Q13153 (PAK1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 151.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Serine/threonine-protein kinase PAK 1 EC=2.7.11.1 Alternative name(s): Alpha-PAK p21-activated kinase 1 Short name=PAK-1 p65-PAK | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 545 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Protein kinase involved in intracellular signaling pathways downstream of integrins and receptor-type kinases that plays an important role in cytoskeleton dynamics, in cell adhesion, migration, proliferation, apoptosis, mitosis, and in vesicle-mediated transport processes. Can directly phosphorylate BAD and protects cells against apoptosis. Activated by interaction with CDC42 and RAC1. Functions as GTPase effector that links the Rho-related GTPases CDC42 and RAC1 to the JNK MAP kinase pathway. Phosphorylates and activates MAP2K1, and thereby mediates activation of downstream MAP kinases. Involved in the reorganization of the actin cytoskeleton, actin stress fibers and of focal adhesion complexes. Phosphorylates the tubulin chaperone TBCB and thereby plays a role in the regulation of microtubule biogenesis and organization of the tubulin cytoskeleton. Plays a role in the regulation of insulin secretion in response to elevated glucose levels. Part of a ternary complex that contains PAK1, DVL1 and MUSK that is important for MUSK-dependent regulation of AChR clustering during the formation of the neuromuscular junction (NMJ). Activity is inhibited in cells undergoing apoptosis, potentially due to binding of CDC2L1 and CDC2L2. Phosphorylates MYL9/MLC2. Phosphorylates RAF1 at 'Ser-338' and 'Ser-339' resulting in: activation of RAF1, stimulation of RAF1 translocation to mitochondria, phosphorylation of BAD by RAF1, and RAF1 binding to BCL2. Phosphorylates SNAI1 at 'Ser-246' promoting its transcriptional repressor activity by increasing its accumulation in the nucleus. Ref.1 Ref.2 Ref.6 Ref.8 Ref.10 Ref.12 Ref.14 Ref.15 Ref.16 Ref.18 Ref.19 Ref.20 Ref.22 Ref.23 Ref.24 Ref.31 |
| Catalytic activity | ATP + a protein = ADP + a phosphoprotein. Ref.6 Ref.10 Ref.35 |
| Cofactor | Magnesium. |
| Enzyme regulation | Phosphorylation of Thr-84 by OXSR1 inhibits activation By similarity. Activated by binding small G proteins. Binding of GTP-bound CDC42 or RAC1 to the autoregulatory region releases monomers from the autoinhibited dimer, and enables activation by phosphorylation of Thr-423. Ref.6 Ref.11 Ref.13 Ref.34 |
| Subunit structure | Homodimer in its autoinhibited state. Active as monomer. Component of cytoplasmic complexes, which also contains PXN, ARHGEF6 and GIT1. Interacts with NISCH By similarity. Interacts with DVL1; mediates the formation of a DVL1, MUSK and PAK1 ternary complex involved in AChR clustering By similarity. Binds to the caspase-cleaved p110 isoform of CDC2L1 and CDC2L2, p110C, but not the full-length proteins. Interacts with ARHGEF7. Interacts tightly with GTP-bound but not GDP-bound CDC42/P21 and RAC1. Probably found in a ternary complex composed of DSCAM, PAK1 and RAC1. Interacts with DSCAM (via cytoplasmic domain); the interaction is direct and enhanced in presence of RAC1. Interacts with SCRIB. Interacts with PDPK1. Interacts (via kinase domain) with RAF1. Interacts with NCK1 and NCK2. Interacts with TBCB. Interacts with CRIPAK. Interacts with BRSK2. Interacts with SNAI1. Ref.9 Ref.10 Ref.11 Ref.12 Ref.13 Ref.14 Ref.16 Ref.17 Ref.18 Ref.20 Ref.22 Ref.25 Ref.26 Ref.31 Ref.33 Ref.35 |
| Subcellular location | Cytoplasm. Cell junction › focal adhesion. Cell membrane. Note: Recruited to the cell membrane by interaction with CDC42 and RAC1. Recruited to focal adhesions upon activation. Ref.6 Ref.16 |
| Post-translational modification | Autophosphorylated in trans, meaning that in a dimer, one kinase molecule phosphorylates the other one. Activated by autophosphorylation at Thr-423 in response to a conformation change, triggered by interaction with GTP-bound CDC42 or RAC1. Activated by phosphorylation at Thr-423 by BRSK2 and by PDPK1. Phosphorylated by JAK2 in response to PRL; this increases PAK1 kinase activity. Phosphorylated at Ser-21 by PKB/AKT; this reduces interaction with NCK1 and association with focal adhesion sites. Ref.6 Ref.10 Ref.11 Ref.16 Ref.23 Ref.24 Ref.31 Ref.35 |
| Sequence similarities | Belongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. STE20 subfamily. Contains 1 CRIB domain. Contains 1 protein kinase domain. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| itself | 4 | EBI-1307,EBI-1307 | ||
| CDC42 | P60953 | 5 | EBI-1307,EBI-81752 | |
