Reviewed,
UniProtKB/Swiss-Prot Q13085 (ACACA_HUMAN)
Last modified
July 7, 2009.
Version 94.
History...
Clusters with 100%,
90%,
50% identity |
Documents (6) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Acetyl-CoA carboxylase 1 EC=6.4.1.2 Alternative name(s): ACC-alpha Including the following 1 domains: 1- Recommended name: Biotin carboxylase EC=6.3.4.14 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Complete proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 2346 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Catalyzes the rate-limiting reaction in the biogenesis of long-chain fatty acids. Carries out three functions: biotin carboxyl carrier protein, biotin carboxylase and carboxyltransferase. |
| Catalytic activity | ATP + acetyl-CoA + HCO3- = ADP + phosphate + malonyl-CoA. ATP + biotin-carboxyl-carrier protein + CO2 = ADP + phosphate + carboxybiotin-carboxyl-carrier protein. |
| Cofactor | Biotin. Binds 2 manganese ions per subunit. |
| Enzyme regulation | By phosphorylation By similarity. |
| Pathway | Lipid metabolism; malonyl-CoA biosynthesis; malonyl-CoA from acetyl-CoA: step 1/1. |
| Subunit structure | Interacts in its inactive phosphorylated form with the BRCT domains of BRCA1 which prevents ACACA dephosphorylation and inhibits lipid synthesis. Ref.8 Ref.11 |
| Subcellular location | |
| Tissue specificity | Expressed in brain, placental, skeletal muscle, renal, pancreatic and adipose tissues; expressed at low level in pulmonary tissue; not detected in the liver. |
| Post-translational modification | Phosphorylation on Ser-1263 is required for interaction with BRCA1. |
| Involvement in disease | Defects in ACACA are a cause of ACACA deficiency [MIM:200350]; also called ACAC or ACC deficiency. ACACA deficiency is an inborn error of de novo fatty acid synthesis. The disorder is associated with severe brain damage, persistent myopathy and poor growth. Ref.15 |
| Sequence similarities | Contains 1 ATP-grasp domain. Contains 1 biotin carboxylation domain. Contains 1 biotinyl-binding domain. Contains 1 carboxyltransferase domain. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| AKR1B10 | O60218 | 3 | EBI-717681,EBI-1572139 | |
| BRCA1 | P38398 | 2 | EBI-717681,EBI-349905 |
Alternative products
| This entry describes 4 isoforms produced by alternative promoter usage. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q13085-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q13085-2) Also known as: E5A; The sequence of this isoform differs from the canonical sequence as follows: 1-75: MDEPSPLAQP...SLQDGLALHI → MEGSPEENKEMRYYMLQ | ||||||
| Isoform 3 (identifier: Q13085-3) Also known as: E5B; The sequence of this isoform differs from the canonical sequence as follows: 1-78: Missing. | ||||||
| Isoform 4 (identifier: Q13085-4) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MWWSTLMSILRARSFWKWISTQTVRIIRAVRAHFGGIM |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 2346 | 2346 | Acetyl-CoA carboxylase 1 | PRO_0000146764 | |||||
Regions | |||||||||
| Domain | 117 – 618 | 502 | Biotin carboxylation | ||||||
| Domain | 275 – 466 | 192 | ATP-grasp | ||||||
