Q13126 (MTAP_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 139.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: S-methyl-5'-thioadenosine phosphorylase EC=2.4.2.28 Alternative name(s): 5'-methylthioadenosine phosphorylase Short name=MTA phosphorylase Short name=MTAP Short name=MTAPase | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 283 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Catalyzes the reversible phosphorylation of S-methyl-5'-thioadenosine (MTA) to adenine and 5-methylthioribose-1-phosphate. Involved in the breakdown of MTA, a major by-product of polyamine biosynthesis. Responsible for the first step in the methionine salvage pathway after MTA has been generated from S-adenosylmethionine. Has broad substrate specificity with 6-aminopurine nucleosides as preferred substrates. Ref.8 |
| Catalytic activity | S-methyl-5'-thioadenosine + phosphate = adenine + S-methyl-5-thio-alpha-D-ribose 1-phosphate. HAMAP-Rule MF_03155 |
| Enzyme regulation | Inhibited by 5'-methylthiotubercin and 5'-chloroformycin. HAMAP-Rule MF_03155 |
| Pathway | Amino-acid biosynthesis; L-methionine biosynthesis via salvage pathway; S-methyl-5-thio-alpha-D-ribose 1-phosphate from S-methyl-5'-thioadenosine (phosphorylase route): step 1/1. HAMAP-Rule MF_03155 |
| Subunit structure | |
| Subcellular location | |
| Tissue specificity | Ubiquitously expressed. |
| Involvement in disease | Diaphyseal medullary stenosis with malignant fibrous histiocytoma (DMSMFH) [MIM:112250]: An autosomal dominant bone dysplasia characterized by pathologic fractures due to abnormal cortical growth and diaphyseal medullary stenosis. The fractures heal poorly, and there is progressive bowing of the lower extremities. Some patients show a limb-girdle myopathy, with muscle weakness and atrophy. Approximately 35% of affected individuals develop an aggressive form of bone sarcoma consistent with malignant fibrous histiocytoma or osteosarcoma. Loss of MTAP activity may play a role in human cancer. MTAP loss has been reported in a number of cancers, including osteosarcoma, malignant melanoma and gastric cancer. |
| Sequence similarities | Belongs to the PNP/MTAP phosphorylase family. MTAP subfamily. |
| Biophysicochemical properties | Kinetic parameters: KM=5 µM for S-methyl-5'-thioadenosine Ref.8 Ref.9 KM=580 µM for phosphate KM=23 µM for adenine KM=8 µM for S-methyl-5-thio-alpha-D-ribose 1-phosphate pH dependence: Optimum pH is 7.2-7.6. |
Ontologies
Alternative products
| This entry describes 7 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q13126-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q13126-2) Also known as: MTAP_v1; The sequence of this isoform differs from the canonical sequence as follows: 272-283: NMAQFSVLLPRH → MIKFQMILSE...KDQTYICMKS | ||||||
| Isoform 3 (identifier: Q13126-3) Also known as: MTAP_v2; The sequence of this isoform differs from the canonical sequence as follows: 272-283: NMAQFSVLLPRH → MIKFQMILSEGYHPFNIQESPFYRGLLDFPSVGHGRGEILPLSPLDLAGYCFQQPMQPPCPDS | ||||||
| Isoform 4 (identifier: Q13126-4) Also known as: MTAP_v3; The sequence of this isoform differs from the canonical sequence as follows: 272-283: NMAQFSVLLPRH → VRSAFQLPP | ||||||
| Isoform 5 (identifier: Q13126-5) Also known as: MTAP_v4; The sequence of this isoform differs from the canonical sequence as follows: 231-283: VSVDRVLKTL...AQFSVLLPRH → MIKFQMILSE...KDQTYICMKS | ||||||
| Isoform 6 (identifier: Q13126-6) Also known as: MTAP_v5; The sequence of this isoform differs from the canonical sequence as follows: 231-283: VSVDRVLKTL...AQFSVLLPRH → MIKFQMILSE...QPMQPPCPDS | ||||||
| Isoform 7 (identifier: Q13126-7) Also known as: MTAP_v6; The sequence of this isoform differs from the canonical sequence as follows: 232-283: SVDRVLKTLKENANKAKSLLLTTIPQIGSTEWSETLHNLKNMAQFSVLLPRH → RSAFQLPP |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 283 | 283 | S-methyl-5'-thioadenosine phosphorylase HAMAP-Rule MF_03155 | PRO_0000184545 | |||||||||||||||||||||||||||||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 60 – 61 | 2 | Phosphate binding HAMAP-Rule MF_03155 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 93 – 94 | 2 | Phosphate binding HAMAP-Rule MF_03155 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 220 – 222 | 3 | Substrate binding HAMAP-Rule MF_03155 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
