SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q13002

- GRIK2_HUMAN

UniProt

Q13002 - GRIK2_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Glutamate receptor ionotropic, kainate 2

Gene
GRIK2, GLUR6
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Ionotropic glutamate receptor. L-glutamate acts as an excitatory neurotransmitter at many synapses in the central nervous system. Binding of the excitatory neurotransmitter L-glutamate induces a conformation change, leading to the opening of the cation channel, and thereby converts the chemical signal to an electrical impulse. The receptor then desensitizes rapidly and enters a transient inactive state, characterized by the presence of bound agonist. May be involved in the transmission of light information from the retina to the hypothalamus. Modulates cell surface expression of NETO2 By similarity.

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Binding sitei523 – 5231Glutamate By similarity
Binding sitei738 – 7381Glutamate By similarity

GO - Molecular functioni

  1. extracellular-glutamate-gated ion channel activity Source: RefGenome
  2. kainate selective glutamate receptor activity Source: UniProtKB

GO - Biological processi

  1. behavioral fear response Source: Ensembl
  2. cellular calcium ion homeostasis Source: Ensembl
  3. glutamate receptor signaling pathway Source: ProtInc
  4. intracellular protein transport Source: Ensembl
  5. ionotropic glutamate receptor signaling pathway Source: RefGenome
  6. ion transmembrane transport Source: GOC
  7. negative regulation of neuron apoptotic process Source: Ensembl
  8. negative regulation of synaptic transmission, glutamatergic Source: Ensembl
  9. neuronal action potential Source: Ensembl
  10. positive regulation of synaptic transmission Source: UniProtKB
  11. regulation of excitatory postsynaptic membrane potential Source: Ensembl
  12. regulation of inhibitory postsynaptic membrane potential Source: Ensembl
  13. regulation of long-term neuronal synaptic plasticity Source: Ensembl
  14. regulation of short-term neuronal synaptic plasticity Source: UniProtKB
  15. regulation of synaptic transmission Source: UniProtKB
  16. synaptic transmission Source: Reactome
  17. synaptic transmission, glutamatergic Source: RefGenome
  18. transport Source: ProtInc
Complete GO annotation...

Keywords - Molecular functioni

Ion channel, Ligand-gated ion channel, Receptor

Keywords - Biological processi

Ion transport, Transport

Enzyme and pathway databases

ReactomeiREACT_21343. Activation of Na-permeable Kainate Receptors.
REACT_21346. Activation of Ca-permeable Kainate Receptor.
SignaLinkiQ13002.

Names & Taxonomyi

Protein namesi
Recommended name:
Glutamate receptor ionotropic, kainate 2
Short name:
GluK2
Alternative name(s):
Excitatory amino acid receptor 4
Short name:
EAA4
Glutamate receptor 6
Short name:
GluR-6
Short name:
GluR6
Gene namesi
Name:GRIK2
Synonyms:GLUR6
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 6

Organism-specific databases

HGNCiHGNC:4580. GRIK2.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini32 – 561530Extracellular Reviewed predictionAdd
BLAST
Transmembranei562 – 58221Helical; Reviewed predictionAdd
BLAST
Topological domaini583 – 63553Cytoplasmic Reviewed predictionAdd
BLAST
Transmembranei636 – 65621Helical; Reviewed predictionAdd
BLAST
Topological domaini657 – 819163Extracellular Reviewed predictionAdd
BLAST
Transmembranei820 – 84021Helical; Reviewed predictionAdd
BLAST
Topological domaini841 – 90868Cytoplasmic Reviewed predictionAdd
BLAST

GO - Cellular componenti

  1. cell junction Source: UniProtKB-KW
  2. dendrite Source: RefGenome
  3. integral component of plasma membrane Source: ProtInc
  4. kainate selective glutamate receptor complex Source: RefGenome
  5. neuronal cell body Source: Ensembl
  6. plasma membrane Source: Reactome
  7. postsynaptic membrane Source: RefGenome
  8. presynaptic membrane Source: RefGenome
Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Cell membrane, Membrane, Postsynaptic cell membrane, Synapse

