Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q13183

- S13A2_HUMAN

UniProt

Q13183 - S13A2_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Solute carrier family 13 member 2

Gene

SLC13A2

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at transcript leveli

Functioni

Cotransport of sodium ions and dicarboxylates such as succinate and citrate.

GO - Molecular functioni

  1. low-affinity sodium:dicarboxylate symporter activity Source: ProtInc

GO - Biological processi

  1. dicarboxylic acid transport Source: GOC
  2. transmembrane transport Source: Reactome
  3. transport Source: ProtInc
Complete GO annotation...

Keywords - Biological processi

Ion transport, Sodium transport, Symport, Transport

Keywords - Ligandi

Sodium

Enzyme and pathway databases

ReactomeiREACT_20646. Sodium-coupled sulphate, di- and tri-carboxylate transporters.

Protein family/group databases

TCDBi2.A.47.1.17. the divalent anion:na(+) symporter (dass) family.

Names & Taxonomyi

Protein namesi
Recommended name:
Solute carrier family 13 member 2
Alternative name(s):
Na(+)/dicarboxylate cotransporter 1
Short name:
NaDC-1
Renal sodium/dicarboxylate cotransporter
Gene namesi
Name:SLC13A2
Synonyms:NADC1, SDCT1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 17

Organism-specific databases

HGNCiHGNC:10917. SLC13A2.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei13 – 3321HelicalSequence AnalysisAdd
BLAST
Transmembranei53 – 7321HelicalSequence AnalysisAdd
BLAST
Transmembranei86 – 10621HelicalSequence AnalysisAdd
BLAST
Transmembranei114 – 13421HelicalSequence AnalysisAdd
BLAST
Transmembranei221 – 24121HelicalSequence AnalysisAdd
BLAST
Transmembranei274 – 29421HelicalSequence AnalysisAdd
BLAST
Transmembranei324 – 34421HelicalSequence AnalysisAdd
BLAST
Transmembranei371 – 39121HelicalSequence AnalysisAdd
BLAST
Transmembranei450 – 47021HelicalSequence AnalysisAdd
BLAST
Transmembranei482 – 50221HelicalSequence AnalysisAdd
BLAST
Transmembranei511 – 53121HelicalSequence AnalysisAdd
BLAST
Transmembranei545 – 56521HelicalSequence AnalysisAdd
BLAST

GO - Cellular componenti

  1. extracellular vesicular exosome Source: UniProt
  2. integral component of plasma membrane Source: ProtInc
  3. membrane Source: ProtInc
  4. plasma membrane Source: Reactome
Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA382.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 592592Solute carrier family 13 member 2PRO_0000172488Add
BLAST

Proteomic databases

PaxDbiQ13183.
PRIDEiQ13183.

PTM databases

PhosphoSiteiQ13183.

Expressioni

Gene expression databases

BgeeiQ13183.
CleanExiHS_SLC13A2.
ExpressionAtlasiQ13183. baseline.
GenevestigatoriQ13183.

Organism-specific databases

HPAiHPA014963.

Interactioni

Protein-protein interaction databases

STRINGi9606.ENSP00000316202.

Structurei

3D structure databases

ProteinModelPortaliQ13183.
SMRiQ13183. Positions 42-301, 407-558.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiCOG0471.
GeneTreeiENSGT00550000074480.
HOGENOMiHOG000278432.
HOVERGENiHBG055339.
InParanoidiQ13183.
KOiK14445.
PhylomeDBiQ13183.
TreeFamiTF312913.

