Q13057 (COASY_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 133.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Bifunctional coenzyme A synthase Short name=CoA synthase Alternative name(s): NBP POV-2 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 564 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Bifunctional enzyme that catalyzes the fourth and fifth sequential steps of CoA biosynthetic pathway. The fourth reaction is catalyzed by the phosphopantetheine adenylyltransferase, coded by the coaD domain; the fifth reaction is catalyzed by the dephospho-CoA kinase, coded by the coaE domain. May act as a point of CoA biosynthesis regulation. Ref.1 |
| Catalytic activity | ATP + pantetheine 4'-phosphate = diphosphate + 3'-dephospho-CoA. ATP + 3'-dephospho-CoA = ADP + CoA. |
| Pathway | Cofactor biosynthesis; coenzyme A biosynthesis; CoA from (R)-pantothenate: step 4/5. Cofactor biosynthesis; coenzyme A biosynthesis; CoA from (R)-pantothenate: step 5/5. |
| Subunit structure | Monomer. Ref.2 |
| Subcellular location | Cytoplasm By similarity. |
| Tissue specificity | Expressed in all tissues examined including brain, heart, skeletal muscle, colon, thymus, spleen, kidney, liver, small intestine, placenta, lung and peripheral blood leukocyte. Lowest expression in peripheral blood leukocytes and highest in kidney and liver. Isoform 2 is expressed mainly in the brain. Ref.1 |
| Sequence similarities | In the central section; belongs to the eukaryotic CoaD family. Contains 1 DPCK (dephospho-CoA kinase) domain. |
| Biophysicochemical properties | Kinetic parameters: KM=7.6 mM for 4'-phoshopantetheine KM=145 mM for ATP (in the PPAT reaction) KM=16.7 mM for dephospho-CoA KM=34.4 mM for ATP (in the DPCK reaction) |
| Sequence caution | The sequence AAA69699.1 differs from that shown. Reason: Frameshift at position 535. The sequence AAF87955.1 differs from that shown. Reason: Erroneous initiation. The sequence AAH06354.1 differs from that shown. Reason: Erroneous initiation. The sequence AAH20985.1 differs from that shown. Reason: Erroneous initiation. The sequence AK075415 differs from that shown. Reason: Frameshift at position 315. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Coenzyme A biosynthesis |
| Cellular component | Cytoplasm |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Ligand | ATP-binding Nucleotide-binding |
| Molecular function | Kinase Nucleotidyltransferase Transferase |
| PTM | Phosphoprotein |
| Technical term | Complete proteome Multifunctional enzyme Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | coenzyme A biosynthetic process Traceable author statement Ref.2. Source: UniProtKB pantothenate metabolic processTraceable author statement. Source: Reactome |
| Cellular_component | mitochondrial outer membrane Traceable author statement. Source: Reactome nucleusInferred from direct assay. Source: HPA |
| Molecular_function | ATP binding Inferred from electronic annotation. Source: UniProtKB-KW dephospho-CoA kinase activityInferred from direct assay Ref.2. Source: UniProtKB pantetheine-phosphate adenylyltransferase activityInferred from direct assay Ref.2. Source: UniProtKB |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q13057-1) Also known as: CoASy alpha; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q13057-2) Also known as: CoASy beta; The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MRTPRLRAQPRGAVYQAPSPPPAPVGLGSM |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 564 | 564 | Bifunctional coenzyme A synthase | PRO_0000173039 | |||||
Regions | |||||||||
| Domain | 360 – 563 | 204 | DPCK | ||||||
| Nucleotide binding | 365 – 372 | 8 | ATP Potential | ||||||
| Region | 180 – 358 | 179 | Phosphopantetheine adenylyltransferase | ||||||
Amino acid modifications | |||||||||
| Modified residue | 178 | 1 | Phosphoserine Ref.12 Ref.13 Ref.14 | ||||||
| Modified residue | 183 | 1 | Phosphoserine Ref.14 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 | 1 | M → MRTPRLRAQPRGAVYQAPSP PPAPVGLGSM in isoform 2. | VSP_036404 | |||||
| Natural variant | 55 | 1 | S → Y. Ref.1 Ref.4 Ref.6 Ref.7 Corresponds to variant rs615942 [ dbSNP | Ensembl ]. | VAR_030299 | |||||
Experimental info | |||||||||
| Sequence conflict | 41 | 1 | L → P in BAG36775. Ref.4 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Complete reconstitution of the human coenzyme A biosynthetic pathway via comparative genomics." Daugherty M., Polanuyer B., Farrell M., Scholle M., Lykidis A., de Crecy-Lagard V., Osterman A. J. Biol. Chem. 277:21431-21439(2002) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, TISSUE SPECIFICITY, VARIANT TYR-55. |
| [2] | "Identification and characterization of the gene encoding the human phosphopantetheine adenylyltransferase and dephospho-CoA kinase bifunctional enzyme (CoA synthase)." Aghajanian S., Worrall D.M. Biochem. J. 365:13-18(2002) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), SUBUNIT. |
| [3] | "HRI human cDNA sequencing project." Ota T., Nishikawa T., Suzuki Y., Kawai-Hio Y., Hayashi K., Ishii S., Saito K., Yamamoto J., Wakamatsu A., Nagai T., Nakamura Y., Nagahari K., Sugano S., Isogai T. Submitted (MAR-2002) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Teratocarcinoma. |
| [4] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2), VARIANT TYR-55. |
