Reviewed,
UniProtKB/Swiss-Prot Q13153 (PAK1_HUMAN)
Last modified
November 25, 2008.
Version 101.
History...
Clusters with 100%,
90%,
50% identity |
Documents (5) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Serine/threonine-protein kinase PAK 1 EC=2.7.11.1 Alternative name(s): p21-activated kinase 1 Short name=PAK-1 p65-PAK Alpha-PAK | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 545 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | The activated kinase acts on a variety of targets. Likely to be the GTPase effector that links the Rho-related GTPases to the JNK MAP kinase pathway. Activated by CDC42 and RAC1. Involved in dissolution of stress fibers and reorganization of focal complexes. Involved in regulation of microtubule biogenesis through phosphorylation of TBCB. Activity is inhibited in cells undergoing apoptosis, potentially due to binding of CDC2L1 and CDC2L2. |
| Catalytic activity | ATP + a protein = ADP + a phosphoprotein. |
| Cofactor | Magnesium. |
| Enzyme regulation | Activated by binding small G proteins. Binding of GTP-bound CDC42 or RAC1 to the autoregulatory region releases monomers from the autoinhibited dimer, enables phosphorylation of Thr-423 and allows the kinase domain to adopt an active structure. Also activated by binding to GTP-bound CDC42, independent of the phosphorylation state of Thr-423. Phosphorylation of Thr-84 by OXSR1 inhibits this activation By similarity. |
| Subunit structure | Homodimer in its autoinhibited state. Active as monomer. Interacts tightly with GTP-bound but not GDP-bound CDC42/P21 and RAC1. Binds to the caspase-cleaved p110 isoform of CDC2L1 and CDC2L2, p110C, but not the full-length proteins. Component of cytoplasmic complexes, which also contain PXN, ARHGEF6 and GIT1. Interacts with ARHGEF7. Also interacts with CRIPAK. Interacts with NISCH By similarity. |
| Subcellular location | Cytoplasm. Cell junction › focal adhesion. Note= Recruited to focal adhesions upon activation. |
| Post-translational modification | Autophosphorylated when activated by CDC42/p21 and RAC1. |
| Sequence similarities | Belongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. STE20 subfamily. Contains 1 CRIB domain. Contains 1 protein kinase domain. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| CDC2L1 | P21127 | 2 | EBI-1307,EBI-1298 | |
| CDC42 | P60953 | 2 | EBI-1307,EBI-81752 | |
| CRIPAK | Q8N1N5 | 5 | EBI-1307,EBI-1205846 | |
| RAC1 | P63000 | 3 | EBI-1307,EBI-413628 | |
| RHOU | Q7L0Q8 | 1 | EBI-1019502,EBI-1638043 | |
| RHOU | Q7L0Q8 | 1 | EBI-1307,EBI-1638043 |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q13153-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q13153-2) Also known as: PAK1B; The sequence of this isoform differs from the canonical sequence as follows: 518-545: HQFLKIAKPLSSLTPLIAAAKEATKNNH → VRKLRFQVFSNFSMIAASIPEDCQAPLQPHSTDCCS |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 545 | 545 | Serine/threonine-protein kinase PAK 1 | PRO_0000086460 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 75 – 88 | 14 | CRIB | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 270 – 521 | 252 | Protein kinase | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Nucleotide binding | 276 – 284 | 9 | ATP By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 70 – 140 | 71 | Autoregulatory region | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 75 – 105 | 31 | GTPase-binding By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 132 – 270 | 139 | Interaction with CRIPAK | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sites | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Active site | 389 | 1 | Proton acceptor | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 299 | 1 | ATP By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 21 | 1 | Phosphoserine; by autocatalysis By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 57 | 1 | Phosphoserine; by autocatalysis By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 84 | 1 | Phosphothreonine; by OXSR1 By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 144 | 1 | Phosphoserine; by autocatalysis By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 149 | 1 | Phosphoserine; by autocatalysis By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 199 | 1 | Phosphoserine; by autocatalysis By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 204 | 1 | Phosphoserine; by autocatalysis By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 212 | 1 | Phosphothreonine | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 220 | 1 | Phosphoserine By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 223 | 1 | Phosphoserine By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 225 | 1 | Phosphothreonine By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 230 | 1 | Phosphothreonine | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 423 | 1 | Phosphothreonine; by autocatalysis Probable | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 518 – 545 | 28 | HQFLK…TKNNH → VRKLRFQVFSNFSMIAASIP EDCQAPLQPHSTDCCS in isoform 2. | VSP_017507 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 83 | 1 | H → L: Decreases activity; when associated with L-86 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 86 | 1 | H → L: Decreases activity; when associated with L-83 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 107 | 1 | L → F: Constitutively active | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 423 | 1 | T → A: Decreases CDC42-stimulated activity and autophosphorylation | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 26 | 1 | A → V in AAA65441. Ref.2 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 26 | 1 | A → V in AAC24716. Ref.3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 237 | 1 | R → L in AAC50590. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 379 | 1 | F → S in AAC50590. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 503 | 1 | E → D in AAA65441. Ref.2 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 80 – 90 | 11 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 91 – 94 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 95 – 98 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 101 – 108 | 8 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 114 – 119 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 121 – 135 | 15 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 195 – 198 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 252 – 257 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 258 – 260 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 266 – 269 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 275 – 279 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 282 – 289 | 8 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 290 – 292 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 295 – 300 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 309 – 319 | 11 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 330 – 334 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 341 – 345 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 349 – 351 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 352 – 358 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 363 – 382 | 20 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 392 – 394 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 395 – 397 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 403 – 405 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 408 – 410 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 433 – 436 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 444 – 459 | 16 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 463 – 466 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 469 – 478 | 10 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 487 – 489 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 492 – 501 | 10 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 506 – 508 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 512 – 515 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 519 – 523 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 527 – 529 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 531 – 539 | 9 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Human Ste20 homologue hPAK1 links GTPases to the JNK MAP kinase pathway." Brown J.L., Stowers L., Baer M., Trejo J., Coughlin S., Chant J. Curr. Biol. 6:598-605(1996) [PubMed: 8805275] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Placenta. |
| [2] | "Human p21-activated kinase (Pak1) regulates actin organization in mammalian cells." Sells M.A., Knaus U.G., Bagrodia S., Ambrose D.M., Bokoch G.M., Chernoff J. Curr. Biol. 7:202-210(1997) [PubMed: 9395435] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [3] | "Human PAK1B." Reid T., Aspenstroem P., Bertoglio J. Submitted (JUN-1998) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2). |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [5] | "Expression of constitutively active alpha-PAK reveals effects of the kinase on actin and focal complexes." Manser E., Huang H.Y., Loo T.H., Chen X.Q., Dong J.M., Leung T., Lim L. Mol. Cell. Biol. 17:1129-1143(1997) [PubMed: 9032240] [Abstract] Cited for: ENZYME REGULATION, SUBCELLULAR LOCATION. |

Clusters with