Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

COP9 signalosome complex subunit 1

Gene

GPS1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Essential component of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes. The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunits of SCF-type E3 ligase complexes, leading to decrease the Ubl ligase activity of SCF-type complexes such as SCF, CSA or DDB2. The complex is also involved in phosphorylation of p53/TP53, c-jun/JUN, IkappaBalpha/NFKBIA, ITPK1 and IRF8/ICSBP, possibly via its association with CK2 and PKD kinases. CSN-dependent phosphorylation of TP53 and JUN promotes and protects degradation by the Ubl system, respectively. Suppresses G-protein- and mitogen-activated protein kinase-mediated signal transduction.5 Publications

GO - Molecular functioni

  • GTPase inhibitor activity Source: ProtInc

GO - Biological processi

  • cell cycle Source: ProtInc
  • COP9 signalosome assembly Source: InterPro
  • cullin deneddylation Source: UniProtKB
  • inactivation of MAPK activity Source: ProtInc
  • JNK cascade Source: ProtInc
  • nucleotide-excision repair, DNA damage recognition Source: Reactome
  • transcription-coupled nucleotide-excision repair Source: Reactome
Complete GO annotation...

Enzyme and pathway databases

BioCyciZFISH:ENSG00000169727-MONOMER.
ReactomeiR-HSA-5696394. DNA Damage Recognition in GG-NER.
R-HSA-6781823. Formation of TC-NER Pre-Incision Complex.
R-HSA-8856825. Cargo recognition for clathrin-mediated endocytosis.

Names & Taxonomyi

Protein namesi
Recommended name:
COP9 signalosome complex subunit 1
Short name:
SGN1
Short name:
Signalosome subunit 1
Alternative name(s):
G protein pathway suppressor 1
Short name:
GPS-1
JAB1-containing signalosome subunit 1
Protein MFH
Gene namesi
Name:GPS1
Synonyms:COPS1, CSN1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 17

Organism-specific databases

HGNCiHGNC:4549. GPS1.

Subcellular locationi

GO - Cellular componenti

  • COP9 signalosome Source: UniProtKB
  • cytoplasm Source: UniProtKB-SubCell
  • nucleoplasm Source: Reactome
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus, Signalosome

Pathology & Biotechi

Organism-specific databases

DisGeNETi2873.
OpenTargetsiENSG00000169727.
PharmGKBiPA28944.

Polymorphism and mutation databases

BioMutaiGPS1.
DMDMi223590263.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemoved1 Publication
ChainiPRO_00001209592 – 491COP9 signalosome complex subunit 1Add BLAST490

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei468PhosphoserineCombined sources1 Publication1
Modified residuei474PhosphoserineCombined sources1 Publication1
Modified residuei479PhosphothreonineCombined sources1 Publication1
Modified residuei483PhosphoserineCombined sources1 Publication1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ13098.
MaxQBiQ13098.
PaxDbiQ13098.
PeptideAtlasiQ13098.
PRIDEiQ13098.
TopDownProteomicsiQ13098-5. [Q13098-5]

PTM databases

iPTMnetiQ13098.
PhosphoSitePlusiQ13098.
SwissPalmiQ13098.

Expressioni

Tissue specificityi

Widely expressed.1 Publication

Gene expression databases

BgeeiENSG00000169727.
CleanExiHS_GPS1.
ExpressionAtlasiQ13098. baseline and differential.
GenevisibleiQ13098. HS.

Interactioni

Subunit structurei

Component of the CSN complex, composed of COPS1/GPS1, COPS2, COPS3, COPS4, COPS5, COPS6, COPS7 (COPS7A or COPS7B), COPS8 and COPS9 isoform 1 (PubMed:11337588, PubMed:18850735, PubMed:26456823). In the complex, it probably interacts directly with COPS2, COPS3, COPS4 and COPS5 (PubMed:11114242). Interacts directly with inositol kinase ITPK1 (PubMed:12324474). Interacts with CAPN8 (By similarity).By similarity5 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
COPS5Q929054EBI-725197,EBI-594661

Protein-protein interaction databases

BioGridi109131. 77 interactors.
DIPiDIP-42077N.
IntActiQ13098. 21 interactors.
MINTiMINT-1203964.
STRINGi9606.ENSP00000347251.

Structurei

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4D10X-ray3.80A/I12-491[»]
4D18X-ray4.08A/I12-491[»]
4WSNX-ray5.50A/I/Q/Y/g/o12-491[»]
ProteinModelPortaliQ13098.
SMRiQ13098.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini324 – 428PCIAdd BLAST105

Domaini

The PCI domain is necessary and sufficient for the interactions with other CSN subunits of the complex. Mediates the interaction with CAPN8 (By similarity).By similarity
The N-terminal part (1-216), which is not required for deneddylating activity and CSN complex formation, is nevertheless essential for other aspects of CSN complex function, such as repression of c-fos/FOS expression.1 Publication

Sequence similaritiesi

Belongs to the CSN1 family.Curated
Contains 1 PCI domain.Curated

Phylogenomic databases

eggNOGiKOG0686. Eukaryota.
ENOG410XRXI. LUCA.
GeneTreeiENSGT00510000046608.
HOGENOMiHOG000091977.
HOVERGENiHBG030722.
InParanoidiQ13098.
KOiK12175.
OMAiDHCPPLR.
OrthoDBiEOG091G08AU.
PhylomeDBiQ13098.
TreeFamiTF101167.