| CDK11B | P21127 | 3 | EBI-1307,EBI-1298 | |
| CRIPAK | Q8N1N5 | 6 | EBI-1307,EBI-1205846 | |
| LIMK1 | P53667 | 5 | EBI-1307,EBI-444403 | |
| RAC1 | P63000 | 8 | EBI-1307,EBI-413628 | |
| RHOU | Q7L0Q8 | 2 | EBI-1019502,EBI-1638043 |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q13153-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q13153-2) Also known as: PAK1B; The sequence of this isoform differs from the canonical sequence as follows: 518-545: HQFLKIAKPLSSLTPLIAAAKEATKNNH → VRKLRFQVFSNFSMIAASIPEDCQAPLQPHSTDCCS |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 545 | 545 | Serine/threonine-protein kinase PAK 1 | PRO_0000086460 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Regions | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 75 – 88 | 14 | CRIB | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 270 – 521 | 252 | Protein kinase | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Nucleotide binding | 276 – 284 | 9 | ATP | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Nucleotide binding | 345 – 347 | 3 | ATP | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 70 – 140 | 71 | Autoregulatory region | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 75 – 105 | 31 | GTPase-binding | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 132 – 270 | 139 | Interaction with CRIPAK | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sites | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Active site | 389 | 1 | Proton acceptor | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 299 | 1 | ATP | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Amino acid modifications | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 21 | 1 | Phosphoserine; by PKB and autocatalysis Ref.16 Ref.24 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 57 | 1 | Phosphoserine; by autocatalysis Ref.24 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 84 | 1 | Phosphothreonine; by OXSR1 By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 131 | 1 | Phosphotyrosine Ref.24 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 142 | 1 | Phosphotyrosine Ref.24 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 144 | 1 | Phosphoserine Ref.30 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 149 | 1 | Phosphoserine Ref.30 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 153 | 1 | Phosphotyrosine; by JAK2 Ref.23 Ref.24 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 174 | 1 | Phosphoserine Ref.24 Ref.30 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 185 | 1 | Phosphothreonine Ref.24 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 199 | 1 | Phosphoserine; by autocatalysis By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 201 | 1 | Phosphotyrosine; by JAK2 Ref.23 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 204 | 1 | Phosphoserine Ref.28 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 212 | 1 | Phosphothreonine Ref.21 Ref.24 Ref.28 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 219 | 1 | Phosphothreonine Ref.28 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 220 | 1 | Phosphoserine Ref.28 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 223 | 1 | Phosphoserine Ref.30 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 225 | 1 | Phosphothreonine By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 230 | 1 | Phosphothreonine Ref.27 Ref.28 Ref.30 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 285 | 1 | Phosphotyrosine; by JAK2 Ref.23 Ref.24 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 423 | 1 | Phosphothreonine; by autocatalysis, BRSK2 and PDPK1 Ref.10 Ref.11 Ref.31 Ref.35 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 518 – 545 | 28 | HQFLK…TKNNH → VRKLRFQVFSNFSMIAASIP EDCQAPLQPHSTDCCS in isoform 2. | VSP_017507 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 515 | 1 | L → V. Corresponds to variant rs35345144 [ dbSNP | Ensembl ]. | VAR_051654 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 83 | 1 | H → L: Abolishes interaction with CDC42, leading to strongly decreased activity; when associated with L-86. Ref.7 Ref.10 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 86 | 1 | H → L: Abolishes interaction with CDC42, leading to strongly decreased activity; when associated with L-83. Ref.7 Ref.10 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 107 | 1 | L → F: Abolishes autoinhibition, leading to constitutive kinase activity. Ref.10 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 299 | 1 | K → R: Strongly decreases activity. Abolishes kinase activity; when associated with N-389. Ref.35 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 