Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q13183

- S13A2_HUMAN

UniProt

Q13183 - S13A2_HUMAN

Protein

Solute carrier family 13 member 2

Gene

SLC13A2

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 118 (01 Oct 2014)
      Sequence version 1 (01 Nov 1996)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Cotransport of sodium ions and dicarboxylates such as succinate and citrate.

    GO - Molecular functioni

    1. low-affinity sodium:dicarboxylate symporter activity Source: ProtInc

    GO - Biological processi

    1. dicarboxylic acid transport Source: GOC
    2. transmembrane transport Source: Reactome
    3. transport Source: ProtInc

    Keywords - Biological processi

    Ion transport, Sodium transport, Symport, Transport

    Keywords - Ligandi

    Sodium

    Enzyme and pathway databases

    ReactomeiREACT_20646. Sodium-coupled sulphate, di- and tri-carboxylate transporters.

    Protein family/group databases

    TCDBi2.A.47.1.17. the divalent anion:na(+) symporter (dass) family.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Solute carrier family 13 member 2
    Alternative name(s):
    Na(+)/dicarboxylate cotransporter 1
    Short name:
    NaDC-1
    Renal sodium/dicarboxylate cotransporter
    Gene namesi
    Name:SLC13A2
    Synonyms:NADC1, SDCT1
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 17

    Organism-specific databases

    HGNCiHGNC:10917. SLC13A2.

    Subcellular locationi

    GO - Cellular componenti

    1. extracellular vesicular exosome Source: UniProt
    2. integral component of plasma membrane Source: ProtInc
    3. membrane Source: ProtInc
    4. plasma membrane Source: Reactome

    Keywords - Cellular componenti

    Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA382.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 592592Solute carrier family 13 member 2PRO_0000172488Add
    BLAST

    Proteomic databases

    PaxDbiQ13183.
    PRIDEiQ13183.

    PTM databases

    PhosphoSiteiQ13183.

    Expressioni

    Gene expression databases

    ArrayExpressiQ13183.
    BgeeiQ13183.
    CleanExiHS_SLC13A2.
    GenevestigatoriQ13183.

    Organism-specific databases

    HPAiHPA014963.

    Interactioni

    Protein-protein interaction databases

    STRINGi9606.ENSP00000316202.

    Structurei

    3D structure databases

    ProteinModelPortaliQ13183.
    SMRiQ13183. Positions 42-301, 407-558.
    ModBaseiSearch...
    MobiDBiSearch...

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei13 – 3321HelicalSequence AnalysisAdd
    BLAST
    Transmembranei53 – 7321HelicalSequence AnalysisAdd
    BLAST
    Transmembranei86 – 10621HelicalSequence AnalysisAdd
    BLAST
    Transmembranei114 – 13421HelicalSequence AnalysisAdd
    BLAST
    Transmembranei221 – 24121HelicalSequence AnalysisAdd
    BLAST
    Transmembranei274 – 29421HelicalSequence AnalysisAdd
    BLAST
    Transmembranei324 – 34421HelicalSequence AnalysisAdd
    BLAST
    Transmembranei371 – 39121HelicalSequence AnalysisAdd
    BLAST
    Transmembranei450 – 47021HelicalSequence AnalysisAdd
    BLAST
    Transmembranei482 – 50221HelicalSequence AnalysisAdd
    BLAST
    Transmembranei511 – 53121HelicalSequence AnalysisAdd
    BLAST
    Transmembranei545 – 56521HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Sequence similaritiesi

    Keywords - Domaini

    Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiCOG0471.
    HOGENOMiHOG000278432.
    HOVERGENiHBG055339.
    InParanoidiQ13183.
    KOiK14445.
    PhylomeDBiQ13183.
    TreeFamiTF312913.

