Reviewed,
UniProtKB/Swiss-Prot Q13107 (UBP4_HUMAN)
Last modified
February 9, 2010.
Version 95.
History...
Clusters with 100%,
90%,
50% identity |
Documents (6) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Ubiquitin carboxyl-terminal hydrolase 4 EC=3.1.2.15 Alternative name(s): Ubiquitin thioesterase 4 Ubiquitin-specific-processing protease 4 Deubiquitinating enzyme 4 Ubiquitous nuclear protein homolog | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Complete proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 963 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Catalytic activity | Ubiquitin C-terminal thioester + H2O = ubiquitin + a thiol. |
| Subcellular location | |
| Sequence similarities | Belongs to the peptidase C19 family. Contains 1 DUSP domain. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Ubl conjugation pathway |
| Cellular component | Cytoplasm |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Molecular function | Hydrolase Protease Thiol protease |
| PTM | Phosphoprotein |
| Technical term | Complete proteome |
| Gene Ontology (GO) | |
| Biological process | ubiquitin-dependent protein catabolic process Inferred from electronic annotation. Source: InterPro |
| Cellular component | lysosome Traceable author statement. Source: ProtInc nucleusTraceable author statement. Source: ProtInc |
| Molecular function | cysteine-type endopeptidase activity Ref.3 Traceable author statement. Source: ProtInc protein bindingInferred from physical interaction. Source: IntAct ubiquitin thiolesterase activityInferred from electronic annotation. Source: EC ubiquitin-specific protease activity Ref.3Traceable author statement. Source: ProtInc |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform UNPEL (identifier: Q13107-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform UNPES (identifier: Q13107-2) The sequence of this isoform differs from the canonical sequence as follows: 232-279: KSSTAPSRNFTTSPKSSASPYSSVSASLIANGDSTSTCGMHSSGVSRG → N |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 963 | 963 | Ubiquitin carboxyl-terminal hydrolase 4 | PRO_0000080621 | |||||
Regions | |||||||||
| Domain | 11 – 122 | 112 | DUSP | ||||||
Sites | |||||||||
| Active site | 311 | 1 | |||||||
| Active site | 873 | 1 | By similarity | ||||||
| Active site | 881 | 1 | By similarity | ||||||
Amino acid modifications | |||||||||
| Modified residue | 680 | 1 | Phosphoserine By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 232 – 279 | 48 | KSSTA…GVSRG → N in isoform UNPES. | VSP_005258 | |||||
| Natural variant | 620 | 1 | Y → C: dbSNP rs9311440. | VAR_028180 | |||||
Experimental info | |||||||||
| Mutagenesis | 311 | 1 | C → A: Loss of activity. | ||||||
| Sequence conflict | 373 | 1 | R → S in AAB72237. Ref.1 | ||||||
| Sequence conflict | 744 | 1 | S → R in AAB72237. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Elevated expression of Unph, a proto-oncogene at 3p21.3, in human lung tumors." Gray D.A., Inazawa J., Gupta K., Wong A., Ueda R., Takahashi T. Oncogene 10:2179-2183(1995) [PubMed: 7784062] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA]. Tissue: Brain cortex. |
| [2] | Gray D.A. Submitted (OCT-1997) to the EMBL/GenBank/DDBJ databases Cited for: SEQUENCE REVISION. |
| [3] | "The human UNP locus at 3p21.31 encodes two tissue-selective, cytoplasmic isoforms with deubiquitinating activity that have reduced expression in small cell lung carcinoma cell lines." Frederick A., Rolfe M., Chiu M.I. Oncogene 16:153-165(1998) [PubMed: 9464533] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA], ALTERNATIVE SPLICING. |
| [4] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM UNPEL). Tissue: Placenta. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA]. |
| [6] | Colinge J., Superti-Furga G., Bennett K.L. Submitted (OCT-2008) to UniProtKB Cited for: IDENTIFICATION [LARGE SCALE ANALYSIS], MASS SPECTROMETRY. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | U20657 mRNA. Translation: AAB72237.1. AF017305 mRNA. Translation: AAC27355.1. AF017306 mRNA. Translation: AAC27356.1. AK291795 mRNA. Translation: BAF84484.1. BC125130 mRNA. Translation: AAI25131.1. |
| IPI | IPI00011836. IPI00216257. |
| PIR | T09478. |
| RefSeq | NP_003354.2. NP_955475.1. |
| UniGene | Hs.403828 Hs.714416 Hs.77500 |
3D structure databases | |
| SMR | Q13107. Positions 1-124. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q13107. 2 interactions. |
| STRING | Q13107. |
Protein family/group databases | |
| MEROPS | C19.010. |
PTM databases | |
| PhosphoSite | Q13107. |
Proteomic databases | |
| PRIDE | Q13107. |
Genome annotation databases | |
| Ensembl | ENST00000265560; ENSP00000265560; ENSG00000114316; Homo sapiens. [Genome view] |
| GeneID | 7375. |
| KEGG | hsa:7375. |
| UCSC | uc003cwq.1. human. uc003cwr.1. human. |
Organism-specific databases | |
| CTD | 7375. |
| GeneCards | GC03M049290. |
| H-InvDB | HIX0022014. |
| HGNC | HGNC:12627. USP4. |
| HPA | HPA018499. |
| MIM | 603486. gene. |
| PharmGKB | PA27527. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | prNOG11241. |
| HOGENOM | HBG318284. |
| HOVERGEN | Q13107. |
| InParanoid | Q13107. |
| OMA | CRPTQYR. |
| OrthoDB | EOG9HX7K9. |
| PhylomeDB | Q13107. |
Enzyme and pathway databases | |
| BRENDA | 3.1.2.15. 247. |
Gene expression databases | |
| ArrayExpress | Q13107. |
| Bgee | Q13107. |
| CleanEx | HS_USP4. |
| Genevestigator | Q13107. |
| GermOnline | ENSG00000114316. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR006615. Pept_C19_DUSP. IPR018200. Pept_C19ubi-hydrolase_C_CS. IPR001394. Peptidase_C19. [Graphical view] |
| Pfam | PF00443. UCH. 1 hit. [Graphical view] |
| SMART | SM00695. DUSP. 1 hit. [Graphical view] |
| PROSITE | PS51283. DUSP. 1 hit. PS00972. UCH_2_1. 1 hit. PS00973. UCH_2_2. 1 hit. PS50235. UCH_2_3. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 28880. |
| SOURCE | Search... |
Entry information
| Entry name | UBP4_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q13107 Secondary accession number(s): A8K6Y0 Q08AK8 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 3 Human chromosome 3: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| Peptidase families Classification of peptidase families and list of entries |
| SIMILARITY comments Index of protein domains and families |

Clusters with


