Q13002 (GRIK2_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 131.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Glutamate receptor ionotropic, kainate 2 Short name=GluK2 Alternative name(s): Excitatory amino acid receptor 4 Short name=EAA4 Glutamate receptor 6 Short name=GluR-6 Short name=GluR6 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 908 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Ionotropic glutamate receptor. L-glutamate acts as an excitatory neurotransmitter at many synapses in the central nervous system. Binding of the excitatory neurotransmitter L-glutamate induces a conformation change, leading to the opening of the cation channel, and thereby converts the chemical signal to an electrical impulse. The receptor then desensitizes rapidly and enters a transient inactive state, characterized by the presence of bound agonist. May be involved in the transmission of light information from the retina to the hypothalamus. Modulates cell surface expression of NETO2 By similarity. |
| Subunit structure | Homotetramer or heterotetramer of pore-forming glutamate receptor subunits. Tetramers may be formed by the dimerization of dimers Probable. Assembles into a kainate-gated homomeric channel that does not bind AMPA. GRIK2 associated to GRIK5 forms functional channels that can be gated by AMPA By similarity. Interacts with DLG4. Interacts with NETO2 By similarity. Interacts (via C-terminus) with KLHL17 (via kelch repeats); the interaction targets GRIK2 for degradation via ubiquitin-proteasome pathway By similarity. Ref.10 |
| Subcellular location | Cell membrane; Multi-pass membrane protein. Cell junction › synapse › postsynaptic cell membrane; Multi-pass membrane protein. |
| Tissue specificity | Expression is higher in cerebellum than in cerebral cortex. |
| Post-translational modification | Sumoylation mediates kainate receptor-mediated endocytosis and regulates synaptic transmission. Sumoylation is enhanced by PIAS3 and desumoylated by SENP1 By similarity. Ref.11 Ubiquitinated. Ubiquitination regulates the GRIK2 levels at the synapse by leading kainate receptor degradation through proteasome By similarity. Phosphorylated by PKC at Ser-868 upon agonist activation, this directly enhance sumoylation. Ref.11 |
| Involvement in disease | Mental retardation, autosomal recessive 6 (MRT6) [MIM:611092]: A disorder characterized by significantly below average general intellectual functioning associated with impairments in adaptative behavior and manifested during the developmental period. In contrast to syndromic or specific mental retardation which also present with associated physical, neurological and/or psychiatric manifestations, intellectual deficiency is the only primary symptom of non-syndromic mental retardation. MRT6 patients display mild to severe mental retardation and psychomotor development delay in early childhood. Patients do not have neurologic problems, congenital malformations, or facial dysmorphism. Body height, weight, and head circumference are normal. |
| Miscellaneous | The postsynaptic actions of Glu are mediated by a variety of receptors that are named according to their selective agonists. This receptor binds domoate > kainate > quisqualate > 6-cyano-7-nitroquinoxaline-2,3-dione > L-glutamate = 6,7-dinitroquinoxaline-2,3-dione > dihydrokainate. |
| Sequence similarities | Belongs to the glutamate-gated ion channel (TC 1.A.10.1) family. GRIK2 subfamily. [View classification] |
| RNA editing | Edited at positions 567, 571 and 621. |
Ontologies
Alternative products
| This entry describes 7 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q13002-1) Also known as: A; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q13002-2) Also known as: B; The sequence of this isoform differs from the canonical sequence as follows: 855-908: RSFCSAMVEELRMSLKCQRRLKHKPQAPVIVKTEEVINMHTFNDRRLPGKETMA → ESSIWLVPPYHPDTV | ||||||
| Isoform 3 (identifier: Q13002-3) The sequence of this isoform differs from the canonical sequence as follows: 585-908: Missing. | ||||||
| Isoform 4 (identifier: Q13002-4) The sequence of this isoform differs from the canonical sequence as follows: 547-622: Missing. | ||||||
| Isoform 5 (identifier: Q13002-5) Also known as: C; The sequence of this isoform differs from the canonical sequence as follows: 856-908: SFCSAMVEEL...RRLPGKETMA → AKTKLPQDYV...PSSSSLSSCS | ||||||
| Isoform 6 (identifier: Q13002-6) Also known as: D; The sequence of this isoform differs from the canonical sequence as follows: 509-695: Missing. 855-908: RSFCSAMVEELRMSLKCQRRLKHKPQAPVIVKTEEVINMHTFNDRRLPGKETMA → ESSIWLVPPYHPDTV | ||||||
| Note: Seems to be specific for non-neuronal cells. May not function as active channel. | ||||||
| Isoform 7 (identifier: Q13002-7) Also known as: E; The sequence of this isoform differs from the canonical sequence as follows: 510-714: Missing. 856-908: SFCSAMVEEL...RRLPGKETMA → AKTKLPQDYV...PSSSSLSSCS | ||||||