| [5] | "DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage." Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L. Nusbaum C.Nature 440:1045-1049(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT TYR-55. |
| [7] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT TYR-55. Tissue: Colon, Muscle and Uterus. |
| [8] | "Molecular cloning of a NBP gene cDNA." Zhu Y.-B., Han Y. Submitted (NOV-1999) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 165-564 (ISOFORMS 1/2). |
| [9] | "A 100-kb physical and transcriptional map around the EDH17B2 gene: identification of three novel genes and a pseudogene of a human homologue of the rat PRL-1 tyrosine phosphatase." Montagna M., Serova O., Sylla B.S., Feunteun J., Lenoir G.M. Hum. Genet. 96:532-538(1995) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 332-564 (ISOFORMS 1/2). Tissue: Ovary. |
| [10] | "Cloning of human full-length CDSs in BD Creator(TM) system donor vector." Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A. Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 340-564 (ISOFORMS 1/2). |
| [11] | "Identification of a novel CoA synthase isoform, which is primarily expressed in the brain." Nemazanyy I., Panasyuk G., Breus O., Zhyvoloup A., Filonenko V., Gout I.T. Biochem. Biophys. Res. Commun. 341:995-1000(2006) [PubMed] [Europe PMC] [Abstract] Cited for: ALTERNATIVE SPLICING. |
| [12] | "Phosphoproteome of resting human platelets." Zahedi R.P., Lewandrowski U., Wiesner J., Wortelkamp S., Moebius J., Schuetz C., Walter U., Gambaryan S., Sickmann A. J. Proteome Res. 7:526-534(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-178, MASS SPECTROMETRY. Tissue: Platelet. |
| [13] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-178, MASS SPECTROMETRY. Tissue: Leukemic T-cell. |
| [14] | "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis." Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M. Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-178 AND SER-183, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [15] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF453478 mRNA. Translation: AAL50813.1. AY094602 mRNA. Translation: AAM19996.1. AK075415 mRNA. No translation available. AK297153 mRNA. Translation: BAG59652.1. AK314076 mRNA. Translation: BAG36775.1. AC067852 Genomic DNA. No translation available. CH471152 Genomic DNA. Translation: EAW60840.1. BC006354 mRNA. Translation: AAH06354.1. Different initiation. BC020985 mRNA. Translation: AAH20985.1. Different initiation. BC067254 mRNA. Translation: AAH67254.1. AF208536 mRNA. Translation: AAF87955.1. Different initiation. U18919 mRNA. Translation: AAA69699.1. Frameshift. BT007168 mRNA. Translation: AAP35832.1. |
| IPI | IPI00184821. IPI00909064. |
| RefSeq | NP_001035994.1. NM_001042529.2. NP_001035997.2. NM_001042532.3. NP_079509.5. NM_025233.6. |
| UniGene | Hs.296422. Hs.742262. |
3D structure databases | |
| ProteinModelPortal | Q13057. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q13057. 2 interactions. |
| MINT | MINT-1212728. |
| STRING | 9606.ENSP00000377404. |
PTM databases | |
| PhosphoSite | Q13057. |
Polymorphism databases | |
| DMDM | 32363505. |
Proteomic databases | |
| PaxDb | Q13057. |
| PRIDE | Q13057. |
Protocols and materials databases | |
| DNASU | 80347. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000393818; ENSP00000377406; ENSG00000068120. ENST00000420359; ENSP00000413338; ENSG00000068120. ENST00000421097; ENSP00000393564; ENSG00000068120. ENST00000449624; ENSP00000407740; ENSG00000068120. ENST00000590958; ENSP00000464814; ENSG00000068120. |
| GeneID | 80347. |
| KEGG | hsa:80347. |
| UCSC | uc002hzz.3. human. uc010cyj.3. human. |
Organism-specific databases | |
| CTD | 80347. |
| GeneCards | GC17P040714. |
| HGNC | HGNC:29932. COASY. |
| HPA | HPA022875. HPA022912. HPA023273. |
| MIM | 609855. gene. |
| neXtProt | NX_Q13057. |
| PharmGKB | PA134867942. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG0237. |
| HOVERGEN | HBG051059. |
| InParanoid | Q13057. |
| KO | K02318. |
| OMA | PVQATFE. |
| OrthoDB | EOG4RXXZW. |
| PhylomeDB | Q13057. |
Enzyme and pathway databases | |
| BRENDA | 2.7.1.24. 2681. |
| Reactome | REACT_111217. Metabolism. |
| SABIO-RK | Q13057. |
| UniPathway | UPA00241; UER00355. UPA00241; UER00356. |
Gene expression databases | |
| Bgee | Q13057. |
| CleanEx | HS_COASY. |
| Genevestigator | Q13057. |
| GermOnline | ENSG00000068120. Homo sapiens. |
Family and domain databases | |
| Gene3D | 3.40.50.620. 1 hit. |
| InterPro | IPR004821. Cyt_trans-like. IPR001977. Depp_CoAkinase. IPR014729. Rossmann-like_a/b/a_fold. [Graphical view] |
| Pfam | PF01121. CoaE. 1 hit. PF01467. CTP_transf_2. 1 hit. [Graphical view] |
| TIGRFAMs | TIGR00152. TIGR00152. 1 hit. |
| PROSITE | PS51219. DPCK. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | COASY. human. |
| GenomeRNAi | 80347. |
| NextBio | 70944. |
| SOURCE | Search... |
Entry information
| Entry name | COASY_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q13057 Secondary accession number(s): B2RA78 Q9NRM3 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 17 Human chromosome 17: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PATHWAY comments Index of metabolic and biosynthesis pathways |
| SIMILARITY comments Index of protein domains and families |

Clusters with