    Family and domain databases

    InterProiIPR001898. Na/sul_symport.
    [Graphical view]
    PfamiPF00939. Na_sulph_symp. 1 hit.
    [Graphical view]
    PROSITEiPS01271. NA_SULFATE. 1 hit.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q13183-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MATCWQALWA YRSYLIVFFV PILLLPLPIL VPSKEAYCAY AIILMALFWC    50
    TEALPLAVTA LFPLILFPMM GIVDASEVAV EYLKDSNLLF FGGLLVAIAV 100
    EHWNLHKRIA LRVLLIVGVR PAPLILGFML VTAFLSMWIS NTATSAMMVP 150
    IAHAVLDQLH SSQASSNVEE GSNNPTFELQ EPSPQKEVTK LDNGQALPVT 200
    SASSEGRAHL SQKHLHLTQC MSLCVCYSAS IGGIATLTGT APNLVLQGQI 250
    NSLFPQNGNV VNFASWFSFA FPTMVILLLL AWLWLQILFL GFNFRKNFGI 300
    GEKMQEQQQA AYCVIQTEHR LLGPMTFAEK AISILFVILV LLWFTREPGF 350
    FLGWGNLAFP NAKGESMVSD GTVAIFIGII MFIIPSKFPG LTQDPENPGK 400
    LKAPLGLLDW KTVNQKMPWN IVLLLGGGYA LAKGSERSGL SEWLGNKLTP 450
    LQSVPAPAIA IILSLLVATF TECTSNVATT TIFLPILASM AQAICLHPLY 500
    VMLPCTLATS LAFMLPVATP PNAIVFSFGD LKVLDMARAG FLLNIIGVLI 550
    IALAINSWGI PLFSLHSFPS WAQSNTTAQC LPSLANTTTP SP 592
    Length:592
    Mass (Da):64,410
    Last modified:November 1, 1996 - v1
    Checksum:i41137D6621A0872A
    GO
    Isoform 2 (identifier: Q13183-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-44: Missing.
         77-77: E → EIIQRPFPSSFESPGECQSVGMSVTASHNLGGTVGDSRVFPPLSHVSTCQ

    Note: No experimental confirmation available.

    Show »
    Length:597
    Mass (Da):64,468
    Checksum:i51635628BF7A3AC3
    GO
    Isoform 3 (identifier: Q13183-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         77-77: E → EIIQRPFPSSFESPGECQSVGMSVTASHNLGGTVGDSRVFPPLSHVSTCQ

    Note: No experimental confirmation available.

    Show »
    Length:641
    Mass (Da):69,525
    Checksum:iFC95202C8D82D238
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti307 – 3071Q → R in BAG60623. (PubMed:14702039)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti44 – 441L → F.
    Corresponds to variant rs45443898 [ dbSNP | Ensembl ].
    VAR_029254
    Natural varianti45 – 451M → L.
    Corresponds to variant rs16964363 [ dbSNP | Ensembl ].
    VAR_052000
    Natural varianti254 – 2541F → L.
    Corresponds to variant rs11568461 [ dbSNP | Ensembl ].
    VAR_029255
    Natural varianti310 – 3101A → P.
    Corresponds to variant rs11568441 [ dbSNP | Ensembl ].
    VAR_029256
    Natural varianti385 – 3851P → S.
    Corresponds to variant rs45546232 [ dbSNP | Ensembl ].
    VAR_020399
    Natural varianti477 – 4771V → M.
    Corresponds to variant rs11568476 [ dbSNP | Ensembl ].
    VAR_029257
    Natural varianti550 – 5501I → V.2 Publications
    Corresponds to variant rs11567842 [ dbSNP | Ensembl ].
    VAR_020400

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 4444Missing in isoform 2. 1 PublicationVSP_046426Add
    BLAST
    Alternative sequencei77 – 771E → EIIQRPFPSSFESPGECQSV GMSVTASHNLGGTVGDSRVF PPLSHVSTCQ in isoform 2 and isoform 3. 1 PublicationVSP_046427

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U26209 mRNA. Translation: AAA98504.1.
    AK298388 mRNA. Translation: BAG60623.1.
    AK314684 mRNA. Translation: BAG37236.1.
    AC015917 Genomic DNA. No translation available.
    BC096277 mRNA. Translation: AAH96277.1.
    BC096278 mRNA. Translation: AAH96278.1.
    BC096279 mRNA. Translation: AAH96279.1.
    CCDSiCCDS11231.1. [Q13183-1]
    CCDS54098.1. [Q13183-3]
    RefSeqiNP_001139447.1. NM_001145975.1.
    NP_003975.1. NM_003984.3. [Q13183-1]
    UniGeneiHs.102307.

    Genome annotation databases

    EnsembliENST00000314669; ENSP00000316202; ENSG00000007216. [Q13183-1]
    ENST00000444914; ENSP00000392411; ENSG00000007216. [Q13183-3]
    GeneIDi9058.
    KEGGihsa:9058.
    UCSCiuc002hbh.3. human. [Q13183-1]

    Polymorphism databases

    DMDMi2499523.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U26209 mRNA. Translation: AAA98504.1 .
    AK298388 mRNA. Translation: BAG60623.1 .
    AK314684 mRNA. Translation: BAG37236.1 .
    AC015917 Genomic DNA. No translation available.
    BC096277 mRNA. Translation: AAH96277.1 .
    BC096278 mRNA. Translation: AAH96278.1 .
    BC096279 mRNA. Translation: AAH96279.1 .
    CCDSi CCDS11231.1. [Q13183-1 ]
    CCDS54098.1. [Q13183-3 ]
    RefSeqi NP_001139447.1. NM_001145975.1.
    NP_003975.1. NM_003984.3. [Q13183-1 ]
    UniGenei Hs.102307.