| Note: Seems to be specific for non-neuronal cells. May not function as active channel. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 31 | 31 | Potential | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Chain | 32 – 908 | 877 | Glutamate receptor ionotropic, kainate 2 | PRO_0000011544 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Topological domain | 32 – 561 | 530 | Extracellular Potential | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Transmembrane | 562 – 582 | 21 | Helical; Potential | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Topological domain | 583 – 635 | 53 | Cytoplasmic Potential | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Transmembrane | 636 – 656 | 21 | Helical; Potential | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Topological domain | 657 – 819 | 163 | Extracellular Potential | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Transmembrane | 820 – 840 | 21 | Helical; Potential | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Topological domain | 841 – 908 | 68 | Cytoplasmic Potential | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 516 – 518 | 3 | Glutamate binding By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 689 – 690 | 2 | Glutamate binding By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sites | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 523 | 1 | Glutamate By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 738 | 1 | Glutamate By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 846 | 1 | Phosphoserine; by PKC Ref.11 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 868 | 1 | Phosphoserine; by PKC Ref.11 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 67 | 1 | N-linked (GlcNAc...) Potential | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 73 | 1 | N-linked (GlcNAc...) Potential | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 275 | 1 | N-linked (GlcNAc...) Potential | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 378 | 1 | N-linked (GlcNAc...) Potential | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 412 | 1 | N-linked (GlcNAc...) Potential | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 423 | 1 | N-linked (GlcNAc...) Potential | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 430 | 1 | N-linked (GlcNAc...) Potential | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 546 | 1 | N-linked (GlcNAc...) Potential | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 96 ↔ 347 | By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Cross-link | 886 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO-1) Ref.11 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 509 – 695 | 187 | Missing in isoform 6. | VSP_044388 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 510 – 714 | 205 | Missing in isoform 7. | VSP_044389 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 547 – 622 | 76 | Missing in isoform 4. | VSP_022334 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 585 – 908 | 324 | Missing in isoform 3. | VSP_022337 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 855 – 908 | 54 | RSFCS…KETMA → ESSIWLVPPYHPDTV in isoform 2 and isoform 6. | VSP_022335 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 856 – 908 | 53 | SFCSA…KETMA → AKTKLPQDYVFLPILESVSI STVLSSSPSSSSLSSCS in isoform 5 and isoform 7. | VSP_022336 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 187 | 1 | E → Q in a breast cancer sample; somatic mutation. Ref.13 | VAR_035694 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 567 | 1 | I → V in RNA edited version. | VAR_000305 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 571 | 1 | Y → C in RNA edited version. | VAR_000306 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 621 | 1 | Q → R in RNA edited version. | VAR_000307 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 766 | 1 | V → I. Corresponds to variant rs3213608 [ dbSNP | Ensembl ]. | VAR_049186 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 867 | 1 | M → I. Corresponds to variant rs2235076 [ dbSNP | Ensembl ]. | VAR_037633 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 20 | 1 | L → P in CAC81020. Ref.3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 20 | 1 | L → P in ADH93570. Ref.5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 20 | 1 | L → P in ADH93571. Ref.5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 20 | 1 | L → P in ADH93572. Ref.5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 20 | 1 | L → P in ADH93573. Ref.5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 789 | 1 | G → S Ref.2 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 433 – 437 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 441 – 443 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 444 – 446 