Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Ubiquitin carboxyl-terminal hydrolase 4

Gene

USP4

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Hydrolase that deubiquitinates target proteins such as the receptor ADORA2A, PDPK1 and TRIM21. Deubiquitination of ADORA2A increases the amount of functional receptor at the cell surface. May regulate mRNA splicing through deubiquitination of the U4 spliceosomal protein PRPF3. This may prevent its recognition by the U5 component PRPF8 thereby destabilizing interactions within the U4/U6.U5 snRNP. May also play a role in the regulation of quality control in the ER.5 Publications

Catalytic activityi

Thiol-dependent hydrolysis of ester, thioester, amide, peptide and isopeptide bonds formed by the C-terminal Gly of ubiquitin (a 76-residue protein attached to proteins as an intracellular targeting signal).

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Active sitei311Nucleophile1
Metal bindingi461Zinc1
Metal bindingi464Zinc1
Metal bindingi799Zinc1
Metal bindingi802Zinc1
Active sitei881Proton acceptorPROSITE-ProRule annotation1

GO - Molecular functioni

  • adenosine receptor binding Source: UniProtKB
  • identical protein binding Source: IntAct
  • metal ion binding Source: UniProtKB-KW
  • thiol-dependent ubiquitin-specific protease activity Source: UniProtKB

GO - Biological processi

  • negative regulation of protein ubiquitination Source: UniProtKB
  • protein deubiquitination Source: UniProtKB
  • protein localization to cell surface Source: UniProtKB
  • regulation of protein stability Source: UniProtKB
  • spliceosomal tri-snRNP complex assembly Source: UniProtKB
  • ubiquitin-dependent protein catabolic process Source: InterPro
Complete GO annotation...

Keywords - Molecular functioni

Hydrolase, Protease, Thiol protease

Keywords - Biological processi

Ubl conjugation pathway

Keywords - Ligandi

Metal-binding, Zinc

Enzyme and pathway databases

BioCyciZFISH:HS03755-MONOMER.
ReactomeiR-HSA-5357786. TNFR1-induced proapoptotic signaling.
R-HSA-5357905. Regulation of TNFR1 signaling.
R-HSA-5357956. TNFR1-induced NFkappaB signaling pathway.
R-HSA-5689880. Ub-specific processing proteases.

Protein family/group databases

MEROPSiC19.010.

Names & Taxonomyi

Protein namesi
Recommended name:
Ubiquitin carboxyl-terminal hydrolase 4 (EC:3.4.19.12)
Alternative name(s):
Deubiquitinating enzyme 4
Ubiquitin thioesterase 4
Ubiquitin-specific-processing protease 4
Ubiquitous nuclear protein homolog
Gene namesi
Name:USP4
Synonyms:UNP, UNPH
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 3

Organism-specific databases

HGNCiHGNC:12627. USP4.

Subcellular locationi

GO - Cellular componenti

  • cytoplasm Source: UniProtKB
  • lysosome Source: ProtInc
  • nucleus Source: UniProtKB
  • plasma membrane Source: HPA
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi311C → A: Loss of activity. Its ubiquitination by TRIM21 is enhanced. 2 Publications1
Mutagenesisi459 – 463LVCPE → AVRPH: Reduces the interaction with RB1. 1 Publication5
Mutagenesisi463E → Q: Reduces the interaction with RB1. 1 Publication1

Keywords - Diseasei

Proto-oncogene

Organism-specific databases

DisGeNETi7375.
OpenTargetsiENSG00000114316.
PharmGKBiPA37252.

Chemistry databases

ChEMBLiCHEMBL2406900.

Polymorphism and mutation databases

BioMutaiUSP4.
DMDMi116242839.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000806211 – 963Ubiquitin carboxyl-terminal hydrolase 4Add BLAST963

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei655PhosphoserineBy similarity1
Modified residuei675PhosphoserineBy similarity1
Modified residuei680PhosphoserineBy similarity1

Post-translational modificationi

Monoubiquitinated by TRIM21. Ubiquitination does not lead to its proteasomal degradation. Autodeubiquitinated.2 Publications

Keywords - PTMi

Phosphoprotein, Ubl conjugation

Proteomic databases

EPDiQ13107.
MaxQBiQ13107.
PaxDbiQ13107.
PeptideAtlasiQ13107.
PRIDEiQ13107.