| Domain | 752 – 818 | 67 | Biotinyl-binding | ||||||
| Domain | 1698 – 2194 | 497 | Carboxyltransferase | ||||||
| Nucleotide binding | 315 – 320 | 6 | ATP Potential | ||||||
Sites | |||||||||
| Active site | 441 | 1 | By similarity | ||||||
| Metal binding | 424 | 1 | Manganese 1 By similarity | ||||||
| Metal binding | 437 | 1 | Manganese 1 By similarity | ||||||
| Metal binding | 437 | 1 | Manganese 2 By similarity | ||||||
| Metal binding | 439 | 1 | Manganese 2 By similarity | ||||||
| Binding site | 1823 | 1 | Coenzyme A By similarity | ||||||
| Binding site | 2127 | 1 | Coenzyme A By similarity | ||||||
| Binding site | 2129 | 1 | Coenzyme A By similarity | ||||||
Amino acid modifications | |||||||||
| Modified residue | 1 | 1 | N-acetylmethionine Ref.7 | ||||||
| Modified residue | 5 | 1 | Phosphoserine Ref.17 | ||||||
| Modified residue | 23 | 1 | Phosphoserine Ref.10 Ref.18 | ||||||
| Modified residue | 25 | 1 | Phosphoserine Ref.17 Ref.10 Ref.18 | ||||||
| Modified residue | 29 | 1 | Phosphoserine Ref.17 Ref.10 Ref.18 Ref.9 | ||||||
| Modified residue | 48 | 1 | Phosphoserine Ref.17 Ref.10 | ||||||
| Modified residue | 50 | 1 | Phosphoserine Ref.10 Ref.16 | ||||||
| Modified residue | 53 | 1 | Phosphoserine Ref.10 | ||||||
| Modified residue | 56 | 1 | Phosphoserine Ref.10 | ||||||
| Modified residue | 58 | 1 | Phosphothreonine Ref.10 | ||||||
| Modified residue | 60 | 1 | Phosphoserine Ref.10 | ||||||
| Modified residue | 78 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 80 | 1 | Phosphoserine Ref.7 Ref.18 | ||||||
| Modified residue | 488 | 1 | Phosphoserine Ref.16 | ||||||
| Modified residue | 786 | 1 | N6-biotinyllysine By similarity | ||||||
| Modified residue | 1042 | 1 | Phosphothreonine Ref.13 | ||||||
| Modified residue | 1201 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 1263 | 1 | Phosphoserine Ref.12 | ||||||
| Modified residue | 1844 | 1 | Phosphoserine Ref.14 | ||||||
| Modified residue | 2099 | 1 | Phosphoserine Ref.13 | ||||||
| Modified residue | 2108 | 1 | Phosphotyrosine Ref.13 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 78 | 78 | Missing in isoform 3. | VSP_026098 | |||||
| Alternative sequence | 1 – 75 | 75 | MDEPS…LALHI → MEGSPEENKEMRYYMLQ in isoform 2. | VSP_026099 | |||||
| Alternative sequence | 1 | 1 | M → MWWSTLMSILRARSFWKWIS TQTVRIIRAVRAHFGGIM in isoform 4. | VSP_026100 | |||||
| Natural variant | 838 | 1 | R → W: dbSNP rs2287351. | VAR_042941 | |||||
| Natural variant | 1687 | 1 | R → Q in a colorectal cancer sample; somatic mutation. Ref.20 | VAR_036514 | |||||
| Natural variant | 2271 | 1 | A → V Rare polymorphism; frequency <0.004; may play a role in breast cancer susceptibility. Ref.3 | VAR_028929 | |||||
Experimental info | |||||||||
| Mutagenesis | 78 | 1 | S → A: No effect on interaction with BRCA1. Ref.12 | ||||||
| Mutagenesis | 344 | 1 | S → A: No effect on interaction with BRCA1. Ref.12 | ||||||
| Mutagenesis | 432 | 1 | S → A: No effect on interaction with BRCA1. Ref.12 | ||||||
| Mutagenesis | 1201 | 1 | S → A: No effect on interaction with BRCA1. Ref.12 | ||||||
| Mutagenesis | 1263 | 1 | S → A: Abolishes interaction with BRCA1. Ref.12 | ||||||
