Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q13183 (S13A2_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 116. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Solute carrier family 13 member 2
Alternative name(s):
Na(+)/dicarboxylate cotransporter 1
Short name=NaDC-1
Renal sodium/dicarboxylate cotransporter
Gene names
Name:SLC13A2
Synonyms:NADC1, SDCT1
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length592 AA.
Sequence statusComplete.
Protein existenceEvidence at transcript level

General annotation (Comments)

Function

Cotransport of sodium ions and dicarboxylates such as succinate and citrate.

Subcellular location

Membrane; Multi-pass membrane protein Potential.

Sequence similarities

Belongs to the SLC13A/DASS transporter (TC 2.A.47) family. NADC subfamily. [View classification]

Alternative products

This entry describes 3 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q13183-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q13183-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1-44: Missing.
     77-77: E → EIIQRPFPSSFESPGECQSVGMSVTASHNLGGTVGDSRVFPPLSHVSTCQ
Note: No experimental confirmation available.
Isoform 3 (identifier: Q13183-3)

The sequence of this isoform differs from the canonical sequence as follows:
     77-77: E → EIIQRPFPSSFESPGECQSVGMSVTASHNLGGTVGDSRVFPPLSHVSTCQ
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 592592Solute carrier family 13 member 2
PRO_0000172488

Regions

Transmembrane13 – 3321Helical; Potential
Transmembrane53 – 7321Helical; Potential
Transmembrane86 – 10621Helical; Potential
Transmembrane114 – 13421Helical; Potential
Transmembrane221 – 24121Helical; Potential
Transmembrane274 – 29421Helical; Potential
Transmembrane324 – 34421Helical; Potential
Transmembrane371 – 39121Helical; Potential
Transmembrane450 – 47021Helical; Potential
Transmembrane482 – 50221Helical; Potential
Transmembrane511 – 53121Helical; Potential
Transmembrane545 – 56521Helical; Potential

Natural variations

Alternative sequence1 – 4444Missing in isoform 2.
VSP_046426
Alternative sequence771E → EIIQRPFPSSFESPGECQSV GMSVTASHNLGGTVGDSRVF PPLSHVSTCQ in isoform 2 and isoform 3.
VSP_046427
Natural variant441L → F.
Corresponds to variant rs45443898 [ dbSNP | Ensembl ].
VAR_029254
Natural variant451M → L.
Corresponds to variant rs16964363 [ dbSNP | Ensembl ].
VAR_052000
Natural variant2541F → L.
Corresponds to variant rs11568461 [ dbSNP | Ensembl ].
VAR_029255
Natural variant3101A → P.
Corresponds to variant rs11568441 [ dbSNP | Ensembl ].
VAR_029256
Natural variant3851P → S.
Corresponds to variant rs45546232 [ dbSNP | Ensembl ].
VAR_020399
Natural variant4771V → M.
Corresponds to variant rs11568476 [ dbSNP | Ensembl ].
VAR_029257
Natural variant5501I → V. Ref.2 Ref.5
Corresponds to variant rs11567842 [ dbSNP | Ensembl ].
VAR_020400

Experimental info

Sequence conflict3071Q → R in BAG60623. Ref.2

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified November 1, 1996. Version 1.
Checksum: 41137D6621A0872A

FASTA59264,410
        10         20         30         40         50         60 
MATCWQALWA YRSYLIVFFV PILLLPLPIL VPSKEAYCAY AIILMALFWC TEALPLAVTA 

        70         80         90        100        110        120 
LFPLILFPMM GIVDASEVAV EYLKDSNLLF FGGLLVAIAV EHWNLHKRIA LRVLLIVGVR 

       130        140        150        160        170        180 
PAPLILGFML VTAFLSMWIS NTATSAMMVP IAHAVLDQLH SSQASSNVEE GSNNPTFELQ 

       190        200        210        220        230        240 
EPSPQKEVTK LDNGQALPVT SASSEGRAHL SQKHLHLTQC MSLCVCYSAS IGGIATLTGT 

       250        260        270        280        290        300 
APNLVLQGQI NSLFPQNGNV VNFASWFSFA FPTMVILLLL AWLWLQILFL GFNFRKNFGI 

       310        320        330        340        350        360 
GEKMQEQQQA AYCVIQTEHR LLGPMTFAEK AISILFVILV LLWFTREPGF FLGWGNLAFP 

       370        380        390        400        410        420 
NAKGESMVSD GTVAIFIGII MFIIPSKFPG LTQDPENPGK LKAPLGLLDW KTVNQKMPWN 

       430        440        450        460        470        480 
IVLLLGGGYA LAKGSERSGL SEWLGNKLTP LQSVPAPAIA IILSLLVATF TECTSNVATT 

       490        500        510        520        530        540 
TIFLPILASM AQAICLHPLY VMLPCTLATS LAFMLPVATP PNAIVFSFGD LKVLDMARAG 

       550        560        570        580        590 
FLLNIIGVLI IALAINSWGI PLFSLHSFPS WAQSNTTAQC LPSLANTTTP SP 

« Hide

Isoform 2 [UniParc].

