Q12982 (BNIP2_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 100.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: BCL2/adenovirus E1B 19 kDa protein-interacting protein 2 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 314 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Implicated in the suppression of cell death. Interacts with the BCL-2 and adenovirus E1B 19 kDa proteins. |
| Subcellular location | Cytoplasm. Cytoplasm › perinuclear region. Note: Localizes to the nuclear envelope region and to other cytoplasmic structures. |
| Sequence similarities | Contains 1 CRAL-TRIO domain. |
Ontologies
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q12982-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q12982-2) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MEPCPSSAPPPFYPGVGEVAGLRWFSIYDQRPSWYRTKKLGLLDIGSLDYQEFVVDIESRLRM |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 314 | 314 | BCL2/adenovirus E1B 19 kDa protein-interacting protein 2 | PRO_0000064961 | |||||
Regions | |||||||||
| Domain | 147 – 304 | 158 | CRAL-TRIO | ||||||
Amino acid modifications | |||||||||
| Modified residue | 114 | 1 | Phosphoserine Ref.6 Ref.7 Ref.8 Ref.9 Ref.10 Ref.11 | ||||||
| Modified residue | 116 | 1 | Phosphothreonine Ref.7 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 | 1 | M → MEPCPSSAPPPFYPGVGEVA GLRWFSIYDQRPSWYRTKKL GLLDIGSLDYQEFVVDIESR LRM in isoform 2. | VSP_038964 | |||||
| Natural variant | 24 | 1 | S → T. Ref.3 Corresponds to variant rs6151509 [ dbSNP | Ensembl ]. | VAR_018837 | |||||
Experimental info | |||||||||
| Sequence conflict | 175 | 1 | M → T in BAG61556. Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Adenovirus E1B 19 kDa and Bcl-2 proteins interact with a common set of cellular proteins." Boyd J.M., Malstrom S., Subramanian T., Venkatesh L.K., Schaeper U., Elangovan B., D'Sa-Eipper C., Chinnadurai G. Cell 79:341-351(1994) [PubMed: 7954800] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [2] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Brain. |
| [3] | NIEHS SNPs program Submitted (APR-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANT THR-24. |
| [4] | "Analysis of the DNA sequence and duplication history of human chromosome 15." Zody M.C., Garber M., Sharpe T., Young S.K., Rowen L., O'Neill K., Whittaker C.A., Kamal M., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Kodira C.D., Madan A., Qin S., Yang X., Abbasi N., Abouelleil A. Nusbaum C.Nature 440:671-675(2006) [PubMed: 16572171] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Eye. |
| [6] | "Evaluation of the low-specificity protease elastase for large-scale phosphoproteome analysis." Wang B., Malik R., Nigg E.A., Korner R. Anal. Chem. 80:9526-9533(2008) [PubMed: 19007248] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-114, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [7] | "Phosphoproteome of resting human platelets." Zahedi R.P., Lewandrowski U., Wiesner J., Wortelkamp S., Moebius J., Schuetz C., Walter U., Gambaryan S., Sickmann A. J. Proteome Res. 7:526-534(2008) [PubMed: 18088087] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-114 AND THR-116, MASS SPECTROMETRY. Tissue: Platelet. |
| [8] | "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle." Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M. Mol. Cell 31:438-448(2008) [PubMed: 18691976] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-114, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [9] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed: 18669648] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-114, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [10] | "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach." Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S. Anal. Chem. 81:4493-4501(2009) [PubMed: 19413330] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-114, MASS SPECTROMETRY. Tissue: Embryonic kidney. |
| [11] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed: 19690332] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-114, MASS SPECTROMETRY. Tissue: Leukemic T-cell. |
| + | Additional computationally mapped references. |
Web resources
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | U15173 mRNA. Translation: AAC00021.1. AK299628 mRNA. Translation: BAG61556.1. AY268590 Genomic DNA. Translation: AAP03429.1. AC092755 Genomic DNA. No translation available. BC002461 mRNA. Translation: AAH02461.1. |
| IPI | IPI00030399. IPI00943060. |
| PIR | I38864. |
| RefSeq | NP_004321.2. NM_004330.2. |
| UniGene | Hs.646490. |
3D structure databases | |
| ProteinModelPortal | Q12982. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q12982. 5 interactions. |
| MINT | MINT-1446815. |
| STRING | Q12982. |
PTM databases | |
| PhosphoSite | Q12982. |
Polymorphism databases | |
| DMDM | 6093506. |
Proteomic databases | |
| PRIDE | Q12982. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000267859; ENSP00000267859; ENSG00000140299. ENST00000409352; ENSP00000386585; ENSG00000140299. ENST00000415213; ENSP00000412767; ENSG00000140299. |
| GeneID | 663. |
| KEGG | hsa:663. |
| UCSC | uc010bgg.1. human. |
Organism-specific databases | |
| CTD | 663. |
| GeneCards | GC15M059951. |
| H-InvDB | HIX0012296. |
| HGNC | HGNC:1083. BNIP2. |
| HPA | HPA026843. |
| MIM | 603292. gene. |
| neXtProt | NX_Q12982. |
| PharmGKB | PA25393. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | prNOG16288. |
| GeneTree | ENSGT00420000029688. |
| HOGENOM | HBG445458. |
| HOVERGEN | HBG054692. |
| InParanoid | Q12982. |
| OMA | ECIKQYE. |
| OrthoDB | EOG4TF0K8. |
| PhylomeDB | Q12982. |
Enzyme and pathway databases | |
| Reactome | REACT_111045. Developmental Biology. |
Gene expression databases | |
| ArrayExpress | Q12982. |
| Bgee | Q12982. |
| CleanEx | HS_BNIP2. |
| Genevestigator | Q12982. |
| GermOnline | ENSG00000140299. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR022181. Bcl2-/adenovirus-E1B. IPR001251. CRAL-TRIO_dom. [Graphical view] |
| Gene3D | G3DSA:3.40.525.10. CRAL_bd_TRIO_C. 1 hit. |
| Pfam | PF12496. BNIP2. 1 hit. PF00650. CRAL_TRIO. 1 hit. [Graphical view] |
| SMART | SM00516. SEC14. 1 hit. [Graphical view] |
| SUPFAM | SSF52087. CRAL_TRIO_C. 1 hit. |
| PROSITE | PS50191. CRAL_TRIO. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 2704. |
| SOURCE | Search... |
Entry information
| Entry name | BNIP2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q12982 Secondary accession number(s): B4DS94 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 15 Human chromosome 15: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with