Pathology & Biotechi

Involvement in diseasei

Mental retardation, autosomal recessive 6 (MRT6) [MIM:611092]: A disorder characterized by significantly below average general intellectual functioning associated with impairments in adaptive behavior and manifested during the developmental period. In contrast to syndromic or specific mental retardation which also present with associated physical, neurological and/or psychiatric manifestations, intellectual deficiency is the only primary symptom of non-syndromic mental retardation. MRT6 patients display mild to severe mental retardation and psychomotor development delay in early childhood. Patients do not have neurologic problems, congenital malformations, or facial dysmorphism. Body height, weight, and head circumference are normal.
Note: The disease is caused by mutations affecting the gene represented in this entry.1 Publication

Keywords - Diseasei

Mental retardation

Organism-specific databases

MIMi611092. phenotype.
Orphaneti88616. Autosomal recessive nonsyndromic intellectual disability.
PharmGKBiPA164741600.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 3131 Reviewed predictionAdd
BLAST
Chaini32 – 908877Glutamate receptor ionotropic, kainate 2PRO_0000011544Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi67 – 671N-linked (GlcNAc...) Reviewed prediction
Glycosylationi73 – 731N-linked (GlcNAc...) Reviewed prediction
Disulfide bondi96 ↔ 347 By similarity
Glycosylationi275 – 2751N-linked (GlcNAc...) Reviewed prediction
Glycosylationi378 – 3781N-linked (GlcNAc...) Reviewed prediction
Glycosylationi412 – 4121N-linked (GlcNAc...) Reviewed prediction
Glycosylationi423 – 4231N-linked (GlcNAc...) Reviewed prediction
Glycosylationi430 – 4301N-linked (GlcNAc...) Reviewed prediction
Glycosylationi546 – 5461N-linked (GlcNAc...) Reviewed prediction
Modified residuei846 – 8461Phosphoserine; by PKC1 Publication
Modified residuei868 – 8681Phosphoserine; by PKC1 Publication
Cross-linki886 – 886Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO-1)1 Publication

Post-translational modificationi

Sumoylation mediates kainate receptor-mediated endocytosis and regulates synaptic transmission. Sumoylation is enhanced by PIAS3 and desumoylated by SENP1 By similarity.1 Publication
Ubiquitinated. Ubiquitination regulates the GRIK2 levels at the synapse by leading kainate receptor degradation through proteasome By similarity.
Phosphorylated by PKC at Ser-868 upon agonist activation, this directly enhance sumoylation.1 Publication

Keywords - PTMi

Disulfide bond, Glycoprotein, Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

MaxQBiQ13002.
PaxDbiQ13002.
PRIDEiQ13002.

PTM databases

PhosphoSiteiQ13002.

Expressioni

Tissue specificityi

Expression is higher in cerebellum than in cerebral cortex.

Gene expression databases

ArrayExpressiQ13002.
BgeeiQ13002.
CleanExiHS_GRIK2.
GenevestigatoriQ13002.

Organism-specific databases

HPAiCAB022463.
HPA014395.
HPA014623.

Interactioni

Subunit structurei

Homotetramer or heterotetramer of pore-forming glutamate receptor subunits. Tetramers may be formed by the dimerization of dimers Inferred. Assembles into a kainate-gated homomeric channel that does not bind AMPA. GRIK2 associated to GRIK5 forms functional channels that can be gated by AMPA By similarity. Interacts with DLG4. Interacts with NETO2 By similarity. Interacts (via C-terminus) with KLHL17 (via kelch repeats); the interaction targets GRIK2 for degradation via ubiquitin-proteasome pathway By similarity.1 Publication

Protein-protein interaction databases

BioGridi109155. 12 interactions.
IntActiQ13002. 2 interactions.
STRINGi9606.ENSP00000397026.

Structurei

Secondary structure

1
908
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi433 – 4375
Turni441 – 4433
Beta strandi444 – 4463
Helixi455 – 4584
Beta strandi459 – 4613
Helixi462 – 47413
Beta strandi478 – 4825
Turni493 – 4953
Helixi500 – 5067
Beta strandi511 – 5133
Helixi521 – 5244
Beta strandi527 – 5293
Beta strandi533 – 5364
Beta strandi538 – 5447
Helixi671 – 6755
Beta strandi678 – 6836
Helixi689 – 6968
Helixi700 – 71112
Helixi713 – 7164
Beta strandi718 – 7203
Helixi721 – 73010
Beta strandi731 – 7388
Helixi739 – 74810
Beta strandi752 – 7576
Beta strandi762 – 7643
Beta strandi767 – 7693
Helixi774 – 78714
Helixi790 – 79910

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
3QXMX-ray1.65A/B429-544[»]
A/B667-806[»]
ProteinModelPortaliQ13002.
SMRiQ13002. Positions 33-415, 430-805.