389 | 1 | D → N: Abolishes kinase activity; when associated with R-299. Ref.35 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 393 | 1 | D → A: Abolishes autophosphorylation at Thr-423. | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 423 | 1 | T → A: Decreases CDC42-stimulated activity and autophosphorylation. Ref.10 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 423 | 1 | T → E: Constitutive kinase activity. Ref.10 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 26 | 1 | A → V in AAA65441. Ref.2 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 26 | 1 | A → V in AAC24716. Ref.3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 237 | 1 | R → L in AAC50590. Ref.1 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 379 | 1 | F → S in AAC50590. Ref.1 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 503 | 1 | E → D in AAA65441. Ref.2 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 79 – 87 | 9 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 91 – 94 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 195 – 198 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 214 – 219 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 250 – 260 | 11 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 261 – 264 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 266 – 268 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 274 – 279 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 282 – 289 | 8 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 290 – 292 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 295 – 302 | 8 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 303 – 305 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 309 – 321 | 13 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 330 – 336 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 339 – 345 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 352 – 358 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 363 – 382 | 20 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 392 – 394 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 395 – 397 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 403 – 405 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 416 – 418 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 428 – 430 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 433 – 437 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 444 – 459 | 16 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 463 – 466 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 469 – 479 | 11 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 487 – 489 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 492 – 501 | 10 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 506 – 508 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 512 – 515 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 519 – 523 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 527 – 530 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 531 – 540 | 10 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Human Ste20 homologue hPAK1 links GTPases to the JNK MAP kinase pathway." Brown J.L., Stowers L., Baer M., Trejo J., Coughlin S., Chant J. Curr. Biol. 6:598-605(1996) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION. Tissue: Placenta. |
| [2] | "Human p21-activated kinase (Pak1) regulates actin organization in mammalian cells." Sells M.A., Knaus U.G., Bagrodia S., Ambrose D.M., Bokoch G.M., Chernoff J. Curr. Biol. 7:202-210(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION. |
| [3] | "Human PAK1B." Reid T., Aspenstroem P., Bertoglio J. Submitted (JUN-1998) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2). |
| [4] | "Human chromosome 11 DNA sequence and analysis including novel gene identification." Taylor T.D., Noguchi H., Totoki Y., Toyoda A., Kuroki Y., Dewar K., Lloyd C., Itoh T., Takeda T., Kim D.-W., She X., Barlow K.F., Bloom T., Bruford E., Chang J.L., Cuomo C.A., Eichler E., FitzGerald M.G. Sakaki Y.Nature 440:497-500(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [6] | "Expression of constitutively active alpha-PAK reveals effects of the kinase on actin and focal complexes." Manser E., Huang H.Y., Loo T.H., Chen X.Q., Dong J.M., Leung T., Lim L. Mol. Cell. Biol. 17:1129-1143(1997) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, CATALYTIC ACTIVITY, AUTOPHOSPHORYLATION, ENZYME REGULATION, SUBCELLULAR LOCATION. |
