Reviewed,
UniProtKB/Swiss-Prot Q13153 (PAK1_HUMAN)
Last modified
June 16, 2009.
Version 110.
History...
Clusters with 100%,
90%,
50% identity |
Documents (7) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Serine/threonine-protein kinase PAK 1 EC=2.7.11.1 Alternative name(s): p21-activated kinase 1 Short name=PAK-1 p65-PAK Alpha-PAK | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 545 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | The activated kinase acts on a variety of targets. Likely to be the GTPase effector that links the Rho-related GTPases to the JNK MAP kinase pathway. Activated by CDC42 and RAC1. Involved in dissolution of stress fibers and reorganization of focal complexes. Involved in regulation of microtubule biogenesis through phosphorylation of TBCB. Activity is inhibited in cells undergoing apoptosis, potentially due to binding of CDC2L1 and CDC2L2. Ref.7 Ref.10 Ref.11 Ref.13 |
| Catalytic activity | ATP + a protein = ADP + a phosphoprotein. |
| Cofactor | Magnesium. |
| Enzyme regulation | Activated by binding small G proteins. Binding of GTP-bound CDC42 or RAC1 to the autoregulatory region releases monomers from the autoinhibited dimer, enables phosphorylation of Thr-423 and allows the kinase domain to adopt an active structure. Also activated by binding to GTP-bound CDC42, independent of the phosphorylation state of Thr-423. Phosphorylation of Thr-84 by OXSR1 inhibits this activation By similarity. |
| Subunit structure | Homodimer in its autoinhibited state. Active as monomer. Interacts tightly with GTP-bound but not GDP-bound CDC42/P21 and RAC1. Binds to the caspase-cleaved p110 isoform of CDC2L1 and CDC2L2, p110C, but not the full-length proteins. Component of cytoplasmic complexes, which also contain PXN, ARHGEF6 and GIT1. Interacts with ARHGEF7. Also interacts with CRIPAK. Interacts with NISCH By similarity. |
| Subcellular location | Cytoplasm. Cell junction › focal adhesion. Note: Recruited to focal adhesions upon activation. Ref.5 |
| Post-translational modification | Autophosphorylated when activated by CDC42/p21 and RAC1. Ref.8 Ref.12 Ref.14 |
| Sequence similarities | Belongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. STE20 subfamily. Contains 1 CRIB domain. Contains 1 protein kinase domain. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| CDC2L1 | P21127 | 2 | EBI-1307,EBI-1298 | |
| CDC42 | P60953 | 2 | EBI-1307,EBI-81752 | |
| Cdc42 | P60766 | 1 | EBI-1307,EBI-81763 | From a different organism. |
| CRIPAK | Q8N1N5 | 5 | EBI-1307,EBI-1205846 | |
| RAC1 | P63000 | 3 | EBI-1307,EBI-413628 | |
| Rac1 | P63001 | 1 | EBI-1307,EBI-413646 | From a different organism. |
| RHOU | Q7L0Q8 | 1 | EBI-1019502,EBI-1638043 | |
| RHOU | Q7L0Q8 | 1 | EBI-1307,EBI-1638043 |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q13153-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q13153-2) Also known as: PAK1B; The sequence of this isoform differs from the canonical sequence as follows: 518-545: HQFLKIAKPLSSLTPLIAAAKEATKNNH → VRKLRFQVFSNFSMIAASIPEDCQAPLQPHSTDCCS |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 545 | 545 | Serine/threonine-protein kinase PAK 1 | PRO_0000086460 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 75 – 88 | 14 | CRIB | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 270 – 521 | 252 | Protein kinase | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Nucleotide binding | 276 – 284 | 9 | ATP By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 70 – 140 | 71 | Autoregulatory region | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 75 – 105 | 31 | GTPase-binding By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 132 – 270 | 139 | Interaction with CRIPAK | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sites | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Active site | 389 | 1 | Proton acceptor | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 299 | 1 | ATP By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 21 | 1 | Phosphoserine; by autocatalysis By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 57 | 1 | Phosphoserine; by autocatalysis By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 84 | 1 | Phosphothreonine; by OXSR1 By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 144 | 1 | Phosphoserine; by autocatalysis By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 149 | 1 | Phosphoserine; by autocatalysis By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 199 | 1 | Phosphoserine; by autocatalysis By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 204 | 1 | Phosphoserine; by autocatalysis By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 212 | 1 | Phosphothreonine Ref.12 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 220 | 1 | Phosphoserine By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 223 | 1 | Phosphoserine By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 225 | 1 | Phosphothreonine By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 230 | 1 | Phosphothreonine Ref.14 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 423 | 1 | Phosphothreonine; by autocatalysis Probable | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 518 – 545 | 28 | HQFLK…TKNNH → VRKLRFQVFSNFSMIAASIP EDCQAPLQPHSTDCCS in isoform 2. | VSP_017507 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 515 | 1 | L → V: dbSNP rs35345144. | VAR_051654 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 83 | 1 | H → L: Decreases activity; when associated with L-86. Ref.6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 86 | 1 | H → L: Decreases activity; when associated with L-83. Ref.6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 107 | 1 | L → F: Constitutively active. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 423 | 1 | T → A: Decreases CDC42-stimulated activity and autophosphorylation. Ref.8 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 26 | 1 | A → V in AAA65441. Ref.2 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 26 | 1 | A → V in AAC24716. Ref.3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 237 | 1 | R → L in AAC50590. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 379 | 1 | F → S in AAC50590. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 503 | 1 | E → D in AAA65441. Ref.2 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 80 – 90 | 11 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 91 – 94 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 95 – 98 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 101 – 108 | 8 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 114 – 119 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 121 – 135 | 15 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 195 – 198 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 252 – 257 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 258 – 260 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 266 – 269 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 275 – 279 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 282 – 289 | 8 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 290 – 292 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 295 – 300 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 309 – 319 | 11 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 330 – 334 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 341 – 345 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 349 – 351 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 352 – 358 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 363 – 382 | 20 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 392 – 394 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 395 – 397 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 403 – 405 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 408 – 410 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 433 – 436 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 444 – 459 | 16 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 463 – 466 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 469 – 478 | 10 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 487 – 489 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 492 – 501 | 10 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 506 – 508 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 512 – 515 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 519 – 523 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 527 – 529 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 531 – 539 | 9 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Human Ste20 homologue hPAK1 links GTPases to the JNK MAP kinase pathway." Brown J.L., Stowers L., Baer M., Trejo J., Coughlin S., Chant J. Curr. Biol. 6:598-605(1996) [PubMed: 8805275] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Placenta. |
| [2] | "Human p21-activated kinase (Pak1) regulates actin organization in mammalian cells." Sells M.A., Knaus U.G., Bagrodia S., Ambrose D.M., Bokoch G.M., Chernoff J. Curr. Biol. 7:202-210(1997) [PubMed: 9395435] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [3] | "Human PAK1B." Reid T., Aspenstroem P., Bertoglio J. Submitted (JUN-1998) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2). |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [5] | "Expression of constitutively active alpha-PAK reveals effects of the kinase on actin and focal complexes." Manser E., Huang H.Y., Loo T.H., Chen X.Q., Dong J.M., Leung T., Lim L. Mol. Cell. Biol. 17:1129-1143(1997) [PubMed: 9032240] [Abstract] Cited for: ENZYME REGULATION, SUBCELLULAR LOCATION. |
| [6] | "Differential effects of PAK1-activating mutations reveal activity-dependent and -independent effects on cytoskeletal regulation." Frost J.A., Khokhlatchev A., Stippec S., White M.A., Cobb M.H. J. Biol. Chem. 273:28191-28198(1998) [PubMed: 9774440] [Abstract] Cited for: MUTAGENESIS OF HIS-83 AND HIS-86. |
| [7] | "A conserved negative regulatory region in alphaPAK: inhibition of PAK kinases reveals their morphological roles downstream of Cdc42 and Rac1." Zhao Z.S., Manser E., Chen X.Q., Chong C., Leung T., Lim L. Mol. Cell. Biol. 18:2153-2163(1998) [PubMed: 9528787] [Abstract] Cited for: FUNCTION, AUTOREGULATORY DOMAIN. |
| [8] | "Identification of a central phosphorylation site in p21-activated kinase regulating autoinhibition and kinase activity." Zenke F.T., King C.C., Bohl B.P., Bokoch G.M. J. Biol. Chem. 274:32565-32573(1999) [PubMed: 10551809] [Abstract] Cited for: PHOSPHORYLATION AT THR-423, MUTAGENESIS OF THR-423. |
| [9] | "Pak1 kinase homodimers are autoinhibited in trans and dissociated upon activation by Cdc42 and Rac1." Parrini M.C., Lei M., Harrison S.C., Mayer B.J. Mol. Cell 9:73-83(2002) [PubMed: 11804587] [Abstract] Cited for: DIMERIZATION, ENZYME REGULATION. |
| [10] | "The C-terminal kinase domain of the p34cdc2-related PITSLRE protein kinase (p110C) associates with p21-activated kinase 1 and inhibits its activity during anoikis." Chen S., Yin X., Zhu X., Yan J., Ji S., Chen C., Cai M., Zhang S., Zong H., Hu Y., Yuan Z., Shen Z., Gu J. J. Biol. Chem. 278:20029-20036(2003) [PubMed: 12624090] [Abstract] Cited for: FUNCTION, INTERACTION WITH CDC2L1 AND CDC2L2. |
| [11] | "p21-activated kinase 1 regulates microtubule dynamics by phosphorylating tubulin cofactor B." Vadlamudi R.K., Barnes C.J., Rayala S., Li F., Balasenthil S., Marcus S., Goodson H.V., Sahin A.A., Kumar R. Mol. Cell. Biol. 25:3726-3736(2005) [PubMed: 15831477] [Abstract] Cited for: FUNCTION. |
