Q13163 (MP2K5_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 134.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Dual specificity mitogen-activated protein kinase kinase 5 Short name=MAP kinase kinase 5 Short name=MAPKK 5 EC=2.7.12.2 Alternative name(s): MAPK/ERK kinase 5 Short name=MEK 5 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 448 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Acts as a scaffold for the formation of a ternary MAP3K2/MAP3K3-MAP3K5-MAPK7 signaling complex. Activation of this pathway appears to play a critical role in protecting cells from stress-induced apoptosis, neuronal survival and cardiac development and angiogenesis. Ref.1 Ref.2 |
| Catalytic activity | ATP + a protein = ADP + a phosphoprotein. |
| Cofactor | Magnesium. |
| Subunit structure | Interacts with PARD6A, MAP3K3 and MAPK7. Forms a complex with SQSTM1 and PRKCZ or PRKCI By similarity. Interacts with Yersinia yopJ. Ref.1 Ref.9 |
| Tissue specificity | Expressed in many adult tissues. Abundant in heart and skeletal muscle. |
| Domain | Binds MAP3K2/MAP3K3 and MAPK7 via non-overlapping residues of the OPR domain. This domain also mediates interactions with SQSTM1 and PARD6A By similarity. |
| Post-translational modification | Activated by phosphorylation on Ser/Thr by MAP kinase kinase kinases By similarity. Yersinia yopJ may acetylate Ser/Thr residues, preventing phosphorylation and activation, thus blocking the MAPK signaling pathway. |
| Sequence similarities | Belongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. MAP kinase kinase subfamily. Contains 1 OPR domain. Contains 1 protein kinase domain. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| GRB2 | P62993 | 2 | EBI-307294,EBI-401755 | |
| MAPK7 | Q13164 | 2 | EBI-307294,EBI-1213983 |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform B (identifier: Q13163-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform A (identifier: Q13163-2) The sequence of this isoform differs from the canonical sequence as follows: 349-358: Missing. | ||||||
| Isoform C (identifier: Q13163-3) The sequence of this isoform differs from the canonical sequence as follows: 349-358: Missing. 444-448: QQGPP → LASLPSPSPSV | ||||||
| Note: Incomplete sequence. | ||||||
| Isoform 4 (identifier: Q13163-4) The sequence of this isoform differs from the canonical sequence as follows: 1-45: MLWLALGPFPAMENQVLVIRIKIPNSGAVDWTVHSGPQLLFRDVL → MMEGHFPQS | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 448 | 448 | Dual specificity mitogen-activated protein kinase kinase 5 | PRO_0000086383 | ||||||||||||||||||||||
Regions | ||||||||||||||||||||||||||
| Domain | 18 – 97 | 80 | OPR | |||||||||||||||||||||||
| Domain | 166 – 409 | 244 | Protein kinase | |||||||||||||||||||||||
| Nucleotide binding | 172 – 180 | 9 | ATP By similarity | |||||||||||||||||||||||
| Region | 18 – 25 | 8 | Interaction with MAPK7 By similarity | |||||||||||||||||||||||
| Region | 64 – 68 | 5 | Interaction with MAP3K2/MAP3K3 By similarity | |||||||||||||||||||||||
| Region | 117 – 131 | 15 | Interaction with MAPK7 By similarity | |||||||||||||||||||||||
Sites | ||||||||||||||||||||||||||
| Active site | 283 | 1 | Proton acceptor By similarity | |||||||||||||||||||||||
| Binding site | 195 | 1 | ATP | |||||||||||||||||||||||
Amino acid modifications | ||||||||||||||||||||||||||
| Modified residue | 311 | 1 | Phosphoserine Ref.1 Ref.11 | |||||||||||||||||||||||
| Modified residue | 315 | 1 | Phosphothreonine Ref.1 | |||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||
| Alternative sequence | 1 – 45 | 45 | MLWLA…FRDVL → MMEGHFPQS in isoform 4. | VSP_043333 | ||||||||||||||||||||||
| Alternative sequence | 349 – 358 | 10 | Missing in isoform A and isoform C. | VSP_021825 | ||||||||||||||||||||||
| Alternative sequence | 444 – 448 | 5 | QQGPP → LASLPSPSPSV in isoform C. | VSP_021826 | ||||||||||||||||||||||
| Natural variant | 118 | 1 | H → R. Ref.14 Corresponds to variant rs56241934 [ dbSNP | Ensembl ]. | VAR_040823 | ||||||||||||||||||||||
| Natural variant | 427 | 1 | A → V. Ref.14 | VAR_040824 | ||||||||||||||||||||||
| Natural variant | 428 | 1 | A → T. Ref.14 Corresponds to variant rs55811347 [ dbSNP | Ensembl ]. | VAR_046070 | ||||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||||
| Mutagenesis | 195 | 1 | K → M: Inactivation. Ref.1 | |||||||||||||||||||||||
| Mutagenesis | 311 | 1 | S → A: Inactivation. Ref.1 | |||||||||||||||||||||||