| Mutagenesis | 1585 | 1 | S → A: No effect on interaction with BRCA1. Ref.12 | ||||||
| Mutagenesis | 1952 | 1 | S → A: No effect on interaction with BRCA1. Ref.12 | ||||||
| Mutagenesis | 2211 | 1 | S → A: No effect on interaction with BRCA1. Ref.12 | ||||||
| Sequence conflict | 66 | 1 | S → A in AAC50139. Ref.1 | ||||||
| Sequence conflict | 79 | 1 | M → W in AAC50139. Ref.1 | ||||||
| Sequence conflict | 89 | 1 | R → G in AAC50139. Ref.1 | ||||||
| Sequence conflict | 182 | 1 | P → A in AAC50139. Ref.1 | ||||||
| Sequence conflict | 234 | 1 | S → N in AAC50139. Ref.1 | ||||||
| Sequence conflict | 299 | 1 | Q → K in AAC50139. Ref.1 | ||||||
| Sequence conflict | 303 | 1 | E → K in AAC50139. Ref.1 | ||||||
| Sequence conflict | 364 | 1 | A → V in AAP94122. Ref.2 | ||||||
| Sequence conflict | 446 | 1 | H → Q in AAC50139. Ref.1 | ||||||
| Sequence conflict | 494 | 1 | D → N in AAC50139. Ref.1 | ||||||
| Sequence conflict | 554 | 1 | D → G in AAC50139. Ref.1 | ||||||
| Sequence conflict | 622 | 1 | Q → R in AAC50139. Ref.1 | ||||||
| Sequence conflict | 640 | 1 | A → G in AAC50139. Ref.1 | ||||||
| Sequence conflict | 814 | 1 | V → I in AAP94122. Ref.2 | ||||||
| Sequence conflict | 1061 | 1 | N → S in AAC50139. Ref.1 | ||||||
| Sequence conflict | 1094 – 1095 | 2 | EL → DV in AAC50139. Ref.1 | ||||||
| Sequence conflict | 1225 | 1 | S → A in AAC50139. Ref.1 | ||||||
| Sequence conflict | 1257 | 1 | S → C in AAC50139. Ref.1 | ||||||
| Sequence conflict | 1297 | 1 | C → G in AAC50139. Ref.1 | ||||||
| Sequence conflict | 1320 | 1 | V → A in AAC50139. Ref.1 | ||||||
| Sequence conflict | 1444 | 1 | N → S in AAC50139. Ref.1 | ||||||
| Sequence conflict | 1474 | 1 | F → L in AAC50139. Ref.1 | ||||||
| Sequence conflict | 1665 – 1666 | 2 | TF → SL in AAC50139. Ref.1 | ||||||
| Sequence conflict | 1677 | 1 | I → V in AAC50139. Ref.1 | ||||||
| Sequence conflict | 1741 | 1 | P → S in AAC50139. Ref.1 | ||||||
| Sequence conflict | 1762 | 1 | S → G in AAC50139. Ref.1 | ||||||
| Sequence conflict | 1822 | 1 | C → S in AAC50139. Ref.1 | ||||||
| Sequence conflict | 1875 | 1 | M → T in AAC50139. Ref.1 | ||||||
| Sequence conflict | 1888 | 1 | D → G in AAC50139. Ref.1 | ||||||
| Sequence conflict | 1997 | 1 | I → V in AAC50139. Ref.1 | ||||||
| Sequence conflict | 2013 | 1 | Q → H in AAC50139. Ref.1 | ||||||
| Sequence conflict | 2058 | 1 | D → H in AAC50139. Ref.1 | ||||||
| Sequence conflict | 2075 | 1 | C → S in AAC50139. Ref.1 | ||||||
| Sequence conflict | 2098 – 2099 | 2 | SS → PT in AAC50139. Ref.1 | ||||||
| Sequence conflict | 2158 – 2159 | 2 | TA → PT in AAC50139. Ref.1 | ||||||
| Sequence conflict | 2166 | 1 | N → S in AAC50139. Ref.1 | ||||||
| Sequence conflict | 2234 | 1 | N → S in AAC50139. Ref.1 | ||||||
| Sequence conflict | 2321 | 1 | H → R in AAP94122. Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Human acetyl-CoA carboxylase: characterization, molecular cloning, and evidence for two isoforms." Abu-Elheiga L., Jayakumar A., Baldini A., Chirala S.S., Wakil S.J. Proc. Natl. Acad. Sci. U.S.A. 92:4011-4015(1995) [PubMed: 7732023] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Liver. |