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni516 – 5183Glutamate binding By similarity
Regioni689 – 6902Glutamate binding By similarity

Sequence similaritiesi

Keywords - Domaini

Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG316680.
HOVERGENiHBG051839.
InParanoidiQ13002.
KOiK05202.
OMAiVNGQWNG.
OrthoDBiEOG71G9W6.
PhylomeDBiQ13002.
TreeFamiTF334668.

Family and domain databases

InterProiIPR001828. ANF_lig-bd_rcpt.
IPR019594. Glu_rcpt_Glu/Gly-bd.
IPR001320. Iontro_glu_rcpt.
IPR001508. NMDA_rcpt.
IPR028082. Peripla_BP_I.
[Graphical view]
PfamiPF01094. ANF_receptor. 1 hit.
PF00060. Lig_chan. 1 hit.
PF10613. Lig_chan-Glu_bd. 1 hit.
[Graphical view]
PRINTSiPR00177. NMDARECEPTOR.
SMARTiSM00918. Lig_chan-Glu_bd. 1 hit.
SM00079. PBPe. 1 hit.
[Graphical view]
SUPFAMiSSF53822. SSF53822. 1 hit.

Sequences (7)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 7 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q13002-1) [UniParc]FASTAAdd to Basket

Also known as: A

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MKIIFPILSN PVFRRTVKLL LCLLWIGYSQ GTTHVLRFGG IFEYVESGPM    50
GAEELAFRFA VNTINRNRTL LPNTTLTYDT QKINLYDSFE ASKKACDQLS 100
LGVAAIFGPS HSSSANAVQS ICNALGVPHI QTRWKHQVSD NKDSFYVSLY 150
PDFSSLSRAI LDLVQFFKWK TVTVVYDDST GLIRLQELIK APSRYNLRLK 200
IRQLPADTKD AKPLLKEMKR GKEFHVIFDC SHEMAAGILK QALAMGMMTE 250
YYHYIFTTLD LFALDVEPYR YSGVNMTGFR ILNTENTQVS SIIEKWSMER 300
LQAPPKPDSG LLDGFMTTDA ALMYDAVHVV SVAVQQFPQM TVSSLQCNRH 350
KPWRFGTRFM SLIKEAHWEG LTGRITFNKT NGLRTDFDLD VISLKEEGLE 400
KIGTWDPASG LNMTESQKGK PANITDSLSN RSLIVTTILE EPYVLFKKSD 450
KPLYGNDRFE GYCIDLLREL STILGFTYEI RLVEDGKYGA QDDANGQWNG 500
MVRELIDHKA DLAVAPLAIT YVREKVIDFS KPFMTLGISI LYRKPNGTNP 550
GVFSFLNPLS PDIWMYILLA YLGVSCVLFV IARFSPYEWY NPHPCNPDSD 600
VVENNFTLLN SFWFGVGALM QQGSELMPKA LSTRIVGGIW WFFTLIIISS 650
YTANLAAFLT VERMESPIDS ADDLAKQTKI EYGAVEDGAT MTFFKKSKIS 700
TYDKMWAFMS SRRQSVLVKS NEEGIQRVLT SDYAFLMEST TIEFVTQRNC 750
NLTQIGGLID SKGYGVGTPM GSPYRDKITI AILQLQEEGK LHMMKEKWWR 800
GNGCPEEESK EASALGVQNI GGIFIVLAAG LVLSVFVAVG EFLYKSKKNA 850
QLEKRSFCSA MVEELRMSLK CQRRLKHKPQ APVIVKTEEV INMHTFNDRR 900
LPGKETMA 908
Length:908
Mass (Da):102,583
Last modified:November 1, 1996 - v1
Checksum:i5F34630524401E84
GO
Isoform 2 (identifier: Q13002-2) [UniParc]FASTAAdd to Basket

Also known as: B

The sequence of this isoform differs from the canonical sequence as follows:
     855-908: RSFCSAMVEELRMSLKCQRRLKHKPQAPVIVKTEEVINMHTFNDRRLPGKETMA → ESSIWLVPPYHPDTV

Show »
Length:869
Mass (Da):97,981
Checksum:iD85D8A5CB2B0C1FA
GO
Isoform 3 (identifier: Q13002-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     585-908: Missing.