PTM databases

iPTMnetiQ13107.
PhosphoSitePlusiQ13107.

Expressioni

Tissue specificityi

Overexpressed in small cell tumors and adenocarcinomas of the lung compared to wild-type lung (at protein level). Expressed in the hippocampal neurons.2 Publications

Gene expression databases

BgeeiENSG00000114316.
CleanExiHS_USP4.
ExpressionAtlasiQ13107. baseline and differential.
GenevisibleiQ13107. HS.

Organism-specific databases

HPAiHPA018499.

Interactioni

Subunit structurei

Interacts with RB1 (both dephosphorylated and hypophosphorylated forms). Interacts with RBL1 and RBL2. Interacts with ADORA2A (via cytoplasmic C-terminus); the interaction is direct. Interacts with SART3; recruits USP4 to its substrate PRPF3.By similarity3 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
itself3EBI-723290,EBI-723290
ADORA2AP292744EBI-723290,EBI-2902702
HUWE1Q7Z6Z74EBI-723290,EBI-625934
RIPK1Q135464EBI-723290,EBI-358507
TRIM21P194743EBI-723305,EBI-81290

GO - Molecular functioni

  • adenosine receptor binding Source: UniProtKB
  • identical protein binding Source: IntAct

Protein-protein interaction databases

BioGridi113221. 106 interactors.
IntActiQ13107. 32 interactors.
MINTiMINT-3027027.
STRINGi9606.ENSP00000265560.

Chemistry databases

BindingDBiQ13107.

Structurei

Secondary structure

1963
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi13 – 20Combined sources8
Helixi21 – 23Combined sources3
Beta strandi32 – 38Combined sources7
Helixi39 – 48Combined sources10
Helixi62 – 64Combined sources3
Turni72 – 74Combined sources3
Beta strandi75 – 77Combined sources3
Turni78 – 81Combined sources4
Turni89 – 92Combined sources4
Beta strandi93 – 97Combined sources5
Helixi98 – 108Combined sources11
Beta strandi118 – 124Combined sources7
Beta strandi126 – 128Combined sources3
Beta strandi130 – 133Combined sources4
Beta strandi140 – 143Combined sources4
Beta strandi151 – 154Combined sources4
Beta strandi158 – 161Combined sources4
Helixi162 – 172Combined sources11
Beta strandi177 – 179Combined sources3
Beta strandi183 – 185Combined sources3
Beta strandi187 – 191Combined sources5
Beta strandi198 – 202Combined sources5
Turni203 – 206Combined sources4
Helixi311 – 321Combined sources11
Helixi324 – 331Combined sources8
Helixi335 – 338Combined sources4
Helixi350 – 362Combined sources13
Beta strandi364 – 366Combined sources3
Beta strandi368 – 370Combined sources3
Helixi373 – 382Combined sources10
Helixi384 – 386Combined sources3
Beta strandi388 – 390Combined sources3
Helixi394 – 408Combined sources15
Helixi428 – 442Combined sources15
Helixi446 – 451Combined sources6
Beta strandi453 – 460Combined sources8
Turni462 – 464Combined sources3
Beta strandi467 – 480Combined sources14
Helixi778 – 785Combined sources8
Beta strandi797 – 799Combined sources3
Turni800 – 803Combined sources4
Beta strandi804 – 806Combined sources3
Beta strandi809 – 816Combined sources8
Beta strandi819 – 826Combined sources8
Beta strandi828 – 830Combined sources3
Beta strandi835 – 837Combined sources3
Helixi852 – 854Combined sources3
Beta strandi858 – 860Combined sources3
Beta strandi864 – 874Combined sources11
Beta strandi876 – 879Combined sources4
Beta strandi881 – 887Combined sources7
Turni889 – 891Combined sources3
Beta strandi894 – 898Combined sources5
Beta strandi901 – 904Combined sources4
Helixi907 – 909Combined sources3
Beta strandi915 – 922Combined sources8
Helixi926 – 928Combined sources3

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2Y6EX-ray2.40A/B/C/D/E/F296-490[»]
A/B/C/D/E/F765-932[»]
5CTRX-ray3.01C/D1-230[»]
ProteinModelPortaliQ13107.
SMRiQ13107.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ13107.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini11 – 122DUSPPROSITE-ProRule annotationAdd BLAST112
Domaini142 – 226Ubiquitin-like 1Add BLAST85
Domaini302 – 923USPAdd BLAST622
Domaini483 – 571Ubiquitin-like 2Add BLAST89