| [2] | "Human acetyl-CoA carboxylase 1 gene: presence of three promoters and heterogeneity at the 5'-untranslated mRNA region." Mao J., Chirala S.S., Wakil S.J. Proc. Natl. Acad. Sci. U.S.A. 100:7515-7520(2003) [PubMed: 12810950] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), NUCLEOTIDE SEQUENCE [MRNA] OF 1-366 (ISOFORMS 2 AND 3), NUCLEOTIDE SEQUENCE [MRNA] OF 1-120 (ISOFORM 4). Tissue: Adipocyte. |
| [3] | "Acetyl-CoA carboxylase alpha gene and breast cancer susceptibility." Sinilnikova O.M., Ginolhac S.M., Magnard C., Leone M., Anczukow O., Hughes D., Moreau K., Thompson D., Coutanson C., Hall J., Romestaing P., Gerard J.-P., Bonadona V., Lasset C., Goldgar D.E., Joulin V., Venezia N.D., Lenoir G.M. Carcinogenesis 25:2417-2424(2004) [PubMed: 15333468] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT VAL-2271. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4). Tissue: Brain. |
| [5] | "Characterisation of an N-terminal variant of acetyl-CoA carboxylase-alpha: expression in human tissues and evolutionary aspects." Travers M.T., Vallance A.J., Clegg R.A., Thomson R., Price N.T., Barber M.C. Biochim. Biophys. Acta 1634:97-106(2003) [PubMed: 14643797] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-113 (ISOFORM 2), NUCLEOTIDE SEQUENCE [MRNA] OF 1-93 (ISOFORM 3). Tissue: Mammary gland and Testis. |
| [6] | "Asymmetric expression of transcripts derived from the shared promoter between the divergently oriented ACACA and TADA2L genes." Travers M.T., Cambot M., Kennedy H.T., Lenoir G.M., Barber M.C., Joulin V. Genomics 85:71-84(2005) [PubMed: 15607423] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-47 (ISOFORM 1). Tissue: Testis. |
| [7] | Bienvenut W.V., Boldt K., von Kriegsheim A.F., Kolch W. Submitted (JUL-2007) to UniProtKB Cited for: PROTEIN SEQUENCE OF 1-18; 39-45; 77-86; 99-111; 121-132; 153-170; 218-224; 267-276; 278-288; 323-335; 568-579; 589-615; 646-657; 748-755; 818-838; 985-992; 997-1008; 1083-1096; 1147-1169; 1192-1199; 1233-1247; 1283-1294; 1317-1325; 1327-1334; 1372-1385; 1401-1420; 1508-1514; 1553-1564; 1668-1687; 1714-1731; 1750-1759; 1782-1798; 1824-1833; 1838-1856; 1905-1916; 1922-1929; 1978-2009; 2063-2072; 2104-2111; 2115-2127; 2139-2161; 2200-2209; 2213-2218; 2221-2229 AND 2261-2293, ACETYLATION AT MET-1, PHOSPHORYLATION AT SER-80, MASS SPECTROMETRY. Tissue: Hepatoma. |
| [8] | "BRCA1 interacts with acetyl-CoA carboxylase through its tandem of BRCT domains." Magnard C., Bachelier R., Vincent A., Jaquinod M., Kieffer S., Lenoir G.M., Venezia N.D. Oncogene 21:6729-6739(2002) [PubMed: 12360400] [Abstract] Cited for: INTERACTION WITH BRCA1. |
| [9] | "Large-scale characterization of HeLa cell nuclear phosphoproteins." Beausoleil S.A., Jedrychowski M., Schwartz D., Elias J.E., Villen J., Li J., Cohn M.A., Cantley L.C., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 101:12130-12135(2004) [PubMed: 15302935] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-29, MASS SPECTROMETRY. Tissue: Epithelium. |