Show »
Length:584
Mass (Da):66,108
Checksum:iE0E9EC92339921A1
GO
Isoform 4 (identifier: Q13002-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     547-622: Missing.

Show »
Length:832
Mass (Da):93,966
Checksum:iC0E9B91AC6AD6012
GO
Isoform 5 (identifier: Q13002-5) [UniParc]FASTAAdd to Basket

Also known as: C

The sequence of this isoform differs from the canonical sequence as follows:
     856-908: SFCSAMVEEL...RRLPGKETMA → AKTKLPQDYV...PSSSSLSSCS

Show »
Length:892
Mass (Da):100,243
Checksum:i50A477CB1265AF26
GO
Isoform 6 (identifier: Q13002-6) [UniParc]FASTAAdd to Basket

Also known as: D

The sequence of this isoform differs from the canonical sequence as follows:
     509-695: Missing.
     855-908: RSFCSAMVEELRMSLKCQRRLKHKPQAPVIVKTEEVINMHTFNDRRLPGKETMA → ESSIWLVPPYHPDTV

Note: Seems to be specific for non-neuronal cells. May not function as active channel.

Show »
Length:682
Mass (Da):77,054
Checksum:iB08053B65BE3087F
GO
Isoform 7 (identifier: Q13002-7) [UniParc]FASTAAdd to Basket

Also known as: E

The sequence of this isoform differs from the canonical sequence as follows:
     510-714: Missing.
     856-908: SFCSAMVEEL...RRLPGKETMA → AKTKLPQDYV...PSSSSLSSCS

Note: Seems to be specific for non-neuronal cells. May not function as active channel.

Show »
Length:687
Mass (Da):77,112
Checksum:i5BBD1224CA1A5FCC
GO

RNA editingi

Partially edited. The presence of Gln at position 621 (non-edited) determines channels with low calcium permeability, whereas Arg (edited) determines a higher calcium permeability especially if the preceding sites are fully edited. This receptor is nearly completely edited in all gray matter structures (90% of the receptors), whereas much less edited in the white matter (10% of the receptors).2 Publications

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti187 – 1871E → Q in a breast cancer sample; somatic mutation. 1 Publication
VAR_035694
Natural varianti567 – 5671I → V in RNA edited version.
VAR_000305
Natural varianti571 – 5711Y → C in RNA edited version.
VAR_000306
Natural varianti621 – 6211Q → R in RNA edited version.
VAR_000307
Natural varianti766 – 7661V → I.
Corresponds to variant rs3213608 [ dbSNP | Ensembl ].
VAR_049186
Natural varianti867 – 8671M → I.
Corresponds to variant rs2235076 [ dbSNP | Ensembl ].
VAR_037633

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei509 – 695187Missing in isoform 6. VSP_044388Add
BLAST
Alternative sequencei510 – 714205Missing in isoform 7. VSP_044389Add
BLAST
Alternative sequencei547 – 62276Missing in isoform 4. VSP_022334Add
BLAST
Alternative sequencei585 – 908324Missing in isoform 3. VSP_022337Add
BLAST
Alternative sequencei855 – 90854RSFCS…KETMA → ESSIWLVPPYHPDTV in isoform 2 and isoform 6. VSP_022335Add
BLAST
Alternative sequencei856 – 90853SFCSA…KETMA → AKTKLPQDYVFLPILESVSI STVLSSSPSSSSLSSCS in isoform 5 and isoform 7. VSP_022336Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti20 – 201L → P in CAC81020. 1 Publication
Sequence conflicti20 – 201L → P in ADH93570. 1 Publication
Sequence conflicti20 – 201L → P in ADH93571. 1 Publication
Sequence conflicti20 – 201L → P in ADH93572. 1 Publication
Sequence conflicti20 – 201L → P in ADH93573. 1 Publication
Sequence conflicti789 – 7891G → S1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U16126 mRNA. Translation: AAC50420.1.
AJ252246 mRNA. Translation: CAC81020.1.
AJ301608 mRNA. Translation: CAC67485.1.
AJ301609 mRNA. Translation: CAC67486.1.
AJ301610 mRNA. Translation: CAC67487.1.
HM149335 mRNA. Translation: ADH93569.1.
HM149336 mRNA. Translation: ADH93570.1.
HM149337 mRNA. Translation: ADH93571.1.
HM149338 mRNA. Translation: ADH93572.1.
HM149339 mRNA. Translation: ADH93573.1.
AL109919 Genomic DNA. No translation available.
AP002528 Genomic DNA. No translation available.
AP002529 Genomic DNA. No translation available.
AP002530 Genomic DNA. No translation available.
CH471051 Genomic DNA. Translation: EAW48448.1.
CCDSiCCDS5048.1. [Q13002-1]
CCDS5049.1. [Q13002-2]
CCDS55045.1. [Q13002-5]
PIRiA54260.
RefSeqiNP_001159719.1. NM_001166247.1. [Q13002-5]
NP_068775.1. NM_021956.4. [Q13002-1]
NP_786944.1. NM_175768.3. [Q13002-2]
XP_005267002.1. XM_005266945.1. [Q13002-1]
XP_006715528.1. XM_006715465.1. [Q13002-5]
UniGeneiHs.98262.