| [12] | "A probability-based approach for high-throughput protein phosphorylation analysis and site localization." Beausoleil S.A., Villen J., Gerber S.A., Rush J., Gygi S.P. Nat. Biotechnol. 24:1285-1292(2006) [PubMed: 16964243] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-212, MASS SPECTROMETRY. Tissue: Epithelium. |
| [13] | "CRIPak, a novel endogenous Pak1 inhibitor." Talukder A.H., Meng Q., Kumar R. Oncogene 25:1311-1319(2006) [PubMed: 16278681] [Abstract] Cited for: FUNCTION, INTERACTION WITH CRIPAK. |
| [14] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed: 18669648] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-230, MASS SPECTROMETRY. |
| [15] | Colinge J., Superti-Furga G., Bennett K.L. Submitted (OCT-2008) to UniProtKB Cited for: IDENTIFICATION [LARGE SCALE ANALYSIS], MASS SPECTROMETRY. |
| [16] | "Structure of PAK1 in an autoinhibited conformation reveals a multistage activation switch." Lei M., Lu W., Meng W., Parrini M.C., Eck M.J., Mayer B.J., Harrison S.C. Cell 102:387-397(2000) [PubMed: 10975528] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.3 ANGSTROMS) OF 70-545. |
| [17] | "Structural analysis of the SH3 domain of beta-PIX and its interaction with alpha-p21 activated kinase (PAK)." Mott H.R., Nietlispach D., Evetts K.A., Owen D. Biochemistry 44:10977-10983(2005) [PubMed: 16101281] [Abstract] Cited for: STRUCTURE BY NMR OF 183-204 IN COMPLEX WITH ARHGEF7. |
| [18] | "The active conformation of the PAK1 kinase domain." Lei M., Robinson M.A., Harrison S.C. Structure 13:769-778(2005) [PubMed: 15893667] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (1.8 ANGSTROMS) OF 249-545, ENZYME REGULATION. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| U51120 mRNA. Translation: AAC50590.1. U24152 mRNA. Translation: AAA65441.1. AF071884 mRNA. Translation: AAC24716.1. BC109299 mRNA. Translation: AAI09300.1. | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| IPI | IPI00289746. IPI00656138. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PIR | G01773. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| RefSeq | NP_001122092.1. NP_002567.3. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| UniGene | Hs.435714 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| IntAct | Q13153. 11 interactions. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PhosphoSite | Q13153. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PRIDE | Q13153. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Ensembl | ENSG00000149269. Homo sapiens. [Contig view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GeneID | 5058. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| KEGG | hsa:5058. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GeneCards | GC11M076710. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| H-InvDB | HIX0009965. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HGNC | HGNC:8590. PAK1. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HPA | CAB005312. HPA003565. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| MIM | 602590. gene. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PharmGKB | PA32917. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HOVERGEN | Q13153. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| OMA | Q13153. EATKNNH. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| BRENDA | 2.7.11.1. 247. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Pathway_Interaction_DB | angiopoietinreceptor_pathway. Angiopoietin receptor Tie2-mediated signaling. aurora_a_pathway. Aurora A signaling. epha2_fwdpathway. EPHA2 forward signaling. ephbfwdpathway. EPHB forward signaling. p38alphabetapathway. Regulation of p38-alpha and p38-beta. s1p_s1p2_pathway. S1P2 pathway. met_pathway. Signaling events activated by Hepatocyte Growth Factor Receptor (c-Met). vegfr1_2_pathway. Signaling events mediated by VEGFR1 and VEGFR2. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ArrayExpress | Q13153. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Bgee | Q13153. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| CleanEx | HS_PAK1. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GermOnline | ENSG00000149269. Homo sapiens. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| InterPro | IPR000095. PAK_box_Rho_bd. IPR000719. Prot_kinase_core. IPR017441. Protein_kinase_ATP_BS. IPR017442. Se/Thr_pkinase-rel. IPR015750. Ser/Thr_Kinase_Pak-rel. IPR008271. Ser_thr_pkin_AS. IPR002290. Ser_thr_pkinase. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PANTHER | PTHR22986:SF84. Pak_like. 1 hit. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Pfam | PF00786. PBD. 1 hit. PF00069. Pkinase. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ProDom | PD000001. Prot_kinase. 1 hit. [Graphical view] [Entries sharing at least one domain] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SMART | SM00285. PBD. 1 hit. SM00220. S_TKc. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PROSITE | PS50108. CRIB. 1 hit. PS00107. PROTEIN_KINASE_ATP. 1 hit. PS50011. PROTEIN_KINASE_DOM. 1 hit. PS00108. PROTEIN_KINASE_ST. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Other Resources | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| NextBio | 19488. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entry information
| Entry name | PAK1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q13153 Secondary accession number(s): O75561 Q86W79 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| Human chromosome 11 Human chromosome 11: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| Human and mouse protein kinases Human and mouse protein kinases: classification and index |
| SIMILARITY comments Index of protein domains and families |

Clusters with


