Q13183 (S13A2_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 102.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Solute carrier family 13 member 2 Alternative name(s): Na(+)/dicarboxylate cotransporter 1 Short name=NaDC-1 Renal sodium/dicarboxylate cotransporter | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 592 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | Cotransport of sodium ions and dicarboxylates such as succinate and citrate. |
| Subcellular location | Membrane; Multi-pass membrane protein Potential. |
| Sequence similarities | Belongs to the SLC13A/DASS transporter (TC 2.A.47) family. NADC subfamily. [View classification] |
Ontologies
| Keywords | |
|---|---|
| Biological process | Ion transport Sodium transport Symport Transport |
| Cellular component | Membrane |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Transmembrane Transmembrane helix |
| Ligand | Sodium |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Cellular_component | integral to plasma membrane Traceable author statement Ref.1. Source: ProtInc |
| Molecular_function | low affinity sodium:dicarboxylate symporter activity Traceable author statement Ref.1. Source: ProtInc |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q13183-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q13183-2) The sequence of this isoform differs from the canonical sequence as follows: 1-44: Missing. 77-77: E → EIIQRPFPSSFESPGECQSVGMSVTASHNLGGTVGDSRVFPPLSHVSTCQ | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 592 | 592 | Solute carrier family 13 member 2 | PRO_0000172488 | |||||
Regions | |||||||||
| Transmembrane | 13 – 33 | 21 | Helical; Potential | ||||||
| Transmembrane | 53 – 73 | 21 | Helical; Potential | ||||||
| Transmembrane | 86 – 106 | 21 | Helical; Potential | ||||||
| Transmembrane | 114 – 134 | 21 | Helical; Potential | ||||||
| Transmembrane | 221 – 241 | 21 | Helical; Potential | ||||||
| Transmembrane | 274 – 294 | 21 | Helical; Potential | ||||||
| Transmembrane | 324 – 344 | 21 | Helical; Potential | ||||||
| Transmembrane | 371 – 391 | 21 | Helical; Potential | ||||||
| Transmembrane | 450 – 470 | 21 | Helical; Potential | ||||||
| Transmembrane | 482 – 502 | 21 | Helical; Potential | ||||||
| Transmembrane | 511 – 531 | 21 | Helical; Potential | ||||||
| Transmembrane | 545 – 565 | 21 | Helical; Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 44 | 44 | Missing in isoform 2. | VSP_046426 | |||||
| Alternative sequence | 77 | 1 | E → EIIQRPFPSSFESPGECQSV GMSVTASHNLGGTVGDSRVF PPLSHVSTCQ in isoform 2. | VSP_046427 | |||||
| Natural variant | 44 | 1 | L → F. Corresponds to variant rs45443898 [ dbSNP | Ensembl ]. | VAR_029254 | |||||
| Natural variant | 45 | 1 | M → L. Corresponds to variant rs16964363 [ dbSNP | Ensembl ]. | VAR_052000 | |||||
| Natural variant | 254 | 1 | F → L. Corresponds to variant rs11568461 [ dbSNP | Ensembl ]. | VAR_029255 | |||||
| Natural variant | 310 | 1 | A → P. Corresponds to variant rs11568441 [ dbSNP | Ensembl ]. | VAR_029256 | |||||
| Natural variant | 385 | 1 | P → S. Corresponds to variant rs45546232 [ dbSNP | Ensembl ]. | VAR_020399 | |||||
| Natural variant | 477 | 1 | V → M. Corresponds to variant rs11568476 [ dbSNP | Ensembl ]. | VAR_029257 | |||||
| Natural variant | 550 | 1 | I → V. Ref.2 Ref.5 Corresponds to variant rs11567842 [ dbSNP | Ensembl ]. | VAR_020400 | |||||
Experimental info | |||||||||
| Sequence conflict | 307 | 1 | Q → R in BAG60623. Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Molecular cloning and functional expression of a sodium-dicarboxylate cotransporter from human kidney." Pajor A.M. Am. J. Physiol. 270:F642-F648(1996) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Kidney. |
| [2] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2), VARIANT VAL-550. Tissue: Kidney. |
| [3] | "DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage." Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L. Nusbaum C.Nature 440:1045-1049(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [5] | "Associations between renal sodium-citrate cotransporter (hNaDC-1) gene polymorphism and urinary citrate excretion in recurrent renal calcium stone formers and normal controls." Okamoto N., Aruga S., Matsuzaki S., Takahashi S., Matsushita K., Kitamura T. Int. J. Urol. 14:344-349(2007) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT VAL-550. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | U26209 mRNA. Translation: AAA98504.1. AK298388 mRNA. Translation: BAG60623.1. AK314684 mRNA. Translation: BAG37236.1. AC015917 Genomic DNA. No translation available. BC096277 mRNA. Translation: AAH96277.1. BC096278 mRNA. Translation: AAH96278.1. BC096279 mRNA. Translation: AAH96279.1. |
| IPI | IPI00011981. IPI00908933. |
| RefSeq | NP_001139447.1. NM_001145975.1. NP_003975.1. NM_003984.3. |
| UniGene | Hs.102307. |
3D structure databases | |
| ProteinModelPortal | Q13183. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 9606.ENSP00000316202. |
PTM databases | |
| PhosphoSite | Q13183. |
Polymorphism databases | |
| DMDM | 2499523. |
Proteomic databases | |
| PaxDb | Q13183. |
| PRIDE | Q13183. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000314669; ENSP00000316202; ENSG00000007216. ENST00000444914; ENSP00000392411; ENSG00000007216. ENST00000572344; ENSP00000458829; ENSG00000262654. |
| GeneID | 9058. |
| KEGG | hsa:9058. |
| UCSC | uc002hbh.3. human. |
Organism-specific databases | |
| CTD | 9058. |
| GeneCards | GC17P026800. |
| HGNC | HGNC:10917. SLC13A2. |
| HPA | HPA014963. |
| MIM | 604148. gene. |
| neXtProt | NX_Q13183. |
| PharmGKB | PA382. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG0471. |
| HOGENOM | HOG000278432. |
| HOVERGEN | HBG055339. |
| InParanoid | Q13183. |
| KO | K14445. |
| OrthoDB | EOG4QZ7KW. |
| PhylomeDB | Q13183. |
Enzyme and pathway databases | |
| Reactome | REACT_15518. Transmembrane transport of small molecules. REACT_20633. Bile salt and organic anion SLC transporters. |
Gene expression databases | |
| ArrayExpress | Q13183. |
| Bgee | Q13183. |
| CleanEx | HS_SLC13A2. |
| Genevestigator | Q13183. |
Family and domain databases | |
| InterPro | IPR001898. Na/sul_symport. [Graphical view] |
| Pfam | PF00939. Na_sulph_symp. 1 hit. [Graphical view] |
| PROSITE | PS01271. NA_SULFATE. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| DrugBank | DB00139. Succinic acid. |
| GenomeRNAi | 9058. |
| NextBio | 33945. |
| SOURCE | Search... |
Entry information
| Entry name | S13A2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q13183 Secondary accession number(s): B2RBI9 Q4VAR7 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 17 Human chromosome 17: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