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 455 – 458 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 459 – 461 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 462 – 474 | 13 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 478 – 482 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 493 – 495 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 500 – 506 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 511 – 513 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 521 – 524 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 527 – 529 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 533 – 536 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 538 – 544 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 671 – 675 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 678 – 683 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 689 – 696 | 8 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 700 – 711 | 12 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 713 – 716 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 718 – 720 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 721 – 730 | 10 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 731 – 738 | 8 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 739 – 748 | 10 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 752 – 757 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 762 – 764 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 767 – 769 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 774 – 787 | 14 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 790 – 799 | 10 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Functional expression and pharmacological characterization of the human EAA4 (GluR6) glutamate receptor: a kainate selective channel subunit." Hoo K.H., Nutt S.L., Fletcher E.J., Elliott C.E., Korczak B., Deverill R.M., Rampersad V., Fantaske R.P., Kamboj R.K. Recept. Channels 2:327-337(1994) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Fetal brain. |
| [2] | "Human GluR6 kainate receptor (GRIK2): molecular cloning, expression, polymorphism, and chromosomal assignment." Paschen W., Blackstone C.D., Huganir R.L., Ross C.A. Genomics 20:435-440(1994) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [3] | "Myeloid progenitor cell growth and apoptosis involves know and cell-specific ionotropic glutamate receptor." Langer A., Xu D., Kuehcke K., Fehse B., Abdallah S., Lother H. Submitted (JAN-2000) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 5). |
| [4] | "Genomic organization of the human GRIK2 gene and characterization of multiple splicing variants." Barbon A., Vallini I., Barlati S. Gene 274:187-197(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2; 3 AND 4), GENE ORGANIZATION. |
| [5] | "Novel spliced variants of ionotropic glutamate receptor GluR6 in normal human fibroblast and brain cells are transcribed by tissue specific promoters." Zhawar V.K., Kaur G., deRiel J.K., Kaur G.P., Kandpal R.P., Athwal R.S. Gene 459:1-10(2010) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 5; 6 AND 7), ALTERNATIVE SPLICING. Tissue: Brain. |
| [6] | "The DNA sequence and analysis of human chromosome 6." Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D. Beck S.Nature 425:805-811(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [7] | Mural R.J., Istrail S., Sutton G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [8] | "RNA editing of the glutamate receptor subunits GluR2 and GluR6 in human brain tissue." Paschen W., Hedreen J.C., Ross C.A. J. Neurochem. 63:1596-1602(1994) [PubMed] [Europe PMC] [Abstract] Cited for: RNA EDITING OF POSITION 621. |
| [9] | "RNA editing of human kainate receptor subunits." Nutt S.L., Kamboj R.K. NeuroReport 5:2625-2629(1994) [PubMed] [Europe PMC] [Abstract] Cited for: RNA EDITING OF POSITIONS 567; 571 AND 621. Tissue: Brain. |
| [10] | "The PDZ1 domain of SAP90. Characterization of structure and binding." Piserchio A., Pellegrini M., Mehta S., Blackman S.M., Garcia E.P., Marshall J., Mierke D.F. J. Biol. Chem. 277:6967-6973(2002) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH DLG4. |
| [11] | "Modification and movement: Phosphorylation and SUMOylation regulate endocytosis of GluK2-containing kainate receptors." Wilkinson K.A., Konopacki F., Henley J.M. Commun. Integr. Biol. 5:223-226(2012) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION AT SER-846 AND SER-868, SUMOYLATION AT LYS-886. |
| [12] | "Binding and selectivity of the marine toxin neodysiherbaine A and its synthetic analogues to GluK1 and GluK2 kainate receptors." Unno M., Shinohara M., Takayama K., Tanaka H., Teruya K., Doh-ura K., Sakai R., Sasaki M., Ikeda-Saito M. J. Mol. Biol. 413:667-683(2011) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (1.65 ANGSTROMS) OF 429-806 IN COMPLEX WITH AGONIST. |