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni27 – 216Necessary for interaction with SART31 PublicationAdd BLAST190
Regioni405 – 407Necessary for interaction with RBL2By similarity3
Regioni459 – 463Necessary for interaction with RB1 and RBL2By similarity5

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi133 – 141Nuclear export signalBy similarity9
Motifi767 – 772Nuclear localization signalBy similarity6

Domaini

The Ubiquitin-like domain 2 inserts into the catalytic domain and competes with the ubiquitin substrate, partially inhibiting DUB activity.1 Publication

Sequence similaritiesi

Belongs to the peptidase C19 family. USP4 subfamily.Curated
Contains 1 DUSP domain.PROSITE-ProRule annotation
Contains 2 ubiquitin-like domains.Curated
Contains 1 USP domain.Curated

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiKOG1870. Eukaryota.
COG5560. LUCA.
GeneTreeiENSGT00670000097750.
HOGENOMiHOG000152636.
HOVERGENiHBG000864.
InParanoidiQ13107.
KOiK11835.
OMAiMEIFLVP.
OrthoDBiEOG091G0157.
PhylomeDBiQ13107.
TreeFamiTF106276.

Family and domain databases

Gene3Di3.30.2230.10. 1 hit.
InterProiIPR006615. Pept_C19_DUSP.
IPR001394. Peptidase_C19_UCH.
IPR028135. Ub_USP-typ.
IPR028134. USP4/12.
IPR018200. USP_CS.
IPR028889. USP_dom.
[Graphical view]
PANTHERiPTHR24006:SF360. PTHR24006:SF360. 2 hits.
PfamiPF06337. DUSP. 1 hit.
PF14836. Ubiquitin_3. 1 hit.
PF00443. UCH. 1 hit.
[Graphical view]
SMARTiSM00695. DUSP. 1 hit.
[Graphical view]
SUPFAMiSSF143791. SSF143791. 1 hit.
PROSITEiPS51283. DUSP. 1 hit.
PS00972. USP_1. 1 hit.
PS00973. USP_2. 1 hit.
PS50235. USP_3. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q13107-1) [UniParc]FASTAAdd to basket
Also known as: UnpEL

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAEGGGCRER PDAETQKSEL GPLMRTTLQR GAQWYLIDSR WFKQWKKYVG
60 70 80 90 100
FDSWDMYNVG EHNLFPGPID NSGLFSDPES QTLKEHLIDE LDYVLVPTEA
110 120 130 140 150
WNKLLNWYGC VEGQQPIVRK VVEHGLFVKH CKVEVYLLEL KLCENSDPTN
160 170 180 190 200
VLSCHFSKAD TIATIEKEMR KLFNIPAERE TRLWNKYMSN TYEQLSKLDN
210 220 230 240 250
TVQDAGLYQG QVLVIEPQNE DGTWPRQTLQ SKSSTAPSRN FTTSPKSSAS
260 270 280 290 300
PYSSVSASLI ANGDSTSTCG MHSSGVSRGG SGFSASYNCQ EPPSSHIQPG
310 320 330 340 350
LCGLGNLGNT CFMNSALQCL SNTAPLTDYF LKDEYEAEIN RDNPLGMKGE
360 370 380 390 400
IAEAYAELIK QMWSGRDAHV APRMFKTQVG RFAPQFSGYQ QQDSQELLAF
410 420 430 440 450
LLDGLHEDLN RVKKKPYLEL KDANGRPDAV VAKEAWENHR LRNDSVIVDT
460 470 480 490 500
FHGLFKSTLV CPECAKVSVT FDPFCYLTLP LPLKKDRVME VFLVPADPHC
510 520 530 540 550
RPTQYRVTVP LMGAVSDLCE ALSRLSGIAA ENMVVADVYN HRFHKIFQMD
560 570 580 590 600
EGLNHIMPRD DIFVYEVCST SVDGSECVTL PVYFRERKSR PSSTSSASAL
610 620 630 640 650
YGQPLLLSVP KHKLTLESLY QAVCDRISRY VKQPLPDEFG SSPLEPGACN
660 670 680 690 700
GSRNSCEGED EEEMEHQEEG KEQLSETEGS GEDEPGNDPS ETTQKKIKGQ
710 720 730 740 750
PCPKRLFTFS LVNSYGTADI NSLAADGKLL KLNSRSTLAM DWDSETRRLY
760 770 780 790 800
YDEQESEAYE KHVSMLQPQK KKKTTVALRD CIELFTTMET LGEHDPWYCP
810 820 830 840 850
NCKKHQQATK KFDLWSLPKI LVVHLKRFSY NRYWRDKLDT VVEFPIRGLN
860 870 880 890 900
MSEFVCNLSA RPYVYDLIAV SNHYGAMGVG HYTAYAKNKL NGKWYYFDDS
910 920 930 940 950
NVSLASEDQI VTKAAYVLFY QRRDDEFYKT PSLSSSGSSD GGTRPSSSQQ
960
GFGDDEACSM DTN
Length:963
Mass (Da):108,565
Last modified:October 17, 2006 - v3
Checksum:i63055C9ADFE36713
GO
Isoform 2 (identifier: Q13107-2) [UniParc]FASTAAdd to basket
Also known as: UnpES

The sequence of this isoform differs from the canonical sequence as follows:
     232-279: KSSTAPSRNFTTSPKSSASPYSSVSASLIANGDSTSTCGMHSSGVSRG → N

Show »
Length:916
Mass (Da):103,958
Checksum:i86CBBDE6AA2AB04E
GO
Isoform 3 (identifier: Q13107-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     233-313: SSTAPSRNFT...LGNLGNTCFM → VSFFLPRLEC...LLPQPPEWLG
     314-963: Missing.

Note: No experimental confirmation available.
Show »
Length:313
Mass (Da):35,661
Checksum:i7B2258A3A64AC0EB
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti373R → S in AAB72237 (PubMed:7784062).Curated1
Sequence conflicti744S → R in AAB72237 (PubMed:7784062).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_028180620Y → C.Corresponds to variant rs9311440dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_005258232 – 279KSSTA…GVSRG → N in isoform 2. 1 PublicationAdd BLAST48
Alternative sequenceiVSP_044814233 – 313SSTAP…NTCFM → VSFFLPRLECNGAILAHCNF CLPGSSNSPASASRVAPSHL ANFFFFEMESHSVTKLECGG AVSAYSRVQVMLLPQPPEWL G in isoform 3. 1 PublicationAdd BLAST81
Alternative sequenceiVSP_044815314 – 963Missing in isoform 3. 1 PublicationAdd BLAST650

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U20657 mRNA. Translation: AAB72237.1.
AF017305 mRNA. Translation: AAC27355.1.
AF017306 mRNA. Translation: AAC27356.1.
AK291795 mRNA. Translation: BAF84484.1.
AC121247 Genomic DNA. No translation available.
BC068017 mRNA. No translation available.
BC125130 mRNA. Translation: AAI25131.1.
CCDSiCCDS2793.1. [Q13107-1]
CCDS2794.1. [Q13107-2]
CCDS58832.1. [Q13107-3]
PIRiT09478.
RefSeqiNP_001238806.1. NM_001251877.1. [Q13107-3]
NP_003354.2. NM_003363.3. [Q13107-1]
NP_955475.1. NM_199443.2. [Q13107-2]
UniGeneiHs.403828.
Hs.77500.

Genome annotation databases

EnsembliENST00000265560; ENSP00000265560; ENSG00000114316. [Q13107-1]
ENST00000351842; ENSP00000341028; ENSG00000114316. [Q13107-2]
ENST00000416417; ENSP00000400623; ENSG00000114316. [Q13107-3]
GeneIDi7375.
KEGGihsa:7375.
UCSCiuc003cwq.3. human. [Q13107-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U20657 mRNA. Translation: AAB72237.1.
AF017305 mRNA. Translation: AAC27355.1.
AF017306 mRNA. Translation: AAC27356.1.
AK291795 mRNA. Translation: BAF84484.1.
AC121247 Genomic DNA. No translation available.
BC068017 mRNA. No translation available.
BC125130 mRNA. Translation: AAI25131.1.
CCDSiCCDS2793.1. [Q13107-1]
CCDS2794.1. [Q13107-2]
CCDS58832.1. [Q13107-3]
PIRiT09478.
RefSeqiNP_001238806.1. NM_001251877.1. [Q13107-3]
NP_003354.2. NM_003363.3. [Q13107-1]
NP_955475.1. NM_199443.2. [Q13107-2]
UniGeneiHs.403828.
Hs.77500.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2Y6EX-ray2.40A/B/C/D/E/F296-490[»]
A/B/C/D/E/F765-932[»]
5CTRX-ray3.01C/D1-230[»]
ProteinModelPortaliQ13107.
SMRiQ13107.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi113221. 106 interactors.
IntActiQ13107. 32 interactors.
MINTiMINT-3027027.
STRINGi9606.ENSP00000265560.

Chemistry databases

BindingDBiQ13107.
ChEMBLiCHEMBL2406900.

Protein family/group databases

MEROPSiC19.010.

PTM databases

iPTMnetiQ13107.
PhosphoSitePlusiQ13107.

Polymorphism and mutation databases

BioMutaiUSP4.
DMDMi116242839.

Proteomic databases

EPDiQ13107.
MaxQBiQ13107.
PaxDbiQ13107.
PeptideAtlasiQ13107.
PRIDEiQ13107.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000265560; ENSP00000265560; ENSG00000114316. [Q13107-1]
ENST00000351842; ENSP00000341028; ENSG00000114316. [Q13107-2]
ENST00000416417; ENSP00000400623; ENSG00000114316. [Q13107-3]
GeneIDi7375.
KEGGihsa:7375.
UCSCiuc003cwq.3. human. [Q13107-1]

Organism-specific databases

CTDi7375.
DisGeNETi7375.
GeneCardsiUSP4.
HGNCiHGNC:12627. USP4.
HPAiHPA018499.
MIMi603486. gene.
neXtProtiNX_Q13107.
OpenTargetsiENSG00000114316.
PharmGKBiPA37252.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1870. Eukaryota.
COG5560. LUCA.
GeneTreeiENSGT00670000097750.
HOGENOMiHOG000152636.
HOVERGENiHBG000864.
InParanoidiQ13107.
KOiK11835.
OMAiMEIFLVP.
OrthoDBiEOG091G0157.
PhylomeDBiQ13107.
TreeFamiTF106276.

Enzyme and pathway databases

BioCyciZFISH:HS03755-MONOMER.
ReactomeiR-HSA-5357786. TNFR1-induced proapoptotic signaling.
R-HSA-5357905. Regulation of TNFR1 signaling.
R-HSA-5357956. TNFR1-induced NFkappaB signaling pathway.
R-HSA-5689880. Ub-specific processing proteases.

Miscellaneous databases

ChiTaRSiUSP4. human.
EvolutionaryTraceiQ13107.
GeneWikiiUSP4.
GenomeRNAii7375.
PROiQ13107.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000114316.
CleanExiHS_USP4.
ExpressionAtlasiQ13107. baseline and differential.
GenevisibleiQ13107. HS.

Family and domain databases

Gene3Di3.30.2230.10. 1 hit.
InterProiIPR006615. Pept_C19_DUSP.
IPR001394. Peptidase_C19_UCH.
IPR028135. Ub_USP-typ.
IPR028134. USP4/12.
IPR018200. USP_CS.
IPR028889. USP_dom.
[Graphical view]
PANTHERiPTHR24006:SF360. PTHR24006:SF360. 2 hits.
PfamiPF06337. DUSP. 1 hit.
PF14836. Ubiquitin_3. 1 hit.
PF00443. UCH. 1 hit.
[Graphical view]
SMARTiSM00695. DUSP. 1 hit.
[Graphical view]
SUPFAMiSSF143791. SSF143791. 1 hit.
PROSITEiPS51283. DUSP. 1 hit.
PS00972. USP_1. 1 hit.
PS00973. USP_2. 1 hit.
PS50235. USP_3. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiUBP4_HUMAN
AccessioniPrimary (citable) accession number: Q13107
Secondary accession number(s): A8K6Y0
, C9IY91, O43452, O43453, Q08AK8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: October 17, 2006
Last modified: November 2, 2016
This is version 162 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. Peptidase families
    Classification of peptidase families and list of entries
  7. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.