Checksum: 51635628BF7A3AC3
Show »

FASTA59764,468
Isoform 3 [UniParc].

Checksum: FC95202C8D82D238
Show »

FASTA64169,525

References

« Hide 'large scale' references
[1]"Molecular cloning and functional expression of a sodium-dicarboxylate cotransporter from human kidney."
Pajor A.M.
Am. J. Physiol. 270:F642-F648(1996) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
Tissue: Kidney.
[2]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2), VARIANT VAL-550.
Tissue: Kidney.
[3]"DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage."
Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L. expand/collapse author list , Chen C.-K., Cook A., Corum B., Cuomo C.A., de Jong P.J., DeCaprio D., Dewar K., FitzGerald M., Gilbert J., Gibson R., Gnerre S., Goldstein S., Grafham D.V., Grocock R., Hafez N., Hagopian D.S., Hart E., Norman C.H., Humphray S., Jaffe D.B., Jones M., Kamal M., Khodiyar V.K., LaButti K., Laird G., Lehoczky J., Liu X., Lokyitsang T., Loveland J., Lui A., Macdonald P., Major J.E., Matthews L., Mauceli E., McCarroll S.A., Mihalev A.H., Mudge J., Nguyen C., Nicol R., O'Leary S.B., Osoegawa K., Schwartz D.C., Shaw-Smith C., Stankiewicz P., Steward C., Swarbreck D., Venkataraman V., Whittaker C.A., Yang X., Zimmer A.R., Bradley A., Hubbard T., Birren B.W., Rogers J., Lander E.S., Nusbaum C.
Nature 440:1045-1049(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[4]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
[5]"Associations between renal sodium-citrate cotransporter (hNaDC-1) gene polymorphism and urinary citrate excretion in recurrent renal calcium stone formers and normal controls."
Okamoto N., Aruga S., Matsuzaki S., Takahashi S., Matsushita K., Kitamura T.
Int. J. Urol. 14:344-349(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: VARIANT VAL-550.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
U26209 mRNA. Translation: AAA98504.1.
AK298388 mRNA. Translation: BAG60623.1.
AK314684 mRNA. Translation: BAG37236.1.
AC015917 Genomic DNA. No translation available.
BC096277 mRNA. Translation: AAH96277.1.
BC096278 mRNA. Translation: AAH96278.1.
BC096279 mRNA. Translation: AAH96279.1.
CCDSCCDS11231.1. [Q13183-1]
RefSeqNP_001139447.1. NM_001145975.1.
NP_003975.1. NM_003984.3. [Q13183-1]
UniGeneHs.102307.

3D structure databases

ProteinModelPortalQ13183.
SMRQ13183. Positions 42-301, 407-558.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

STRING9606.ENSP00000316202.

Chemistry

DrugBankDB00139. Succinic acid.

Protein family/group databases

TCDB2.A.47.1.17. the divalent anion:na(+) symporter (dass) family.

PTM databases

PhosphoSiteQ13183.

Polymorphism databases

DMDM2499523.

Proteomic databases

PaxDbQ13183.
PRIDEQ13183.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000314669; ENSP00000316202; ENSG00000007216. [Q13183-1]
ENST00000572344; ENSP00000458829; ENSG00000262654. [Q13183-1]
GeneID9058.
KEGGhsa:9058.
UCSCuc002hbh.3. human. [Q13183-1]

Organism-specific databases

CTD9058.
GeneCardsGC17P026800.
HGNCHGNC:10917. SLC13A2.
HPAHPA014963.
MIM604148. gene.
neXtProtNX_Q13183.
PharmGKBPA382.
GenAtlasSearch...

Phylogenomic databases

eggNOGCOG0471.
HOGENOMHOG000278432.
HOVERGENHBG055339.
InParanoidQ13183.
KOK14445.
PhylomeDBQ13183.
TreeFamTF312913.

Enzyme and pathway databases

ReactomeREACT_15518. Transmembrane transport of small molecules.
REACT_20633. Bile salt and organic anion SLC transporters.

Gene expression databases

ArrayExpressQ13183.
BgeeQ13183.
CleanExHS_SLC13A2.
GenevestigatorQ13183.

Family and domain databases

InterProIPR001898. Na/sul_symport.
[Graphical view]
PfamPF00939. Na_sulph_symp. 1 hit.
[Graphical view]
PROSITEPS01271. NA_SULFATE. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

GeneWikiSLC13A2.
GenomeRNAi9058.
NextBio33945.
PROQ13183.
SOURCESearch...

Entry information

Entry nameS13A2_HUMAN
AccessionPrimary (citable) accession number: Q13183
Secondary accession number(s): B2RBI9 expand/collapse secondary AC list , B4DPL1, E7ETH5, Q4VAR7
Entry history
Integrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: November 1, 1996
Last modified: July 9, 2014
This is version 116 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 17

Human chromosome 17: entries, gene names and cross-references to MIM