| [13] | "The consensus coding sequences of human breast and colorectal cancers." Sjoeblom T., Jones S., Wood L.D., Parsons D.W., Lin J., Barber T.D., Mandelker D., Leary R.J., Ptak J., Silliman N., Szabo S., Buckhaults P., Farrell C., Meeh P., Markowitz S.D., Willis J., Dawson D., Willson J.K.V. Velculescu V.E.Science 314:268-274(2006) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT [LARGE SCALE ANALYSIS] GLN-187. |
| [14] | "A defect in the ionotropic glutamate receptor 6 gene (GRIK2) is associated with autosomal recessive mental retardation." Motazacker M.M., Rost B.R., Hucho T., Garshasbi M., Kahrizi K., Ullmann R., Abedini S.S., Nieh S.E., Amini S.H., Goswami C., Tzschach A., Jensen L.R., Schmitz D., Ropers H.H., Najmabadi H., Kuss A.W. Am. J. Hum. Genet. 81:792-798(2007) [PubMed] [Europe PMC] [Abstract] Cited for: INVOLVEMENT IN MRT6. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | U16126 mRNA. Translation: AAC50420.1. AJ252246 mRNA. Translation: CAC81020.1. AJ301608 mRNA. Translation: CAC67485.1. AJ301609 mRNA. Translation: CAC67486.1. AJ301610 mRNA. Translation: CAC67487.1. HM149335 mRNA. Translation: ADH93569.1. HM149336 mRNA. Translation: ADH93570.1. HM149337 mRNA. Translation: ADH93571.1. HM149338 mRNA. Translation: ADH93572.1. HM149339 mRNA. Translation: ADH93573.1. AL109919 Genomic DNA. No translation available. AP002528 Genomic DNA. No translation available. AP002529 Genomic DNA. No translation available. AP002530 Genomic DNA. No translation available. CH471051 Genomic DNA. Translation: EAW48448.1. | ||||||||||||
| IPI | IPI00011396. IPI00396613. IPI00642591. IPI00746275. IPI00815931. | ||||||||||||
| PIR | A54260. | ||||||||||||
| RefSeq | NP_001159719.1. NM_001166247.1. NP_068775.1. NM_021956.4. NP_786944.1. NM_175768.3. | ||||||||||||
| UniGene | Hs.98262. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | Q13002. | ||||||||||||
| SMR | Q13002. Positions 33-415, 429-804. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| IntAct | Q13002. 2 interactions. | ||||||||||||
| STRING | 9606.ENSP00000397026. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | Q13002. | ||||||||||||
Polymorphism databases | |||||||||||||
| DMDM | 2492627. | ||||||||||||
Proteomic databases | |||||||||||||
| PaxDb | Q13002. | ||||||||||||
| PRIDE | Q13002. | ||||||||||||
Protocols and materials databases | |||||||||||||
| DNASU | 2898. | ||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENST00000318991; ENSP00000313276; ENSG00000164418. ENST00000369137; ENSP00000358133; ENSG00000164418. ENST00000369138; ENSP00000358134; ENSG00000164418. ENST00000413795; ENSP00000405596; ENSG00000164418. ENST00000421544; ENSP00000397026; ENSG00000164418. | ||||||||||||
| GeneID | 2898. | ||||||||||||
| KEGG | hsa:2898. | ||||||||||||
| UCSC | uc003pqn.3. human. uc003pqo.4. human. uc010kcw.3. human. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 2898. | ||||||||||||
| GeneCards | GC06P101846. | ||||||||||||
| H-InvDB | HIX0006094. | ||||||||||||
| HGNC | HGNC:4580. GRIK2. | ||||||||||||
| HPA | CAB022463. HPA014395. HPA014623. | ||||||||||||
| MIM | 138244. gene. 611092. phenotype. | ||||||||||||
| neXtProt | NX_Q13002. | ||||||||||||
| Orphanet | 88616. Autosomal recessive nonsyndromic intellectual deficit. | ||||||||||||
| PharmGKB | PA164741600. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| eggNOG | NOG316680. | ||||||||||||
| HOVERGEN | HBG051839. | ||||||||||||
| InParanoid | Q13002. | ||||||||||||
| KO | K05202. | ||||||||||||
| OMA | VNGQWNG. | ||||||||||||
| OrthoDB | EOG41C6VH. | ||||||||||||
| PhylomeDB | Q13002. | ||||||||||||
Enzyme and pathway databases | |||||||||||||
| Reactome | REACT_13685. Neuronal System. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | Q13002. | ||||||||||||
| Bgee | Q13002. | ||||||||||||
| CleanEx | HS_GRIK2. | ||||||||||||
| Genevestigator | Q13002. | ||||||||||||
| GermOnline | ENSG00000164418. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| InterPro | IPR001828. ANF_lig-bd_rcpt. IPR019594. Glu_rcpt_Glu/Gly-bd. IPR001320. Iontro_glu_rcpt. IPR001508. NMDA_rcpt. [Graphical view] | ||||||||||||
| Pfam | PF01094. ANF_receptor. 1 hit. PF00060. Lig_chan. 1 hit. PF10613. Lig_chan-Glu_bd. 1 hit. [Graphical view] | ||||||||||||
| PRINTS | PR00177. NMDARECEPTOR. | ||||||||||||
| SMART | SM00918. Lig_chan-Glu_bd. 1 hit. SM00079. PBPe. 1 hit. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| BindingDB | Q13002. | ||||||||||||
| ChEMBL | CHEMBL3683. | ||||||||||||
| DrugBank | DB00142. L-Glutamic Acid. | ||||||||||||
| GenomeRNAi | 2898. | ||||||||||||
| NextBio | 11469. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | GRIK2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q13002 Secondary accession number(s): A6NMY9 Q96KS8 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 6 Human chromosome 6: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