Family and domain databases

Gene3Di1.10.10.10. 1 hit.
1.25.40.10. 2 hits.
InterProiIPR033008. CSN1.
IPR000717. PCI_dom.
IPR019585. Rpn7/CSN1.
IPR011990. TPR-like_helical_dom.
IPR011991. WHTH_DNA-bd_dom.
[Graphical view]
PANTHERiPTHR14145:SF2. PTHR14145:SF2. 2 hits.
PfamiPF01399. PCI. 1 hit.
PF10602. RPN7. 1 hit.
[Graphical view]
SMARTiSM00088. PINT. 1 hit.
[Graphical view]
SUPFAMiSSF46785. SSF46785. 1 hit.

Sequences (4)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q13098-4) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MPLPVQVFNL QGAVEPMQID VDPQEDPQNA PDVNYVVENP SLDLEQYAAS
60 70 80 90 100
YSGLMRIERL QFIADHCPTL RVEALKMALS FVQRTFNVDM YEEIHRKLSE
110 120 130 140 150
ATRSSLRELQ NAPDAIPESG VEPPALDTAW VEATRKKALL KLEKLDTDLK
160 170 180 190 200
NYKGNSIKES IRRGHDDLGD HYLDCGDLSN ALKCYSRARD YCTSAKHVIN
210 220 230 240 250
MCLNVIKVSV YLQNWSHVLS YVSKAESTPE IAEQRGERDS QTQAILTKLK
260 270 280 290 300
CAAGLAELAA RKYKQAAKCL LLASFDHCDF PELLSPSNVA IYGGLCALAT
310 320 330 340 350
FDRQELQRNV ISSSSFKLFL ELEPQVRDII FKFYESKYAS CLKMLDEMKD
360 370 380 390 400
NLLLDMYLAP HVRTLYTQIR NRALIQYFSP YVSADMHRMA AAFNTTVAAL
410 420 430 440 450
EDELTQLILE GLISARVDSH SKILYARDVD QRSTTFEKSL LMGKEFQRRA
460 470 480 490
KAMMLRAAVL RNQIHVKSPP REGSQGELTP ANSQSRMSTN M
Length:491
Mass (Da):55,537
Last modified:February 10, 2009 - v4
Checksum:iBF925164ED985638
GO
Isoform 4 (identifier: Q13098-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     103-106: Missing.

Show »
Length:487
Mass (Da):55,093
Checksum:i8E706F5C8E4763A5
GO
Isoform 3 (identifier: Q13098-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     12-109: GAVEPMQIDV...EATRSSLREL → PASSVSGSGG...QIDVDPQEDP
     471-491: REGSQGELTPANSQSRMSTNM → TSTDLGPPGG...VRCRQVGGVH

Note: No experimental confirmation available.
Show »
Length:549
Mass (Da):59,818
Checksum:iB0C46F7860CB480E
GO
Isoform 2 (identifier: Q13098-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-11: MPLPVQVFNLQ → MRDSSAPSSASSSVTDLYCTPHSSRSDLVLPGTAGDFSLSASLSACTLLYE
     103-106: Missing.

Show »
Length:527
Mass (Da):59,050
Checksum:i6081BEBD48CAF32C
GO

Sequence cautioni

The sequence AAC50906 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti259A → T in BAC04120 (PubMed:14702039).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0362401 – 11MPLPVQVFNLQ → MRDSSAPSSASSSVTDLYCT PHSSRSDLVLPGTAGDFSLS ASLSACTLLYE in isoform 2. 1 PublicationAdd BLAST11
Alternative sequenceiVSP_03624112 – 109GAVEP…SLREL → PASSVSGSGGAESQDRMRDS SAPSSASSSVTDLYCTPHSS RSDLVLPGMAGDFSLSASLS ACTLLYEGAVEPMQIDVDPQ EDP in isoform 3. 1 PublicationAdd BLAST98
Alternative sequenceiVSP_036242103 – 106Missing in isoform 2 and isoform 4. 2 Publications4
Alternative sequenceiVSP_011882471 – 491REGSQ…MSTNM → TSTDLGPPGGSVLPAAQLRG LATGCHPACVPSLGLRRQAA ASCGPSWKERPAGLDPVGFC PQGADCAAPRPSGTISQTPP VPASVRCRQVGGVH in isoform 3. 1 PublicationAdd BLAST21

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U20285 mRNA. Translation: AAC50906.2. Different initiation.
AK093283 mRNA. Translation: BAC04120.1.
AC135056 Genomic DNA. No translation available.
BC000155 mRNA. Translation: AAH00155.3.
BC064503 mRNA. Translation: AAH64503.1.
BT009834 mRNA. Translation: AAP88836.1.
CCDSiCCDS11800.1. [Q13098-7]
CCDS32774.1. [Q13098-4]
CCDS82226.1. [Q13098-5]
PIRiG01646.
RefSeqiNP_001308021.1. NM_001321092.1. [Q13098-5]
NP_004118.3. NM_004127.5. [Q13098-4]
NP_997657.1. NM_212492.2. [Q13098-7]
XP_016880023.1. XM_017024534.1.
UniGeneiHs.268530.