Genome annotation databases

EnsembliENST00000318991; ENSP00000313276; ENSG00000164418. [Q13002-2]
ENST00000369137; ENSP00000358133; ENSG00000164418. [Q13002-4]
ENST00000369138; ENSP00000358134; ENSG00000164418. [Q13002-5]
ENST00000413795; ENSP00000405596; ENSG00000164418. [Q13002-2]
ENST00000421544; ENSP00000397026; ENSG00000164418. [Q13002-1]
GeneIDi2898.
KEGGihsa:2898.
UCSCiuc003pqn.3. human. [Q13002-1]
uc003pqo.4. human. [Q13002-2]
uc010kcw.3. human. [Q13002-5]
uc021zdk.1. human. [Q13002-6]

Polymorphism databases

DMDMi2492627.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism, RNA editing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U16126 mRNA. Translation: AAC50420.1 .
AJ252246 mRNA. Translation: CAC81020.1 .
AJ301608 mRNA. Translation: CAC67485.1 .
AJ301609 mRNA. Translation: CAC67486.1 .
AJ301610 mRNA. Translation: CAC67487.1 .
HM149335 mRNA. Translation: ADH93569.1 .
HM149336 mRNA. Translation: ADH93570.1 .
HM149337 mRNA. Translation: ADH93571.1 .
HM149338 mRNA. Translation: ADH93572.1 .
HM149339 mRNA. Translation: ADH93573.1 .
AL109919 Genomic DNA. No translation available.
AP002528 Genomic DNA. No translation available.
AP002529 Genomic DNA. No translation available.
AP002530 Genomic DNA. No translation available.
CH471051 Genomic DNA. Translation: EAW48448.1 .
CCDSi CCDS5048.1. [Q13002-1 ]
CCDS5049.1. [Q13002-2 ]
CCDS55045.1. [Q13002-5 ]
PIRi A54260.
RefSeqi NP_001159719.1. NM_001166247.1. [Q13002-5 ]
NP_068775.1. NM_021956.4. [Q13002-1 ]
NP_786944.1. NM_175768.3. [Q13002-2 ]
XP_005267002.1. XM_005266945.1. [Q13002-1 ]
XP_006715528.1. XM_006715465.1. [Q13002-5 ]
UniGenei Hs.98262.

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
3QXM X-ray 1.65 A/B 429-544 [» ]
A/B 667-806 [» ]
ProteinModelPortali Q13002.
SMRi Q13002. Positions 33-415, 430-805.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 109155. 12 interactions.
IntActi Q13002. 2 interactions.
STRINGi 9606.ENSP00000397026.

Chemistry

BindingDBi Q13002.
ChEMBLi CHEMBL3683.
DrugBanki DB00142. L-Glutamic Acid.
GuidetoPHARMACOLOGYi 451.

PTM databases

PhosphoSitei Q13002.

Polymorphism databases

DMDMi 2492627.

Proteomic databases

MaxQBi Q13002.
PaxDbi Q13002.
PRIDEi Q13002.