| Mutagenesis | 315 | 1 | T → A: Inactivation. Ref.1 | |||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||
| Beta strand | 17 – 23 | 7 | ||||||||||||||||||||||||
| Turn | 24 – 26 | 3 | ||||||||||||||||||||||||
| Beta strand | 27 – 33 | 7 | ||||||||||||||||||||||||
| Helix | 41 – 51 | 11 | ||||||||||||||||||||||||
| Beta strand | 58 – 63 | 6 | ||||||||||||||||||||||||
| Beta strand | 65 – 67 | 3 | ||||||||||||||||||||||||
| Beta strand | 69 – 72 | 4 | ||||||||||||||||||||||||
| Helix | 75 – 93 | 19 | ||||||||||||||||||||||||
| Turn | 94 – 96 | 3 | ||||||||||||||||||||||||
| Beta strand | 102 – 107 | 6 | ||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Components of a new human protein kinase signal transduction pathway." Zhou G., Bao Z.Q., Dixon J.E. J. Biol. Chem. 270:12665-12669(1995) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM A), FUNCTION, INTERACTION WITH ERK5 AND MAPK7, MUTAGENESIS OF LYS-195; SER-311 AND THR-315, PHOSPHORYLATION AT SER-311 AND THR-315. Tissue: Fetal brain. |
| [2] | "BMK1/ERK5 regulates serum-induced early gene expression through transcription factor MEF2C." Kato Y., Kravchenko V.V., Tapping R.I., Han J., Ulevitch R.J., Lee J.-D. EMBO J. 16:7054-7066(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS B AND C), FUNCTION. Tissue: Placenta. |
| [3] | Lee J.D. Submitted (MAY-2007) to the EMBL/GenBank/DDBJ databases Cited for: SEQUENCE REVISION TO C-TERMINUS OF ISOFORM C. |
| [4] | "Cloning of human full-length CDSs in BD Creator(TM) system donor vector." Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A. Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM B). |
| [5] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4). Tissue: Cerebellum. |
| [6] | "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)." Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM B). |
| [7] | "Analysis of the DNA sequence and duplication history of human chromosome 15." Zody M.C., Garber M., Sharpe T., Young S.K., Rowen L., O'Neill K., Whittaker C.A., Kamal M., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Kodira C.D., Madan A., Qin S., Yang X., Abbasi N., Abouelleil A. Nusbaum C.Nature 440:671-675(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [8] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM B). Tissue: Brain. |
| [9] | "Yersinia YopJ acetylates and inhibits kinase activation by blocking phosphorylation." Mukherjee S., Keitany G., Li Y., Wang Y., Ball H.L., Goldsmith E.J., Orth K. Science 312:1211-1214(2006) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH YOPJ, ACETYLATION. |
| [10] | "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle." Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M. Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. Tissue: Cervix carcinoma. |
| [11] | "Large-scale proteomics analysis of the human kinome." Oppermann F.S., Gnad F., Olsen J.V., Hornberger R., Greff Z., Keri G., Mann M., Daub H. Mol. Cell. Proteomics 8:1751-1764(2009) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-311, MASS SPECTROMETRY. |
| [12] | "Crystal structure of the complex of human mitogen activated protein kinase kinase 5 phox domain (MAP2K5-Phox) with human mitogen activated protein kinase kinase kinase 3 (MAP3K2B-Phox)." Structural genomics consortium (SGC) Submitted (NOV-2006) to the PDB data bank Cited for: X-RAY CRYSTALLOGRAPHY (1.75 ANGSTROMS) OF 4-108 IN COMPLEX WITH MAP3K2. |
| [13] | "Crystal structure of the complex of human mitogen activated protein kinase kinase 5 phox domain (MAP2K5-Phox) with human mitogen activated protein kinase kinase kinase 3 (MAP3K3B-Phox)." Structural genomics consortium (SGC) Submitted (NOV-2006) to the PDB data bank Cited for: X-RAY CRYSTALLOGRAPHY (1.83 ANGSTROMS) OF 4-108 IN COMPLEX WITH MAP3K3. |
| [14] | "Patterns of somatic mutation in human cancer genomes." Greenman C., Stephens P., Smith R., Dalgliesh G.L., Hunter C., Bignell G., Davies H., Teague J., Butler A., Stevens C., Edkins S., O'Meara S., Vastrik I., Schmidt E.E., Avis T., Barthorpe S., Bhamra G., Buck G. Stratton M.R.Nature 446:153-158(2007) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS [LARGE SCALE ANALYSIS] ARG-118; VAL-427 AND THR-428. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | U25265 mRNA. Translation: AAA96146.1. U71087 mRNA. Translation: AAB16851.1. U71088 mRNA. Translation: AAB16852.2. BT006780 mRNA. Translation: AAP35426.1. AK293459 mRNA. Translation: BAG56954.1. CR542229 mRNA. Translation: CAG47025.1. AC009292 Genomic DNA. No translation available. AC016355 Genomic DNA. No translation available. AC103753 Genomic DNA. No translation available. BC008838 mRNA. Translation: AAH08838.1. | ||||||||||||||||||||||||