Sites | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 18 | 1 | Phosphate | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 196 | 1 | Substrate; via amide nitrogen | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 197 | 1 | Phosphate | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Site | 178 | 1 | Important for substrate specificity | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Site | 233 | 1 | Important for substrate specificity | ||||||||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 231 – 283 | 53 | VSVDR…LLPRH → MIKFQMILSEGYHPFNIQES PFYRGLLDFPSVGHGRGKKC LSAPAIILRPPQPRGTVTTF KVSWSKDQTYICMKS in isoform 5. | VSP_044071 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 231 – 283 | 53 | VSVDR…LLPRH → MIKFQMILSEGYHPFNIQES PFYRGLLDFPSVGHGRGEIL PLSPLDLAGYCFQQPMQPPC PDS in isoform 6. | VSP_044072 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 232 – 283 | 52 | SVDRV…LLPRH → RSAFQLPP in isoform 7. | VSP_044073 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 272 – 283 | 12 | NMAQF…LLPRH → MIKFQMILSEGYHPFNIQES PFYRGLLDFPSVGHGRGKKC LSAPAIILRPPQPRGTVTTF KVSWSKDQTYICMKS in isoform 2. | VSP_044074 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 272 – 283 | 12 | NMAQF…LLPRH → MIKFQMILSEGYHPFNIQES PFYRGLLDFPSVGHGRGEIL PLSPLDLAGYCFQQPMQPPC PDS in isoform 3. | VSP_044075 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 272 – 283 | 12 | NMAQF…LLPRH → VRSAFQLPP in isoform 4. | VSP_044076 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 56 | 1 | V → I. Ref.1 Ref.4 Ref.7 Corresponds to variant rs7023954 [ dbSNP | Ensembl ]. | VAR_031470 | |||||||||||||||||||||||||||||||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 218 | 1 | A → G in AAG38871. Ref.2 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 218 | 1 | A → G in AAR24607. Ref.2 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 11 – 16 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 23 – 25 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 26 – 32 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 45 – 50 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 53 – 59 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 60 – 65 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 69 – 71 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 74 – 83 | 10 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 87 – 97 | 11 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 107 – 109 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 112 – 116 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 126 – 128 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 134 – 136 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 140 – 142 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 146 – 158 | 13 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 163 – 165 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 168 – 172 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 180 – 188 | 9 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 193 – 197 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 198 – 207 | 10 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 211 – 220 | 10 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 222 – 224 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 225 – 228 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 233 – 258 | 26 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 264 – 275 | 12 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Construction of a 2.8-megabase yeast artificial chromosome contig and cloning of the human methylthioadenosine phosphorylase gene from the tumor suppressor region on 9p21." Olopade O.I., Pomykala H.M., Hagos F., Sveen L.W., Espinosa R. III, Dreyling M.H., Gursky S., Stadler W.M., le Beau M.M., Bohlander S.K. Proc. Natl. Acad. Sci. U.S.A. 92:6489-6493(1995) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA], VARIANT ILE-56. Tissue: Epidermis. |
| [2] | "Genomic cloning of methylthioadenosine phosphorylase: a purine metabolic enzyme deficient in multiple different cancers." Nobori T., Takabayashi K., Tran P., Orvis L., Batova A., Yu A.L., Carson D.A. Proc. Natl. Acad. Sci. U.S.A. 93:6203-6208(1996) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA]. Tissue: Placenta. |
| [3] | "Primate genome gain and loss: a bone dysplasia, muscular dystrophy, and bone cancer syndrome resulting from mutated retroviral-derived MTAP transcripts." Camacho-Vanegas O., Camacho S.C., Till J., Miranda-Lorenzo I., Terzo E., Ramirez M.C., Schramm V., Cordovano G., Watts G., Mehta S., Kimonis V., Hoch B., Philibert K.D., Raabe C.A., Bishop D.F., Glucksman M.J., Martignetti J.A. Am. J. Hum. Genet. 90:614-627(2012) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2; 3; 4; 5; 6 AND 7), INVOLVEMENT IN DMSMFH. |
| [4] | "Identification of human methylthioadenosine phosphorylase (MTAP) mRNA mutation in colon cancer cell line COLO 205." Li Q., Cao W.-X., Zhang Y., Shi M.-M., Liu B.-Y., Zhu Z.-G., Lin Y.-Z. Submitted (AUG-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA], VARIANT ILE-56. Tissue: Colon. |