Genome annotation databases

EnsembliENST00000306823; ENSP00000302873; ENSG00000169727. [Q13098-4]
ENST00000392358; ENSP00000376167; ENSG00000169727. [Q13098-7]
ENST00000578552; ENSP00000462265; ENSG00000169727. [Q13098-5]
GeneIDi2873.
KEGGihsa:2873.
UCSCiuc002kdk.2. human. [Q13098-4]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U20285 mRNA. Translation: AAC50906.2. Different initiation.
AK093283 mRNA. Translation: BAC04120.1.
AC135056 Genomic DNA. No translation available.
BC000155 mRNA. Translation: AAH00155.3.
BC064503 mRNA. Translation: AAH64503.1.
BT009834 mRNA. Translation: AAP88836.1.
CCDSiCCDS11800.1. [Q13098-7]
CCDS32774.1. [Q13098-4]
CCDS82226.1. [Q13098-5]
PIRiG01646.
RefSeqiNP_001308021.1. NM_001321092.1. [Q13098-5]
NP_004118.3. NM_004127.5. [Q13098-4]
NP_997657.1. NM_212492.2. [Q13098-7]
XP_016880023.1. XM_017024534.1.
UniGeneiHs.268530.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4D10X-ray3.80A/I12-491[»]
4D18X-ray4.08A/I12-491[»]
4WSNX-ray5.50A/I/Q/Y/g/o12-491[»]
ProteinModelPortaliQ13098.
SMRiQ13098.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi109131. 77 interactors.
DIPiDIP-42077N.
IntActiQ13098. 21 interactors.
MINTiMINT-1203964.
STRINGi9606.ENSP00000347251.

PTM databases

iPTMnetiQ13098.
PhosphoSitePlusiQ13098.
SwissPalmiQ13098.

Polymorphism and mutation databases

BioMutaiGPS1.
DMDMi223590263.

Proteomic databases

EPDiQ13098.
MaxQBiQ13098.
PaxDbiQ13098.
PeptideAtlasiQ13098.
PRIDEiQ13098.
TopDownProteomicsiQ13098-5. [Q13098-5]

Protocols and materials databases

DNASUi2873.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000306823; ENSP00000302873; ENSG00000169727. [Q13098-4]
ENST00000392358; ENSP00000376167; ENSG00000169727. [Q13098-7]
ENST00000578552; ENSP00000462265; ENSG00000169727. [Q13098-5]
GeneIDi2873.
KEGGihsa:2873.
UCSCiuc002kdk.2. human. [Q13098-4]

Organism-specific databases

CTDi2873.
DisGeNETi2873.
GeneCardsiGPS1.
HGNCiHGNC:4549. GPS1.
MIMi601934. gene.
neXtProtiNX_Q13098.
OpenTargetsiENSG00000169727.
PharmGKBiPA28944.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0686. Eukaryota.
ENOG410XRXI. LUCA.
GeneTreeiENSGT00510000046608.
HOGENOMiHOG000091977.
HOVERGENiHBG030722.
InParanoidiQ13098.
KOiK12175.
OMAiDHCPPLR.
OrthoDBiEOG091G08AU.
PhylomeDBiQ13098.
TreeFamiTF101167.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000169727-MONOMER.
ReactomeiR-HSA-5696394. DNA Damage Recognition in GG-NER.
R-HSA-6781823. Formation of TC-NER Pre-Incision Complex.
R-HSA-8856825. Cargo recognition for clathrin-mediated endocytosis.

Miscellaneous databases

ChiTaRSiGPS1. human.
GeneWikiiGPS1.
GenomeRNAii2873.
PROiQ13098.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000169727.
CleanExiHS_GPS1.
ExpressionAtlasiQ13098. baseline and differential.
GenevisibleiQ13098. HS.

Family and domain databases

Gene3Di1.10.10.10. 1 hit.
1.25.40.10. 2 hits.
InterProiIPR033008. CSN1.
IPR000717. PCI_dom.
IPR019585. Rpn7/CSN1.
IPR011990. TPR-like_helical_dom.
IPR011991. WHTH_DNA-bd_dom.
[Graphical view]
PANTHERiPTHR14145:SF2. PTHR14145:SF2. 2 hits.
PfamiPF01399. PCI. 1 hit.
PF10602. RPN7. 1 hit.
[Graphical view]
SMARTiSM00088. PINT. 1 hit.
[Graphical view]
SUPFAMiSSF46785. SSF46785. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiCSN1_HUMAN
AccessioniPrimary (citable) accession number: Q13098
Secondary accession number(s): Q8NA10, Q9BWL1
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: February 10, 2009
Last modified: November 30, 2016
This is version 162 of the entry and version 4 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.