases

    PhosphoSitei Q13190.

    Polymorphism databases

    DMDMi 114152881.

    Proteomic databases

    MaxQBi Q13190.
    PaxDbi Q13190.
    PRIDEi Q13190.

    Protocols and materials databases

    DNASUi 6811.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000294179 ; ENSP00000294179 ; ENSG00000162236 . [Q13190-1 ]
    ENST00000377897 ; ENSP00000367129 ; ENSG00000162236 . [Q13190-4 ]
    ENST00000394690 ; ENSP00000378182 ; ENSG00000162236 . [Q13190-2 ]
    GeneIDi 6811.
    KEGGi hsa:6811.
    UCSCi uc001nvh.3. human. [Q13190-1 ]

    Organism-specific databases

    CTDi 6811.
    GeneCardsi GC11M062574.
    HGNCi HGNC:11440. STX5.
    HPAi HPA001358.
    MIMi 603189. gene.
    neXtProti NX_Q13190.
    PharmGKBi PA36237.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG326964.
    HOGENOMi HOG000194860.
    HOVERGENi HBG001973.
    InParanoidi Q13190.
    KOi K08490.
    OMAi MEEAQTN.
    PhylomeDBi Q13190.
    TreeFami TF315068.

    Miscellaneous databases

    EvolutionaryTracei Q13190.
    GeneWikii STX5.
    GenomeRNAii 6811.
    NextBioi 26577.
    PROi Q13190.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q13190.
    Bgeei Q13190.
    CleanExi HS_STX5.
    Genevestigatori Q13190.

    Family and domain databases

    InterProi IPR006012. Syntaxin/epimorphin_CS.
    IPR006011. Syntaxin_N.
    IPR010989. t-SNARE.
    IPR000727. T_SNARE_dom.
    [Graphical view ]
    Pfami PF05739. SNARE. 1 hit.
    PF00804. Syntaxin. 1 hit.
    [Graphical view ]
    SMARTi SM00397. t_SNARE. 1 hit.
    [Graphical view ]
    SUPFAMi SSF47661. SSF47661. 1 hit.
    PROSITEi PS00914. SYNTAXIN. 1 hit.
    PS50192. T_SNARE. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Cloning and identification of human syntaxin 5 as a synaptobrevin/VAMP binding protein."
      Ravichandran V., Roche P.A.
      J. Mol. Neurosci. 8:159-161(1997) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
      Tissue: B-cell.
    2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Heart.
    3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: Umbilical cord blood.
    4. "Cloning of human full-length CDSs in BD Creator(TM) system donor vector."
      Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A.
      Submitted (OCT-2004) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3).
      Tissue: Kidney and Uterus.
    7. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    8. "Direct interaction between the COG complex and the SM protein, Sly1, is required for Golgi SNARE pairing."
      Laufman O., Kedan A., Hong W., Lev S.
      EMBO J. 28:2006-2017(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH COG4.
    9. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    10. Cited for: VARIANT [LARGE SCALE ANALYSIS] HIS-79.

    Entry informationi

    Entry nameiSTX5_HUMAN
    AccessioniPrimary (citable) accession number: Q13190
    Secondary accession number(s): B2R8T2
    , F8W8Q9, Q5U0D4, Q7Z3T6, Q9BUG1
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: November 1, 1997
    Last sequence update: September 5, 2006
    Last modified: October 1, 2014
    This is version 133 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. Human chromosome 11
      Human chromosome 11: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    6. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3