| [5] | "DNA sequence and analysis of human chromosome 9." Humphray S.J., Oliver K., Hunt A.R., Plumb R.W., Loveland J.E., Howe K.L., Andrews T.D., Searle S., Hunt S.E., Scott C.E., Jones M.C., Ainscough R., Almeida J.P., Ambrose K.D., Ashwell R.I.S., Babbage A.K., Babbage S., Bagguley C.L. Dunham I.Nature 429:369-374(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [7] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA], VARIANT ILE-56. Tissue: Brain. |
| [8] | "Purification and characterization of 5'-deoxy-5'-methylthioadenosine phosphorylase from human placenta." Della Ragione F., Carteni-Farina M., Gragnaniello V., Schettino M.I., Zappia V. J. Biol. Chem. 261:12324-12329(1986) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, BIOPHYSICOCHEMICAL PROPERTIES, SUBUNIT. |
| [9] | "Purification and characterization of recombinant human 5'-methylthioadenosine phosphorylase: definite identification of coding cDNA." Ragione F.D., Takabayashi K., Mastropietro S., Mercurio C., Oliva A., Russo G.L., Pietra V.D., Borriello A., Nobori T., Carson D.A., Zappia V. Biochem. Biophys. Res. Commun. 223:514-519(1996) [PubMed] [Europe PMC] [Abstract] Cited for: BIOPHYSICOCHEMICAL PROPERTIES, SUBUNIT. |
| [10] | "Methylthioadenosine phosphorylase gene deletions are common in osteosarcoma." Garcia-Castellano J.M., Villanueva A., Healey J.H., Sowers R., Cordon-Cardo C., Huvos A., Bertino J.R., Meyers P., Gorlick R. Clin. Cancer Res. 8:782-787(2002) [PubMed] [Europe PMC] [Abstract] Cited for: INVOLVEMENT IN OSTEOSARCOMA. |
| [11] | "Methylthioadenosine phosphorylase deficiency in Japanese osteosarcoma patients." Miyazaki S., Nishioka J., Shiraishi T., Matsumine A., Uchida A., Nobori T. Int. J. Oncol. 31:1069-1076(2007) [PubMed] [Europe PMC] [Abstract] Cited for: INVOLVEMENT IN OSTEOSARCOMA. |
| [12] | "Direct and tumor microenvironment mediated influences of 5'-deoxy-5'-(methylthio)adenosine on tumor progression of malignant melanoma." Stevens A.P., Spangler B., Wallner S., Kreutz M., Dettmer K., Oefner P.J., Bosserhoff A.K. J. Cell. Biochem. 106:210-219(2009) [PubMed] [Europe PMC] [Abstract] Cited for: INVOLVEMENT IN MALIGNANT MELANOMA. |
| [13] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [14] | "Downregulation of methylthioadenosine phosphorylase by homozygous deletion in gastric carcinoma." Kim J., Kim M.A., Min S.Y., Jee C.D., Lee H.E., Kim W.H. Genes Chromosomes Cancer 50:421-433(2011) [PubMed] [Europe PMC] [Abstract] Cited for: INVOLVEMENT IN GASTRIC CANCER. |
| [15] | "The structure of human 5'-deoxy-5'-methylthioadenosine phosphorylase at 1.7-A resolution provides insights into substrate binding and catalysis." Appleby T.C., Erion M.D., Ealick S.E. Structure 7:629-641(1999) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (1.7 ANGSTROMS) IN COMPLEX WITH MTA. |
| [16] | "Structural comparison of MTA phosphorylase and MTA/AdoHcy nucleosidase explains substrate preferences and identifies regions exploitable for inhibitor design." Lee J.E., Settembre E.C., Cornell K.A., Riscoe M.K., Sufrin J.R., Ealick S.E., Howell P.L. Biochemistry 43:5159-5169(2004) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.03 ANGSTROMS) IN COMPLEX WITH SUBSTRATE ANALOGS. |
| [17] | "Picomolar transition state analogue inhibitors of human 5'-methylthioadenosine phosphorylase and X-ray structure with MT-immucillin-A." Singh V., Shi W., Evans G.B., Tyler P.C., Furneaux R.H., Almo S.C., Schramm V.L. Biochemistry 43:9-18(2004) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (1.95 ANGSTROMS) IN COMPLEX WITH INHIBITORS. |
| [18] | "The impact of human leukocyte antigen (HLA) micropolymorphism on ligand specificity within the HLA-B*41 allotypic family." Bade-Doding C., Theodossis A., Gras S., Kjer-Nielsen L., Eiz-Vesper B., Seltsam A., Huyton T., Rossjohn J., McCluskey J., Blasczyk R. Haematologica 96:110-118(2011) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (1.90 ANGSTROMS) OF 227-237. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | U22233 mRNA. Translation: AAA81646.1. L40432 mRNA. Translation: AAG38871.1. L42634 L42633 Genomic DNA. Translation: AAR24607.2.HE654772 mRNA. Translation: CCF77345.1. HE654773 mRNA. Translation: CCF77346.1. HE654774 mRNA. Translation: CCF77347.1. HE654775 mRNA. Translation: CCF77348.1. HE654776 mRNA. Translation: CCF77349.1. HE654777 mRNA. Translation: CCF77350.1. AY712791 mRNA. Translation: AAU04442.1. AL359922 Genomic DNA. Translation: CAI16481.1. CH471071 Genomic DNA. Translation: EAW58606.1. BC026106 mRNA. Translation: AAH26106.1. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| IPI | IPI00011876. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PIR | I38969. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| RefSeq | NP_002442.2. NM_002451.3. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| UniGene | Hs.193268. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ProteinModelPortal | Q13126. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| IntAct | Q13126. 6 interactions. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| MINT | MINT-268764. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| STRING | 9606.ENSP00000369519. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PhosphoSite | Q13126. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Polymorphism databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| DMDM | 143811423. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