| [10] | "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks." Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M. Cell 127:635-648(2006) [PubMed: 17081983] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-23; SER-25; SER-29; SER-48; SER-50; SER-53; SER-56; THR-58 AND SER-60, MASS SPECTROMETRY. Tissue: Epithelium. |
| [11] | "BRCA1 affects lipid synthesis through its interaction with acetyl-CoA carboxylase." Moreau K., Dizin E., Ray H., Luquain C., Lefai E., Foufelle F., Billaud M., Lenoir G.M., Venezia N.D. J. Biol. Chem. 281:3172-3181(2006) [PubMed: 16326698] [Abstract] Cited for: INTERACTION WITH BRCA1. |
| [12] | "ACCA phosphopeptide recognition by the BRCT repeats of BRCA1." Ray H., Moreau K., Dizin E., Callebaut I., Venezia N.D. J. Mol. Biol. 359:973-982(2006) [PubMed: 16698035] [Abstract] Cited for: PHOSPHORYLATION AT SER-1263, MUTAGENESIS OF SER-78; SER-344; SER-432; SER-1201; SER-1263; SER-1585; SER-1952 AND SER-2211. |
| [13] | "Global proteomic profiling of phosphopeptides using electron transfer dissociation tandem mass spectrometry." Molina H., Horn D.M., Tang N., Mathivanan S., Pandey A. Proc. Natl. Acad. Sci. U.S.A. 104:2199-2204(2007) [PubMed: 17287340] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-1042; SER-2099 AND TYR-2108, MASS SPECTROMETRY. |
| [14] | "Automated phosphoproteome analysis for cultured cancer cells by two-dimensional nanoLC-MS using a calcined titania/C18 biphasic column." Imami K., Sugiyama N., Kyono Y., Tomita M., Ishihama Y. Anal. Sci. 24:161-166(2008) [PubMed: 18187866] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1844, MASS SPECTROMETRY. |
| [15] | "Acetyl-CoA carboxylase deficiency: an inborn error of de novo fatty acid synthesis." Blom W., de Muinck Keizer S.M.P.F., Scholte H.R. N. Engl. J. Med. 305:465-466(1981) [PubMed: 6114432] [Abstract] Cited for: INVOLVEMENT IN ACACA DEFICIENCY. |
| [16] | "Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis." Cantin G.T., Yi W., Lu B., Park S.K., Xu T., Lee J.-D., Yates J.R. III J. Proteome Res. 7:1346-1351(2008) [PubMed: 18220336] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-50 AND SER-488, MASS SPECTROMETRY. |
| [17] | "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle." Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M. Mol. Cell 31:438-448(2008) [PubMed: 18691976] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-5; SER-25; SER-29 AND SER-48, MASS SPECTROMETRY. |
| [18] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed: 18669648] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-23; SER-25; SER-29 AND SER-80, MASS SPECTROMETRY. |
| [19] | Colinge J., Superti-Furga G., Bennett K.L. Submitted (OCT-2008) to UniProtKB Cited for: IDENTIFICATION [LARGE SCALE ANALYSIS], MASS SPECTROMETRY. |
| [20] | "The consensus coding sequences of human breast and colorectal cancers." Sjoeblom T., Jones S., Wood L.D., Parsons D.W., Lin J., Barber T.D., Mandelker D., Leary R.J., Ptak J., Silliman N., Szabo S., Buckhaults P., Farrell C., Meeh P., Markowitz S.D., Willis J., Dawson D., Willson J.K.V. Velculescu V.E.Science 314:268-274(2006) [PubMed: 16959974] [Abstract] Cited for: VARIANT [LARGE SCALE ANALYSIS] GLN-1687. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| U19822 mRNA. Translation: AAC50139.1. AY315619 mRNA. Translation: AAP94114.1. AY315620 mRNA. Translation: AAP94115.1. AY315621 mRNA. Translation: AAP94116.1. AY315623 mRNA. Translation: AAP94118.1. AY315625 mRNA. Translation: AAP94120.1. Different initiation. AY315627 mRNA. Translation: AAP94122.1. AY237919 mRNA. Translation: AAP69841.1. BC137287 mRNA. Translation: AAI37288.1. AJ534888 mRNA. Translation: CAD59556.1. AJ534889 mRNA. Translation: CAD59557.1. AJ564444 mRNA. Translation: CAD92089.1. | |
| IPI | IPI00011569. IPI00396015. IPI00396018. IPI00847501. |
| PIR | I38928. |
| RefSeq | NP_942131.1. NP_942133.1. NP_942134.1. NP_942135.1. NP_942136.1. |
| UniGene | Hs.160556 |
3D structure databases | |
| HSSP | HSSP built from PDB template 1OD4 based on UniProtKB Q00955. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q13085. 10 interactions. |
PTM databases | |
| PhosphoSite | Q13085. |
Proteomic databases | |
| PRIDE | Q13085. |
Genome annotation databases | |
| Ensembl | ENSG00000132142. Homo sapiens. [Contig view] |
| GeneID | 31. |
| KEGG | hsa:31. |
| UCSC | uc002hnk.1. human. uc002hnm.1. human. |
Organism-specific databases | |
| GeneCards | GC17M032516. |
| HGNC | HGNC:84. ACACA. |
| HPA | CAB013715. |
| MIM | 200350. gene+phenotype. |
| PharmGKB | PA24421. |
| GenAtlas | Search... |
Phylogenomic databases | |
| HOVERGEN | Q13085. |
Enzyme and pathway databases | |
| BRENDA | 6.3.4.14. 247. 6.4.1.2. 247. |
| Reactome | REACT_1505. Integration of energy metabolism. REACT_602. Metabolism of lipids and lipoproteins. |
Gene expression databases | |
| ArrayExpress | Q13085. |
| Bgee | Q13085. |
| GermOnline | ENSG00000132142. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR013537. AcCoA_COase_cen. IPR011761. ATP-grasp. IPR013816. ATP_grasp_subdomain_2. IPR011764. BC. IPR001882. Biotin_BS. IPR005482. Biotin_COase_C. IPR000089. Biotin_lipoyl. IPR005479. CarbamoylP_synth_lsu_ATP-bd. IPR005481. CarbamoylP_synth_lsu_N. IPR000022. Carboxyl_trans. IPR011763. COA_CT_C. IPR011762. COA_CT_N. IPR013817. Pre-ATP_grasp. [Graphical view] |
| Gene3D | G3DSA:3.30.470.20. ATP_grasp_subdomain_2. 1 hit. G3DSA:3.40.50.20. Pre-ATP_grasp. 1 hit. |
| Pfam | PF08326. ACC_central. 1 hit. PF02785. Biotin_carb_C. 1 hit. PF00364. Biotin_lipoyl. 1 hit. PF01039. Carboxyl_trans. 1 hit. PF00289. CPSase_L_chain. 1 hit. PF02786. CPSase_L_D2. 1 hit. [Graphical view] |
| PROSITE | PS50975. ATP_GRASP. 1 hit. PS50979. BC. 1 hit. PS00188. BIOTIN. 1 hit. PS50968. BIOTINYL_LIPOYL. 1 hit. PS50989. COA_CT_CTER. 1 hit. PS50980. COA_CT_NTER. 1 hit. PS00866. CPSASE_1. 1 hit. PS00867. CPSASE_2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| DrugBank | DB00121. Biotin. |
| NextBio | 111. |
| SOURCE | Search... |
Entry information
| Entry name | ACACA_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q13085 Secondary accession number(s): B2RP68 Q86WB3 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| Human chromosome 17 Human chromosome 17: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PATHWAY comments Index of metabolic and biosynthesis pathways |
| SIMILARITY comments Index of protein domains and families |

Clusters with