| [7] | "Differential effects of PAK1-activating mutations reveal activity-dependent and -independent effects on cytoskeletal regulation." Frost J.A., Khokhlatchev A., Stippec S., White M.A., Cobb M.H. J. Biol. Chem. 273:28191-28198(1998) [PubMed] [Europe PMC] [Abstract] Cited for: MUTAGENESIS OF HIS-83 AND HIS-86. |
| [8] | "A conserved negative regulatory region in alphaPAK: inhibition of PAK kinases reveals their morphological roles downstream of Cdc42 and Rac1." Zhao Z.S., Manser E., Chen X.Q., Chong C., Leung T., Lim L. Mol. Cell. Biol. 18:2153-2163(1998) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, AUTOREGULATORY DOMAIN. |
| [9] | "Identification of Grb4/Nckbeta, a src homology 2 and 3 domain-containing adapter protein having similar binding and biological properties to Nck." Braverman L.E., Quilliam L.A. J. Biol. Chem. 274:5542-5549(1999) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH NCK1 AND NCK2. |
| [10] | "Identification of a central phosphorylation site in p21-activated kinase regulating autoinhibition and kinase activity." Zenke F.T., King C.C., Bohl B.P., Bokoch G.M. J. Biol. Chem. 274:32565-32573(1999) [PubMed] [Europe PMC] [Abstract] Cited for: CATALYTIC ACTIVITY, AUTOPHOSPHORYLATION, AUTOREGULATORY REGION, FUNCTION, INTERACTION WITH CDC42, PHOSPHORYLATION AT THR-423, MUTAGENESIS OF HIS-83; HIS-86; LEU-107 AND THR-423. |
| [11] | "p21-activated kinase (PAK1) is phosphorylated and activated by 3-phosphoinositide-dependent kinase-1 (PDK1)." King C.C., Gardiner E.M., Zenke F.T., Bohl B.P., Newton A.C., Hemmings B.A., Bokoch G.M. J. Biol. Chem. 275:41201-41209(2000) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION AT THR-423 BY PDPK1, INTERACTION WITH PDPK1, ENZYME REGULATION. |
| [12] | "Interaction between active Pak1 and Raf-1 is necessary for phosphorylation and activation of Raf-1." Zang M., Hayne C., Luo Z. J. Biol. Chem. 277:4395-4405(2002) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION IN PHOSPHORYLATION OF RAF1, INTERACTION WITH RAF1. |
| [13] | "Pak1 kinase homodimers are autoinhibited in trans and dissociated upon activation by Cdc42 and Rac1." Parrini M.C., Lei M., Harrison S.C., Mayer B.J. Mol. Cell 9:73-83(2002) [PubMed] [Europe PMC] [Abstract] Cited for: SUBUNIT, ENZYME REGULATION. |
| [14] | "The C-terminal kinase domain of the p34cdc2-related PITSLRE protein kinase (p110C) associates with p21-activated kinase 1 and inhibits its activity during anoikis." Chen S., Yin X., Zhu X., Yan J., Ji S., Chen C., Cai M., Zhang S., Zong H., Hu Y., Yuan Z., Shen Z., Gu J. J. Biol. Chem. 278:20029-20036(2003) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH CDC2L1 AND CDC2L2. |
| [15] | "PAK1 phosphorylation of MEK1 regulates fibronectin-stimulated MAPK activation." Slack-Davis J.K., Eblen S.T., Zecevic M., Boerner S.A., Tarcsafalvi A., Diaz H.B., Marshall M.S., Weber M.J., Parsons J.T., Catling A.D. J. Cell Biol. 162:281-291(2003) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [16] | "Akt phosphorylation of serine 21 on Pak1 modulates Nck binding and cell migration." Zhou G.L., Zhuo Y., King C.C., Fryer B.H., Bokoch G.M., Field J. Mol. Cell. Biol. 23:8058-8069(2003) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION AT SER-21, MASS SPECTROMETRY, FUNCTION, INTERACTION WITH NCK1, SUBCELLULAR LOCATION. |
| [17] | "The Down syndrome cell adhesion molecule (DSCAM) interacts with and activates Pak." Li W., Guan K.L. J. Biol. Chem. 279:32824-32831(2004) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH DSCAM. |
| [18] | "Pak1 phosphorylation of snail, a master regulator of epithelial-to-mesenchyme transition, modulates snail's subcellular localization and functions." Yang Z., Rayala S., Nguyen D., Vadlamudi R.K., Chen S., Kumar R. Cancer Res. 65:3179-3184(2005) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH SNAI1. |
| [19] | "Integrin engagement differentially modulates epithelial cell motility by RhoA/ROCK and PAK1." Zhou H., Kramer R.H. J. Biol. Chem. 280:10624-10635(2005) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [20] | "p21-activated kinase 1 regulates microtubule dynamics by phosphorylating tubulin cofactor B." Vadlamudi R.K., Barnes C.J., Rayala S., Li F., Balasenthil S., Marcus S., Goodson H.V., Sahin A.A., Kumar R. Mol. Cell. Biol. 25:3726-3736(2005) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH TBCB. |
| [21] | "A probability-based approach for high-throughput protein phosphorylation analysis and site localization." Beausoleil S.A., Villen J., Gerber S.A., Rush J., Gygi S.P. Nat. Biotechnol. 24:1285-1292(2006) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-212, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [22] | "CRIPak, a novel endogenous Pak1 inhibitor." Talukder A.H., Meng Q., Kumar R. Oncogene 25:1311-1319(2006) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH CRIPAK. |