2D gel databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| REPRODUCTION-2DPAGE | Q13126. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| UCD-2DPAGE | Q13126. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PaxDb | Q13126. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PRIDE | Q13126. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| DNASU | 4507. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Ensembl | ENST00000380172; ENSP00000369519; ENSG00000099810. ENST00000580900; ENSP00000463424; ENSG00000099810. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GeneID | 4507. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| KEGG | hsa:4507. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| UCSC | uc003zph.3. human. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| CTD | 4507. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GeneCards | GC09P021792. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| H-InvDB | HIX0007954. HIX0025895. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HGNC | HGNC:7413. MTAP. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| MIM | 112250. phenotype. 156540. gene. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| neXtProt | NX_Q13126. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Orphanet | 85182. Diaphyseal medullary stenosis - bone malignancy. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PharmGKB | PA31220. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| eggNOG | COG0005. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HOGENOM | HOG000228986. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HOVERGEN | HBG002487. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| InParanoid | Q13126. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| KO | K00772. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| OMA | VVPDQFI. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| OrthoDB | EOG4B8JDJ. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PhylomeDB | Q13126. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| BioCyc | MetaCyc:HS01913-MONOMER. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Reactome | REACT_111217. Metabolism. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SABIO-RK | Q13126. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| UniPathway | UPA00904; UER00873. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ArrayExpress | Q13126. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Bgee | Q13126. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| CleanEx | HS_MTAP. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Genevestigator | Q13126. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GermOnline | ENSG00000099810. Homo sapiens. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HAMAP | MF_01963. MTAP. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| InterPro | IPR010044. MTAP. IPR000845. Nucleoside_phosphorylase_d. IPR001369. PNP/MTAP. IPR018099. Purine_phosphorylase-2_CS. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PANTHER | PTHR11904. PTHR11904. 1 hit. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Pfam | PF01048. PNP_UDP_1. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| TIGRFAMs | TIGR01694. MTAP. 1 hit. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PROSITE | PS01240. PNP_MTAP_2. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Other | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| BindingDB | Q13126. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ChEMBL | CHEMBL4941. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ChiTaRS | MTAP. human. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| DrugBank | DB00173. Adenine. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| EvolutionaryTrace | Q13126. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GenomeRNAi | 4507. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| NextBio | 17416. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entry information
| Entry name | MTAP_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q13126 Secondary accession number(s): I2G7M5 Q9H010 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 9 Human chromosome 9: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PATHWAY comments Index of metabolic and biosynthesis pathways |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