    3D structure databases

    ProteinModelPortali Q13183.
    SMRi Q13183. Positions 42-301, 407-558.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    STRINGi 9606.ENSP00000316202.

    Chemistry

    DrugBanki DB00139. Succinic acid.

    Protein family/group databases

    TCDBi 2.A.47.1.17. the divalent anion:na(+) symporter (dass) family.

    PTM databases

    PhosphoSitei Q13183.

    Polymorphism databases

    DMDMi 2499523.

    Proteomic databases

    PaxDbi Q13183.
    PRIDEi Q13183.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000314669 ; ENSP00000316202 ; ENSG00000007216 . [Q13183-1 ]
    ENST00000444914 ; ENSP00000392411 ; ENSG00000007216 . [Q13183-3 ]
    GeneIDi 9058.
    KEGGi hsa:9058.
    UCSCi uc002hbh.3. human. [Q13183-1 ]

    Organism-specific databases

    CTDi 9058.
    GeneCardsi GC17P026800.
    HGNCi HGNC:10917. SLC13A2.
    HPAi HPA014963.
    MIMi 604148. gene.
    neXtProti NX_Q13183.
    PharmGKBi PA382.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG0471.
    HOGENOMi HOG000278432.
    HOVERGENi HBG055339.
    InParanoidi Q13183.
    KOi K14445.
    PhylomeDBi Q13183.
    TreeFami TF312913.

    Enzyme and pathway databases

    Reactomei REACT_20646. Sodium-coupled sulphate, di- and tri-carboxylate transporters.

    Miscellaneous databases

    GeneWikii SLC13A2.
    GenomeRNAii 9058.
    NextBioi 33945.
    PROi Q13183.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q13183.
    Bgeei Q13183.
    CleanExi HS_SLC13A2.
    Genevestigatori Q13183.

    Family and domain databases

    InterProi IPR001898. Na/sul_symport.
    [Graphical view ]
    Pfami PF00939. Na_sulph_symp. 1 hit.
    [Graphical view ]
    PROSITEi PS01271. NA_SULFATE. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Molecular cloning and functional expression of a sodium-dicarboxylate cotransporter from human kidney."
      Pajor A.M.
      Am. J. Physiol. 270:F642-F648(1996) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
      Tissue: Kidney.
    2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2), VARIANT VAL-550.
      Tissue: Kidney.
    3. "DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage."
      Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L.
      , Chen C.-K., Cook A., Corum B., Cuomo C.A., de Jong P.J., DeCaprio D., Dewar K., FitzGerald M., Gilbert J., Gibson R., Gnerre S., Goldstein S., Grafham D.V., Grocock R., Hafez N., Hagopian D.S., Hart E., Norman C.H., Humphray S., Jaffe D.B., Jones M., Kamal M., Khodiyar V.K., LaButti K., Laird G., Lehoczky J., Liu X., Lokyitsang T., Loveland J., Lui A., Macdonald P., Major J.E., Matthews L., Mauceli E., McCarroll S.A., Mihalev A.H., Mudge J., Nguyen C., Nicol R., O'Leary S.B., Osoegawa K., Schwartz D.C., Shaw-Smith C., Stankiewicz P., Steward C., Swarbreck D., Venkataraman V., Whittaker C.A., Yang X., Zimmer A.R., Bradley A., Hubbard T., Birren B.W., Rogers J., Lander E.S., Nusbaum C.
      Nature 440:1045-1049(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    5. "Associations between renal sodium-citrate cotransporter (hNaDC-1) gene polymorphism and urinary citrate excretion in recurrent renal calcium stone formers and normal controls."
      Okamoto N., Aruga S., Matsuzaki S., Takahashi S., Matsushita K., Kitamura T.
      Int. J. Urol. 14:344-349(2007) [PubMed] [Europe PMC] [Abstract]
      Cited for: VARIANT VAL-550.

    Entry informationi

    Entry nameiS13A2_HUMAN
    AccessioniPrimary (citable) accession number: Q13183
    Secondary accession number(s): B2RBI9
    , B4DPL1, E7ETH5, Q4VAR7
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: November 1, 1997
    Last sequence update: November 1, 1996
    Last modified: October 1, 2014
    This is version 118 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 17
      Human chromosome 17: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3