| [23] | "JAK2 tyrosine kinase phosphorylates PAK1 and regulates PAK1 activity and functions." Rider L., Shatrova A., Feener E.P., Webb L., Diakonova M. J. Biol. Chem. 282:30985-30996(2007) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, PHOSPHORYLATION AT TYR-153; TYR-201 AND TYR-285, MASS SPECTROMETRY. |
| [24] | "Identification of phosphorylation sites in betaPIX and PAK1." Mayhew M.W., Jeffery E.D., Sherman N.E., Nelson K., Polefrone J.M., Pratt S.J., Shabanowitz J., Parsons J.T., Fox J.W., Hunt D.F., Horwitz A.F. J. Cell Sci. 120:3911-3918(2007) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, PHOSPHORYLATION AT SER-21; SER-57; TYR-131; TYR-142; TYR-153; SER-174; THR-185; THR-212 AND TYR-285, MASS SPECTROMETRY. |
| [25] | "Affixin activates Rac1 via betaPIX in C2C12 myoblast." Matsuda C., Kameyama K., Suzuki A., Mishima W., Yamaji S., Okamoto H., Nishino I., Hayashi Y.K. FEBS Lett. 582:1189-1196(2008) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH RAC1 AND CDC42. |
| [26] | "Scrib regulates PAK activity during the cell migration process." Nola S., Sebbagh M., Marchetto S., Osmani N., Nourry C., Audebert S., Navarro C., Rachel R., Montcouquiol M., Sans N., Etienne-Manneville S., Borg J.-P., Santoni M.-J. Hum. Mol. Genet. 17:3552-3565(2008) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH SCRIB. |
| [27] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-230, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [28] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-204; THR-212; THR-219; SER-220 AND THR-230, MASS SPECTROMETRY. Tissue: Leukemic T-cell. |
| [29] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [30] | "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation." Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B. Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-144; SER-149; SER-174; SER-223 AND THR-230, MASS SPECTROMETRY. |
| [31] | "Synapses of amphids defective (SAD-A) kinase promotes glucose-stimulated insulin secretion through activation of p21-activated kinase (PAK1) in pancreatic beta-Cells." Nie J., Sun C., Faruque O., Ye G., Li J., Liang Q., Chang Z., Yang W., Han X., Shi Y. J. Biol. Chem. 287:26435-26444(2012) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH BRSK2, PHOSPHORYLATION AT THR-423. |
| [32] | "Structure of PAK1 in an autoinhibited conformation reveals a multistage activation switch." Lei M., Lu W., Meng W., Parrini M.C., Eck M.J., Mayer B.J., Harrison S.C. Cell 102:387-397(2000) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.3 ANGSTROMS) OF 70-545. |
| [33] | "Structural analysis of the SH3 domain of beta-PIX and its interaction with alpha-p21 activated kinase (PAK)." Mott H.R., Nietlispach D., Evetts K.A., Owen D. Biochemistry 44:10977-10983(2005) [PubMed] [Europe PMC] [Abstract] Cited for: STRUCTURE BY NMR OF 183-204 IN COMPLEX WITH ARHGEF7, INTERACTION WITH ARHGEF7. |
| [34] | "The active conformation of the PAK1 kinase domain." Lei M., Robinson M.A., Harrison S.C. Structure 13:769-778(2005) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (1.8 ANGSTROMS) OF 249-545, ENZYME REGULATION. |
| [35] | "Structural insights into the autoactivation mechanism of p21-activated protein kinase." Wang J., Wu J.W., Wang Z.X. Structure 19:1752-1761(2011) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (1.80 ANGSTROMS) OF 248-545 OF MUTANT ARG-299 IN COMPLEX WITH ATP ANALOG AMP-PNP, MUTAGENESIS OF LYS-299 AND ASP-389, CATALYTIC ACTIVITY, AUTOPHOSPHORYLATION, SUBUNIT, PHOSPHORYLATION AT THR-423. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | U51120 mRNA. Translation: AAC50590.1. U24152 mRNA. Translation: AAA65441.1. AF071884 mRNA. Translation: AAC24716.1. AP000486 Genomic DNA. No translation available. AP003680 Genomic DNA. No translation available. BC109299 mRNA. Translation: AAI09300.1. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| IPI | IPI00289746. IPI00656138. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PIR | G01773. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| RefSeq | NP_001122092.1. NM_001128620.1. NP_002567.3. NM_002576.4. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| UniGene | Hs.435714. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ProteinModelPortal | Q13153. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| DIP | DIP-31016N. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| IntAct | Q13153. 34 interactions. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| MINT | MINT-92897. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| STRING | 9606.ENSP00000278568. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PhosphoSite | Q13153. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Polymorphism databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| DMDM | 90111767. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PaxDb | Q13153. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PRIDE | Q13153. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| DNASU | 5058. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Ensembl | ENST00000278568; ENSP00000278568; ENSG00000149269. ENST00000356341; ENSP00000348696; ENSG00000149269. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GeneID | 5058. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| KEGG | hsa:5058. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| UCSC | uc001oyg.4. human. uc001oyh.4. human. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| CTD | 5058. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GeneCards | GC11M077033. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HGNC | HGNC:8590. PAK1. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HPA | CAB005312. HPA003565. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| MIM | 602590. gene. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| neXtProt | NX_Q13153. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PharmGKB | PA32917. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| eggNOG | COG0515. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HOGENOM | HOG000234202. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HOVERGEN | HBG108518. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| KO | K04409. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| OMA | TPTRDVA. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| OrthoDB | EOG45DWP5. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| BRENDA | 2.7.11.1. 2681. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Pathway_Interaction_DB | angiopoietinreceptor_pathway. Angiopoietin receptor Tie2-mediated signaling. aurora_a_pathway. Aurora A signaling. epha2_fwdpathway. EPHA2 forward signaling. ephbfwdpathway. EPHB forward signaling. p38alphabetapathway. Regulation of p38-alpha and p38-beta. s1p_s1p2_pathway. S1P2 pathway. met_pathway. Signaling events activated by Hepatocyte Growth Factor Receptor (c-Met). vegfr1_2_pathway. Signaling events mediated by VEGFR1 and VEGFR2. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Reactome | REACT_111045. Developmental Biology. REACT_111155. Cell-Cell communication. REACT_6900. Immune System. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ArrayExpress | Q13153. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Bgee | Q13153. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| CleanEx | HS_PAK1. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Genevestigator | Q13153. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GermOnline | ENSG00000149269. Homo sapiens. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| InterPro | IPR011009. Kinase-like_dom. IPR000095. PAK_box_Rho-bd. IPR000719. Prot_kinase_cat_dom. IPR017441. Protein_kinase_ATP_BS. IPR002290. Ser/Thr_dual-sp_kinase_dom. IPR008271. Ser/Thr_kinase_AS. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Pfam | PF00786. PBD. 1 hit. PF00069. Pkinase. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SMART | SM00285. PBD. 1 hit. SM00220. S_TKc. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SUPFAM | SSF56112. Kinase_like. 1 hit. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PROSITE | PS50108. CRIB. 1 hit. PS00107. PROTEIN_KINASE_ATP. 1 hit. PS50011. PROTEIN_KINASE_DOM. 1 hit. PS00108. PROTEIN_KINASE_ST. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Other | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| BindingDB | Q13153. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ChEMBL | CHEMBL4600. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ChiTaRS | PAK1. human. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| EvolutionaryTrace | Q13153. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GenomeRNAi | 5058. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| NextBio | 19488. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entry information
| Entry name | PAK1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q13153 Secondary accession number(s): O75561 Q86W79 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human and mouse protein kinases Human and mouse protein kinases: classification and index |
| Human chromosome 11 Human chromosome 11: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