Family and domain databases

InterProiIPR001898. Na/sul_symport.
[Graphical view]
PfamiPF00939. Na_sulph_symp. 1 hit.
[Graphical view]
PROSITEiPS01271. NA_SULFATE. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q13183-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MATCWQALWA YRSYLIVFFV PILLLPLPIL VPSKEAYCAY AIILMALFWC
60 70 80 90 100
TEALPLAVTA LFPLILFPMM GIVDASEVAV EYLKDSNLLF FGGLLVAIAV
110 120 130 140 150
EHWNLHKRIA LRVLLIVGVR PAPLILGFML VTAFLSMWIS NTATSAMMVP
160 170 180 190 200
IAHAVLDQLH SSQASSNVEE GSNNPTFELQ EPSPQKEVTK LDNGQALPVT
210 220 230 240 250
SASSEGRAHL SQKHLHLTQC MSLCVCYSAS IGGIATLTGT APNLVLQGQI
260 270 280 290 300
NSLFPQNGNV VNFASWFSFA FPTMVILLLL AWLWLQILFL GFNFRKNFGI
310 320 330 340 350
GEKMQEQQQA AYCVIQTEHR LLGPMTFAEK AISILFVILV LLWFTREPGF
360 370 380 390 400
FLGWGNLAFP NAKGESMVSD GTVAIFIGII MFIIPSKFPG LTQDPENPGK
410 420 430 440 450
LKAPLGLLDW KTVNQKMPWN IVLLLGGGYA LAKGSERSGL SEWLGNKLTP
460 470 480 490 500
LQSVPAPAIA IILSLLVATF TECTSNVATT TIFLPILASM AQAICLHPLY
510 520 530 540 550
VMLPCTLATS LAFMLPVATP PNAIVFSFGD LKVLDMARAG FLLNIIGVLI
560 570 580 590
IALAINSWGI PLFSLHSFPS WAQSNTTAQC LPSLANTTTP SP
Length:592
Mass (Da):64,410
Last modified:November 1, 1996 - v1
Checksum:i41137D6621A0872A
GO
Isoform 2 (identifier: Q13183-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-44: Missing.
     77-77: E → EIIQRPFPSSFESPGECQSVGMSVTASHNLGGTVGDSRVFPPLSHVSTCQ

Note: No experimental confirmation available.

Show »
Length:597
Mass (Da):64,468
Checksum:i51635628BF7A3AC3
GO
Isoform 3 (identifier: Q13183-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     77-77: E → EIIQRPFPSSFESPGECQSVGMSVTASHNLGGTVGDSRVFPPLSHVSTCQ

Note: No experimental confirmation available.

Show »
Length:641
Mass (Da):69,525
Checksum:iFC95202C8D82D238
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti307 – 3071Q → R in BAG60623. (PubMed:14702039)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti44 – 441L → F.
Corresponds to variant rs45443898 [ dbSNP | Ensembl ].
VAR_029254
Natural varianti45 – 451M → L.
Corresponds to variant rs16964363 [ dbSNP | Ensembl ].
VAR_052000
Natural varianti254 – 2541F → L.
Corresponds to variant rs11568461 [ dbSNP | Ensembl ].
VAR_029255
Natural varianti310 – 3101A → P.
Corresponds to variant rs11568441 [ dbSNP | Ensembl ].
VAR_029256
Natural varianti385 – 3851P → S.
Corresponds to variant rs45546232 [ dbSNP | Ensembl ].
VAR_020399
Natural varianti477 – 4771V → M.
Corresponds to variant rs11568476 [ dbSNP | Ensembl ].
VAR_029257
Natural varianti550 – 5501I → V.2 Publications
Corresponds to variant rs11567842 [ dbSNP | Ensembl ].
VAR_020400

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 4444Missing in isoform 2. 1 PublicationVSP_046426Add
BLAST
Alternative sequencei77 – 771E → EIIQRPFPSSFESPGECQSV GMSVTASHNLGGTVGDSRVF PPLSHVSTCQ in isoform 2 and isoform 3. 1 PublicationVSP_046427

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U26209 mRNA. Translation: AAA98504.1.
AK298388 mRNA. Translation: BAG60623.1.
AK314684 mRNA. Translation: BAG37236.1.
AC015917 Genomic DNA. No translation available.
BC096277 mRNA. Translation: AAH96277.1.
BC096278 mRNA. Translation: AAH96278.1.
BC096279 mRNA. Translation: AAH96279.1.
CCDSiCCDS11231.1. [Q13183-1]
CCDS54098.1. [Q13183-3]
RefSeqiNP_001139447.1. NM_001145975.1. [Q13183-3]
NP_003975.1. NM_003984.3. [Q13183-1]
UniGeneiHs.102307.

Genome annotation databases

EnsembliENST00000314669; ENSP00000316202; ENSG00000007216. [Q13183-1]
ENST00000444914; ENSP00000392411; ENSG00000007216. [Q13183-3]
GeneIDi9058.
KEGGihsa:9058.
UCSCiuc002hbh.3. human. [Q13183-1]

Polymorphism databases

DMDMi2499523.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U26209 mRNA. Translation: AAA98504.1 .
AK298388 mRNA. Translation: BAG60623.1 .
AK314684 mRNA. Translation: BAG37236.1 .
AC015917 Genomic DNA. No translation available.
BC096277 mRNA. Translation: AAH96277.1 .
BC096278 mRNA. Translation: AAH96278.1 .
BC096279 mRNA. Translation: AAH96279.1 .
CCDSi CCDS11231.1. [Q13183-1 ]
CCDS54098.1. [Q13183-3 ]
RefSeqi NP_001139447.1. NM_001145975.1. [Q13183-3 ]
NP_003975.1. NM_003984.3. [Q13183-1 ]
UniGenei Hs.102307.

3D structure databases

ProteinModelPortali Q13183.
SMRi Q13183. Positions 42-301, 407-558.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

STRINGi 9606.ENSP00000316202.

Chemistry

DrugBanki DB00139. Succinic acid.

Protein family/group databases

TCDBi 2.A.47.1.17. the divalent anion:na(+) symporter (dass) family.

PTM databases

PhosphoSitei Q13183.

Polymorphism databases

DMDMi 2499523.

Proteomic databases

PaxDbi Q13183.
PRIDEi Q13183.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000314669 ; ENSP00000316202 ; ENSG00000007216 . [Q13183-1 ]
ENST00000444914 ; ENSP00000392411 ; ENSG00000007216 . [Q13183-3 ]
GeneIDi 9058.
KEGGi hsa:9058.
UCSCi uc002hbh.3. human. [Q13183-1 ]

Organism-specific databases

CTDi 9058.
GeneCardsi GC17P026800.
HGNCi HGNC:10917. SLC13A2.
HPAi HPA014963.
MIMi 604148. gene.
neXtProti NX_Q13183.
PharmGKBi PA382.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG0471.
GeneTreei ENSGT00550000074480.
HOGENOMi HOG000278432.
HOVERGENi HBG055339.
InParanoidi Q13183.
KOi K14445.
PhylomeDBi Q13183.
TreeFami TF312913.

Enzyme and pathway databases

Reactomei REACT_20646. Sodium-coupled sulphate, di- and tri-carboxylate transporters.

Miscellaneous databases

GeneWikii SLC13A2.
GenomeRNAii 9058.
NextBioi 33945.
PROi Q13183.
SOURCEi Search...

Gene expression databases

Bgeei Q13183.
CleanExi HS_SLC13A2.
ExpressionAtlasi Q13183. baseline.
Genevestigatori Q13183.

Family and domain databases

InterProi IPR001898. Na/sul_symport.
[Graphical view ]
Pfami PF00939. Na_sulph_symp. 1 hit.
[Graphical view ]
PROSITEi PS01271. NA_SULFATE. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Molecular cloning and functional expression of a sodium-dicarboxylate cotransporter from human kidney."
    Pajor A.M.
    Am. J. Physiol. 270:F642-F648(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Kidney.
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2), VARIANT VAL-550.
    Tissue: Kidney.
  3. "DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage."
    Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L.
    , Chen C.-K., Cook A., Corum B., Cuomo C.A., de Jong P.J., DeCaprio D., Dewar K., FitzGerald M., Gilbert J., Gibson R., Gnerre S., Goldstein S., Grafham D.V., Grocock R., Hafez N., Hagopian D.S., Hart E., Norman C.H., Humphray S., Jaffe D.B., Jones M., Kamal M., Khodiyar V.K., LaButti K., Laird G., Lehoczky J., Liu X., Lokyitsang T., Loveland J., Lui A., Macdonald P., Major J.E., Matthews L., Mauceli E., McCarroll S.A., Mihalev A.H., Mudge J., Nguyen C., Nicol R., O'Leary S.B., Osoegawa K., Schwartz D.C., Shaw-Smith C., Stankiewicz P., Steward C., Swarbreck D., Venkataraman V., Whittaker C.A., Yang X., Zimmer A.R., Bradley A., Hubbard T., Birren B.W., Rogers J., Lander E.S., Nusbaum C.
    Nature 440:1045-1049(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
  5. "Associations between renal sodium-citrate cotransporter (hNaDC-1) gene polymorphism and urinary citrate excretion in recurrent renal calcium stone formers and normal controls."
    Okamoto N., Aruga S., Matsuzaki S., Takahashi S., Matsushita K., Kitamura T.
    Int. J. Urol. 14:344-349(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: VARIANT VAL-550.

Entry informationi

Entry nameiS13A2_HUMAN
AccessioniPrimary (citable) accession number: Q13183
Secondary accession number(s): B2RBI9
, B4DPL1, E7ETH5, Q4VAR7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: November 1, 1996
Last modified: October 29, 2014
This is version 119 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3