Protocols and materials databases

DNASUi 2898.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000318991 ; ENSP00000313276 ; ENSG00000164418 . [Q13002-2 ]
ENST00000369137 ; ENSP00000358133 ; ENSG00000164418 . [Q13002-4 ]
ENST00000369138 ; ENSP00000358134 ; ENSG00000164418 . [Q13002-5 ]
ENST00000413795 ; ENSP00000405596 ; ENSG00000164418 . [Q13002-2 ]
ENST00000421544 ; ENSP00000397026 ; ENSG00000164418 . [Q13002-1 ]
GeneIDi 2898.
KEGGi hsa:2898.
UCSCi uc003pqn.3. human. [Q13002-1 ]
uc003pqo.4. human. [Q13002-2 ]
uc010kcw.3. human. [Q13002-5 ]
uc021zdk.1. human. [Q13002-6 ]

Organism-specific databases

CTDi 2898.
GeneCardsi GC06P101846.
H-InvDB HIX0006094.
HGNCi HGNC:4580. GRIK2.
HPAi CAB022463.
HPA014395.
HPA014623.
MIMi 138244. gene.
611092. phenotype.
neXtProti NX_Q13002.
Orphaneti 88616. Autosomal recessive nonsyndromic intellectual disability.
PharmGKBi PA164741600.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG316680.
HOVERGENi HBG051839.
InParanoidi Q13002.
KOi K05202.
OMAi VNGQWNG.
OrthoDBi EOG71G9W6.
PhylomeDBi Q13002.
TreeFami TF334668.

Enzyme and pathway databases

Reactomei REACT_21343. Activation of Na-permeable Kainate Receptors.
REACT_21346. Activation of Ca-permeable Kainate Receptor.
SignaLinki Q13002.

Miscellaneous databases

GeneWikii GRIK2.
GenomeRNAii 2898.
NextBioi 11469.
PROi Q13002.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q13002.
Bgeei Q13002.
CleanExi HS_GRIK2.
Genevestigatori Q13002.