| IPI | IPI00158248. IPI00185860. IPI00219607. IPI00788893. | ||||||||||||||||||||||||
| RefSeq | NP_001193733.1. NM_001206804.1. NP_002748.1. NM_002757.3. NP_660143.1. NM_145160.2. | ||||||||||||||||||||||||
| UniGene | Hs.114198. | ||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||
| ProteinModelPortal | Q13163. | ||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||
| DIP | DIP-27558N. | ||||||||||||||||||||||||
| IntAct | Q13163. 10 interactions. | ||||||||||||||||||||||||
| MINT | MINT-1155433. | ||||||||||||||||||||||||
| STRING | 9606.ENSP00000178640. | ||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||
| PhosphoSite | Q13163. | ||||||||||||||||||||||||
Polymorphism databases | |||||||||||||||||||||||||
| DMDM | 118572669. | ||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||
| PaxDb | Q13163. | ||||||||||||||||||||||||
| PRIDE | Q13163. | ||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||
| DNASU | 5607. | ||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||
| Ensembl | ENST00000178640; ENSP00000178640; ENSG00000137764. ENST00000354498; ENSP00000346493; ENSG00000137764. ENST00000395476; ENSP00000378859; ENSG00000137764. | ||||||||||||||||||||||||
| GeneID | 5607. | ||||||||||||||||||||||||
| KEGG | hsa:5607. | ||||||||||||||||||||||||
| UCSC | uc002aqu.3. human. uc002aqv.3. human. | ||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||
| CTD | 5607. | ||||||||||||||||||||||||
| GeneCards | GC15P067835. | ||||||||||||||||||||||||
| HGNC | HGNC:6845. MAP2K5. | ||||||||||||||||||||||||
| HPA | CAB022094. HPA027347. HPA027755. | ||||||||||||||||||||||||
| MIM | 602520. gene. | ||||||||||||||||||||||||
| neXtProt | NX_Q13163. | ||||||||||||||||||||||||
| PharmGKB | PA30590. | ||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||
| eggNOG | COG0515. | ||||||||||||||||||||||||
| HOGENOM | HOG000234206. | ||||||||||||||||||||||||
| HOVERGEN | HBG108518. | ||||||||||||||||||||||||
| InParanoid | Q13163. | ||||||||||||||||||||||||
| KO | K04463. | ||||||||||||||||||||||||
| OMA | FNDGNAT. | ||||||||||||||||||||||||
| OrthoDB | EOG49GKGK. | ||||||||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||||||||
| BRENDA | 2.7.12.2. 2681. | ||||||||||||||||||||||||
| Pathway_Interaction_DB | mapktrkpathway. Trk receptor signaling mediated by the MAPK pathway. | ||||||||||||||||||||||||
| Reactome | REACT_111102. Signal Transduction. | ||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||
| ArrayExpress | Q13163. | ||||||||||||||||||||||||
| Bgee | Q13163. | ||||||||||||||||||||||||
| CleanEx | HS_MAP2K5. | ||||||||||||||||||||||||
| Genevestigator | Q13163. | ||||||||||||||||||||||||
| GermOnline | ENSG00000137764. Homo sapiens. | ||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||
| InterPro | IPR011009. Kinase-like_dom. IPR000270. OPR_PB1. IPR000719. Prot_kinase_cat_dom. IPR017441. Protein_kinase_ATP_BS. IPR002290. Ser/Thr_dual-sp_kinase_dom. IPR008271. Ser/Thr_kinase_AS. [Graphical view] | ||||||||||||||||||||||||
| Pfam | PF00564. PB1. 1 hit. PF00069. Pkinase. 1 hit. [Graphical view] | ||||||||||||||||||||||||
| SMART | SM00666. PB1. 1 hit. SM00220. S_TKc. 1 hit. [Graphical view] | ||||||||||||||||||||||||
| SUPFAM | SSF56112. Kinase_like. 1 hit. | ||||||||||||||||||||||||
| PROSITE | PS00107. PROTEIN_KINASE_ATP. 1 hit. PS50011. PROTEIN_KINASE_DOM. 1 hit. PS00108. PROTEIN_KINASE_ST. 1 hit. [Graphical view] | ||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||
Other | |||||||||||||||||||||||||
| BindingDB | Q13163. | ||||||||||||||||||||||||
| ChEMBL | CHEMBL4948. | ||||||||||||||||||||||||
| ChiTaRS | MAP2K5. human. | ||||||||||||||||||||||||
| EvolutionaryTrace | Q13163. | ||||||||||||||||||||||||
| GenomeRNAi | 5607. | ||||||||||||||||||||||||
| NextBio | 21792. | ||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||
Entry information
| Entry name | MP2K5_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q13163 Secondary accession number(s): B4DE43, Q92961, Q92962 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human and mouse protein kinases Human and mouse protein kinases: classification and index |
| Human chromosome 15 Human chromosome 15: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
