Q13098 (CSN1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 113.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: COP9 signalosome complex subunit 1 Short name=SGN1 Short name=Signalosome subunit 1 Alternative name(s): G protein pathway suppressor 1 Short name=GPS-1 JAB1-containing signalosome subunit 1 Protein MFH | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 491 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Essential component of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes. The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunits of SCF-type E3 ligase complexes, leading to decrease the Ubl ligase activity of SCF-type complexes such as SCF, CSA or DDB2. The complex is also involved in phosphorylation of p53/TP53, c-jun/JUN, IkappaBalpha/NFKBIA, ITPK1 and IRF8/ICSBP, possibly via its association with CK2 and PKD kinases. CSN-dependent phosphorylation of TP53 and JUN promotes and protects degradation by the Ubl system, respectively. Suppresses G-protein- and mitogen-activated protein kinase-mediated signal transduction. Ref.6 Ref.7 Ref.9 Ref.11 Ref.12 |
| Subunit structure | Component of the CSN complex, composed of COPS1/GPS1, COPS2, COPS3, COPS4, COPS5, COP6, COPS7 (COPS7A or COPS7B) and COPS8. In the complex, it probably interacts directly with COPS2, COPS3, COPS4 and CSN5. Interacts directly with inositol kinase ITPK1. Interacts with CAPN8 By similarity. Ref.8 Ref.10 |
| Subcellular location | |
| Tissue specificity | Widely expressed. Ref.1 |
| Domain | The PCI domain is necessary and sufficient for the interactions with other CSN subunits of the complex. Mediates the interaction with CAPN8 By similarity. Ref.8 The N-terminal part (1-216), which is not required for deneddylating activity and CSN complex formation, is nevertheless essential for other aspects of CSN complex function, such as repression of c-fos/FOS expression. Ref.8 |
| Post-translational modification | Phosphorylated upon DNA damage, probably by ATM or ATR. Ref.13 Ref.14 Ref.15 Ref.16 Ref.17 Ref.18 Ref.19 Ref.20 |
| Sequence similarities | Belongs to the CSN1 family. Contains 1 PCI domain. |
| Sequence caution | The sequence AAC50906.2 differs from that shown. Reason: Erroneous initiation. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cytoplasm Nucleus Signalosome |
| Coding sequence diversity | Alternative splicing |
| PTM | Acetylation Phosphoprotein |
| Technical term | Complete proteome Direct protein sequencing Reference proteome |
| Gene Ontology (GO) | |
| Biological process | JNK cascade Traceable author statement. Source: ProtInc cell cycleTraceable author statement. Source: ProtInc cullin deneddylationInferred from direct assay. Source: UniProtKB inactivation of MAPK activityTraceable author statement. Source: ProtInc |
| Cellular component | cytoplasm Inferred from electronic annotation. Source: UniProtKB-SubCell signalosomeInferred from direct assay Ref.17. Source: UniProtKB |
| Molecular function | GTPase inhibitor activity Traceable author statement. Source: ProtInc bindingInferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q13098-4) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 4 (identifier: Q13098-5) The sequence of this isoform differs from the canonical sequence as follows: 103-106: Missing. | ||||||
| Isoform 3 (identifier: Q13098-6) The sequence of this isoform differs from the canonical sequence as follows: 12-109: GAVEPMQIDV...EATRSSLREL → PASSVSGSGG...QIDVDPQEDP 471-491: REGSQGELTPANSQSRMSTNM → TSTDLGPPGG...VRCRQVGGVH | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 2 (identifier: Q13098-7) The sequence of this isoform differs from the canonical sequence as follows: 1-11: MPLPVQVFNLQ → MRDSSAPSSASSSVTDLYCTPHSSRSDLVLPGTAGDFSLSASLSACTLLYE 103-106: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Initiator methionine | 1 | 1 | Removed Ref.17 | ||||||
| Chain | 2 – 491 | 490 | COP9 signalosome complex subunit 1 | PRO_0000120959 | |||||
Regions | |||||||||
| Domain | 324 – 428 | 105 | PCI | ||||||
Amino acid modifications | |||||||||
| Modified residue | 377 | 1 | Phosphotyrosine Ref.13 | ||||||
| Modified residue | 467 | 1 | N6-acetyllysine Ref.21 | ||||||
| Modified residue | 468 | 1 | Phosphoserine Ref.15 Ref.17 | ||||||
| Modified residue | 474 | 1 | Phosphoserine Ref.16 Ref.17 Ref.18 Ref.19 Ref.20 | ||||||
| Modified residue | 479 | 1 | Phosphothreonine Ref.14 Ref.16 Ref.17 Ref.18 Ref.19 Ref.20 | ||||||
| Modified residue | 483 | 1 | Phosphoserine Ref.16 Ref.17 Ref.18 | ||||||
| Modified residue | 488 | 1 | Phosphoserine Ref.15 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 11 | 11 | MPLPVQVFNLQ → MRDSSAPSSASSSVTDLYCT PHSSRSDLVLPGTAGDFSLS ASLSACTLLYE in isoform 2. | VSP_036240 | |||||
| Alternative sequence | 12 – 109 | 98 | GAVEP…SLREL → PASSVSGSGGAESQDRMRDS SAPSSASSSVTDLYCTPHSS RSDLVLPGMAGDFSLSASLS ACTLLYEGAVEPMQIDVDPQ EDP in isoform 3. | VSP_036241 | |||||
| Alternative sequence | 103 – 106 | 4 | Missing in isoform 2 and isoform 4. | VSP_036242 | |||||
| Alternative sequence | 471 – 491 | 21 | REGSQ…MSTNM → TSTDLGPPGGSVLPAAQLRG LATGCHPACVPSLGLRRQAA ASCGPSWKERPAGLDPVGFC PQGADCAAPRPSGTISQTPP VPASVRCRQVGGVH in isoform 3. | VSP_011882 | |||||
Experimental info | |||||||||
| Sequence conflict | 259 | 1 | A → T in BAC04120. Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Two human cDNAs, including a homolog of Arabidopsis FUS6 (COP11), suppress G-protein- and mitogen-activated protein kinase-mediated signal transduction in yeast and mammalian cells." Spain B.H., Bowdish K.S., Pacal A., Flueckiger Staub S., Koo D., Chang K.-Y.R., Xie W., Colicelli J. Mol. Cell. Biol. 16:6698-6706(1996) [PubMed: 8943324] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4), TISSUE SPECIFICITY. |
| [2] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3). Tissue: Testis. |
| [3] | "DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage." Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L. Nusbaum C.Nature 440:1045-1049(2006) [PubMed: 16625196] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). Tissue: Placenta and Prostate. |
| [5] | "Cloning of human full-length CDSs in BD Creator(TM) system donor vector." Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A. Submitted (AUG-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 17-491 (ISOFORM 1). |
| [6] | "A novel protein complex involved in signal transduction possessing similarities to 26S proteasome subunits." Seeger M., Kraft R., Ferrell K., Bech-Otschir D., Dumdey R., Schade R., Gordon C., Naumann M., Dubiel W. FASEB J. 12:469-478(1998) [PubMed: 9535219] [Abstract] Cited for: PARTIAL PROTEIN SEQUENCE, FUNCTION, SUBCELLULAR LOCATION. |
| [7] | "COP9 signalosome-specific phosphorylation targets p53 to degradation by the ubiquitin system." Bech-Otschir D., Kraft R., Huang X., Henklein P., Kapelari B., Pollmann C., Dubiel W. EMBO J. 20:1630-1639(2001) [PubMed: 11285227] [Abstract] Cited for: FUNCTION. |
| [8] | "The subunit 1 of the COP9 signalosome suppresses gene expression through its N-terminal domain and incorporates into the complex through the PCI domain." Tsuge T., Matsui M., Wei N. J. Mol. Biol. 305:1-9(2001) [PubMed: 11114242] [Abstract] Cited for: DOMAIN, INTERACTION WITH COPS2; COPS3 AND COPS4. |
| [9] | "Promotion of NEDD-CUL1 conjugate cleavage by COP9 signalosome." Lyapina S., Cope G., Shevchenko A., Serino G., Tsuge T., Zhou C., Wolf D.A., Wei N., Shevchenko A., Deshaies R.J. Science 292:1382-1385(2001) [PubMed: 11337588] [Abstract] Cited for: FUNCTION, COMPOSITION OF THE CSN COMPLEX. |
| [10] | "Inositol 1,3,4-trisphosphate 5/6-kinase associates with the COP9 signalosome by binding to CSN1." Sun Y., Wilson M.P., Majerus P.W. J. Biol. Chem. 277:45759-45764(2002) [PubMed: 12324474] [Abstract] Cited for: INTERACTION WITH ITPK1. |
| [11] | "The ubiquitin ligase activity in the DDB2 and CSA complexes is differentially regulated by the COP9 signalosome in response to DNA damage." Groisman R., Polanowska J., Kuraoka I., Sawada J., Saijo M., Drapkin R., Kisselev A.F., Tanaka K., Nakatani Y. Cell 113:357-367(2003) [PubMed: 12732143] [Abstract] Cited for: FUNCTION. |
| [12] | "Protein kinase CK2 and protein kinase D are associated with the COP9 signalosome." Uhle S., Medalia O., Waldron R., Dumdey R., Henklein P., Bech-Otschir D., Huang X., Berse M., Sperling J., Schade R., Dubiel W. EMBO J. 22:1302-1312(2003) [PubMed: 12628923] [Abstract] Cited for: FUNCTION. |
| [13] | "Tyrosine phosphorylated Par3 regulates epithelial tight junction assembly promoted by EGFR signaling." Wang Y., Du D., Fang L., Yang G., Zhang C., Zeng R., Ullrich A., Lottspeich F., Chen Z. EMBO J. 25:5058-5070(2006) [PubMed: 17053785] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-377, MASS SPECTROMETRY. Tissue: Embryonic kidney. |
| [14] | "A probability-based approach for high-throughput protein phosphorylation analysis and site localization." Beausoleil S.A., Villen J., Gerber S.A., Rush J., Gygi S.P. Nat. Biotechnol. 24:1285-1292(2006) [PubMed: 16964243] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-479, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [15] | "Global proteomic profiling of phosphopeptides using electron transfer dissociation tandem mass spectrometry." Molina H., Horn D.M., Tang N., Mathivanan S., Pandey A. Proc. Natl. Acad. Sci. U.S.A. 104:2199-2204(2007) [PubMed: 17287340] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-468 AND SER-488, MASS SPECTROMETRY. Tissue: Embryonic kidney. |
| [16] | "ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage." Matsuoka S., Ballif B.A., Smogorzewska A., McDonald E.R. III, Hurov K.E., Luo J., Bakalarski C.E., Zhao Z., Solimini N., Lerenthal Y., Shiloh Y., Gygi S.P., Elledge S.J. Science 316:1160-1166(2007) [PubMed: 17525332] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-474; THR-479 AND SER-483, MASS SPECTROMETRY. Tissue: Embryonic kidney. |
| [17] | "Characterization of the human COP9 signalosome complex using affinity purification and mass spectrometry." Fang L., Wang X., Yamoah K., Chen P.L., Pan Z.Q., Huang L. J. Proteome Res. 7:4914-4925(2008) [PubMed: 18850735] [Abstract] Cited for: IDENTIFICATION IN THE CSN COMPLEX, CLEAVAGE OF INITIATOR METHIONINE, PHOSPHORYLATION AT SER-468; SER-474; THR-479 AND SER-483. |
| [18] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed: 18669648] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-474; THR-479 AND SER-483, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [19] | "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach." Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S. Anal. Chem. 81:4493-4501(2009) [PubMed: 19413330] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-474 AND THR-479, MASS SPECTROMETRY. Tissue: Embryonic kidney. |
| [20] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed: 19690332] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-474 AND THR-479, MASS SPECTROMETRY. Tissue: Leukemic T-cell. |
| [21] | "Lysine acetylation targets protein complexes and co-regulates major cellular functions." Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T., Olsen J.V., Mann M. Science 325:834-840(2009) [PubMed: 19608861] [Abstract] Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-467, MASS SPECTROMETRY. |
| [22] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed: 21269460] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | U20285 mRNA. Translation: AAC50906.2. Different initiation. AK093283 mRNA. Translation: BAC04120.1. AC135056 Genomic DNA. No translation available. BC000155 mRNA. Translation: AAH00155.3. BC064503 mRNA. Translation: AAH64503.1. BT009834 mRNA. Translation: AAP88836.1. |
| IPI | IPI00156282. IPI00300386. IPI00414289. IPI00921488. |
| PIR | G01646. |
| RefSeq | NP_004118.3. NM_004127.4. NP_997657.1. NM_212492.1. |
| UniGene | Hs.268530. |
3D structure databases | |
| ProteinModelPortal | Q13098. |
| ModBase | Search... |
Protein-protein interaction databases | |
| DIP | DIP-42077N. |
| IntAct | Q13098. 6 interactions. |
| MINT | MINT-1203964. |
| STRING | Q13098. |
PTM databases | |
| PhosphoSite | Q13098. |
Polymorphism databases | |
| DMDM | 223590263. |
Proteomic databases | |
| PRIDE | Q13098. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000306823; ENSP00000302873; ENSG00000169727. |
| GeneID | 2873. |
| KEGG | hsa:2873. |
| UCSC | uc002kdk.1. human. uc002kdl.1. human. |
Organism-specific databases | |
| CTD | 2873. |
| GeneCards | GC17P080009. |
| HGNC | HGNC:4549. GPS1. |
| MIM | 601934. gene. |
| neXtProt | NX_Q13098. |
| PharmGKB | PA28944. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | prNOG10929. |
| GeneTree | ENSGT00510000046608. |
| HOVERGEN | HBG030722. |
| OMA | YKSNSIK. |
| PhylomeDB | Q13098. |
Gene expression databases | |
| ArrayExpress | Q13098. |
| Bgee | Q13098. |
| CleanEx | HS_GPS1. |
| Genevestigator | Q13098. |
| GermOnline | ENSG00000169727. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR019585. 26S_proteasome_reg_su-Rpn7. IPR000717. PCI_dom. IPR011990. TPR-like_helical. IPR011991. WHTH_trsnscrt_rep_DNA-bd. [Graphical view] |
| Gene3D | G3DSA:1.25.40.10. TPR-like_helical. 1 hit. G3DSA:1.10.10.10. Wing_hlx_DNA_bd. 1 hit. |
| KO | K12175. |
| Pfam | PF01399. PCI. 1 hit. PF10602. RPN7. 1 hit. [Graphical view] |
| SMART | SM00088. PINT. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 11339. |
| SOURCE | Search... |
Entry information
| Entry name | CSN1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q13098 Secondary accession number(s): Q8NA10, Q9BWL1 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 17 Human chromosome 17: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with