Family and domain databases

InterProi IPR001828. ANF_lig-bd_rcpt.
IPR019594. Glu_rcpt_Glu/Gly-bd.
IPR001320. Iontro_glu_rcpt.
IPR001508. NMDA_rcpt.
IPR028082. Peripla_BP_I.
[Graphical view ]
Pfami PF01094. ANF_receptor. 1 hit.
PF00060. Lig_chan. 1 hit.
PF10613. Lig_chan-Glu_bd. 1 hit.
[Graphical view ]
PRINTSi PR00177. NMDARECEPTOR.
SMARTi SM00918. Lig_chan-Glu_bd. 1 hit.
SM00079. PBPe. 1 hit.
[Graphical view ]
SUPFAMi SSF53822. SSF53822. 1 hit.
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Functional expression and pharmacological characterization of the human EAA4 (GluR6) glutamate receptor: a kainate selective channel subunit."
    Hoo K.H., Nutt S.L., Fletcher E.J., Elliott C.E., Korczak B., Deverill R.M., Rampersad V., Fantaske R.P., Kamboj R.K.
    Recept. Channels 2:327-337(1994) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Fetal brain.
  2. "Human GluR6 kainate receptor (GRIK2): molecular cloning, expression, polymorphism, and chromosomal assignment."
    Paschen W., Blackstone C.D., Huganir R.L., Ross C.A.
    Genomics 20:435-440(1994) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  3. "Myeloid progenitor cell growth and apoptosis involves know and cell-specific ionotropic glutamate receptor."
    Langer A., Xu D., Kuehcke K., Fehse B., Abdallah S., Lother H.
    Submitted (JAN-2000) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 5).
  4. "Genomic organization of the human GRIK2 gene and characterization of multiple splicing variants."
    Barbon A., Vallini I., Barlati S.
    Gene 274:187-197(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2; 3 AND 4), GENE ORGANIZATION.
  5. "Novel spliced variants of ionotropic glutamate receptor GluR6 in normal human fibroblast and brain cells are transcribed by tissue specific promoters."
    Zhawar V.K., Kaur G., deRiel J.K., Kaur G.P., Kandpal R.P., Athwal R.S.
    Gene 459:1-10(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 5; 6 AND 7), ALTERNATIVE SPLICING.
    Tissue: Brain.
  6. "The DNA sequence and analysis of human chromosome 6."
    Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D.
    , Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beare D.M., Beasley H., Beasley O., Bird C.P., Blakey S.E., Bray-Allen S., Brook J., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Clark S.Y., Clark G., Clee C.M., Clegg S., Cobley V., Collier R.E., Collins J.E., Colman L.K., Corby N.R., Coville G.J., Culley K.M., Dhami P., Davies J., Dunn M., Earthrowl M.E., Ellington A.E., Evans K.A., Faulkner L., Francis M.D., Frankish A., Frankland J., French L., Garner P., Garnett J., Ghori M.J., Gilby L.M., Gillson C.J., Glithero R.J., Grafham D.V., Grant M., Gribble S., Griffiths C., Griffiths M.N.D., Hall R., Halls K.S., Hammond S., Harley J.L., Hart E.A., Heath P.D., Heathcott R., Holmes S.J., Howden P.J., Howe K.L., Howell G.R., Huckle E., Humphray S.J., Humphries M.D., Hunt A.R., Johnson C.M., Joy A.A., Kay M., Keenan S.J., Kimberley A.M., King A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C.R., Lloyd D.M., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., Maslen G.L., Matthews L., McCann O.T., McLaren S.J., McLay K., McMurray A., Moore M.J.F., Mullikin J.C., Niblett D., Nickerson T., Novik K.L., Oliver K., Overton-Larty E.K., Parker A., Patel R., Pearce A.V., Peck A.I., Phillimore B.J.C.T., Phillips S., Plumb R.W., Porter K.M., Ramsey Y., Ranby S.A., Rice C.M., Ross M.T., Searle S.M., Sehra H.K., Sheridan E., Skuce C.D., Smith S., Smith M., Spraggon L., Squares S.L., Steward C.A., Sycamore N., Tamlyn-Hall G., Tester J., Theaker A.J., Thomas D.W., Thorpe A., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., White S.S., Whitehead S.L., Whittaker H., Wild A., Willey D.J., Wilmer T.E., Wood J.M., Wray P.W., Wyatt J.C., Young L., Younger R.M., Bentley D.R., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Dunham I., Rogers J., Beck S.
    Nature 425:805-811(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  7. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  8. "RNA editing of the glutamate receptor subunits GluR2 and GluR6 in human brain tissue."
    Paschen W., Hedreen J.C., Ross C.A.
    J. Neurochem. 63:1596-1602(1994) [PubMed] [Europe PMC] [Abstract]
    Cited for: RNA EDITING OF POSITION 621.
  9. "RNA editing of human kainate receptor subunits."
    Nutt S.L., Kamboj R.K.
    NeuroReport 5:2625-2629(1994) [PubMed] [Europe PMC] [Abstract]
    Cited for: RNA EDITING OF POSITIONS 567; 571 AND 621.
    Tissue: Brain.
  10. Cited for: INTERACTION WITH DLG4.
  11. "Modification and movement: Phosphorylation and SUMOylation regulate endocytosis of GluK2-containing kainate receptors."
    Wilkinson K.A., Konopacki F., Henley J.M.
    Commun. Integr. Biol. 5:223-226(2012) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION AT SER-846 AND SER-868, SUMOYLATION AT LYS-886.
  12. "Binding and selectivity of the marine toxin neodysiherbaine A and its synthetic analogues to GluK1 and GluK2 kainate receptors."
    Unno M., Shinohara M., Takayama K., Tanaka H., Teruya K., Doh-ura K., Sakai R., Sasaki M., Ikeda-Saito M.
    J. Mol. Biol. 413:667-683(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: X-RAY CRYSTALLOGRAPHY (1.65 ANGSTROMS) OF 429-806 IN COMPLEX WITH AGONIST.
  13. Cited for: VARIANT [LARGE SCALE ANALYSIS] GLN-187.
  14. "A defect in the ionotropic glutamate receptor 6 gene (GRIK2) is associated with autosomal recessive mental retardation."
    Motazacker M.M., Rost B.R., Hucho T., Garshasbi M., Kahrizi K., Ullmann R., Abedini S.S., Nieh S.E., Amini S.H., Goswami C., Tzschach A., Jensen L.R., Schmitz D., Ropers H.H., Najmabadi H., Kuss A.W.
    Am. J. Hum. Genet. 81:792-798(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: INVOLVEMENT IN MRT6.

Entry informationi

Entry nameiGRIK2_HUMAN
AccessioniPrimary (citable) accession number: Q13002
Secondary accession number(s): A6NMY9
, B5MCV0, D7RWZ3, D7RWZ4, D7RWZ5, D7RWZ6, D7RWZ7, Q8WWS1, Q96KS6, Q96KS7, Q96KS8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: November 1, 1996
Last modified: September 3, 2014
This is version 145 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Miscellaneous

The postsynaptic actions of Glu are mediated by a variety of receptors that are named according to their selective agonists. This receptor binds domoate > kainate > quisqualate > 6-cyano-7-nitroquinoxaline-2,3-dione > L-glutamate = 6,7-dinitroquinoxaline-2,3-dione > dihydrokainate.

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi