Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q12982

- BNIP2_HUMAN

UniProt

Q12982 - BNIP2_HUMAN

Protein

BCL2/adenovirus E1B 19 kDa protein-interacting protein 2

Gene

BNIP2

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 124 (01 Oct 2014)
      Sequence version 1 (01 Nov 1996)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Implicated in the suppression of cell death. Interacts with the BCL-2 and adenovirus E1B 19 kDa proteins.

    GO - Molecular functioni

    1. calcium ion binding Source: UniProtKB
    2. GTPase activator activity Source: ProtInc
    3. identical protein binding Source: RefGenome
    4. protein binding Source: UniProtKB

    GO - Biological processi

    1. apoptotic process Source: MGI
    2. muscle cell differentiation Source: Reactome
    3. negative regulation of apoptotic process Source: UniProtKB
    4. positive regulation of GTPase activity Source: GOC
    5. positive regulation of muscle cell differentiation Source: Reactome

    Keywords - Biological processi

    Apoptosis

    Enzyme and pathway databases

    ReactomeiREACT_21402. CDO in myogenesis.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    BCL2/adenovirus E1B 19 kDa protein-interacting protein 2
    Gene namesi
    Name:BNIP2
    Synonyms:NIP2
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 15

    Organism-specific databases

    HGNCiHGNC:1083. BNIP2.

    Subcellular locationi

    Cytoplasm. Cytoplasmperinuclear region
    Note: Localizes to the nuclear envelope region and to other cytoplasmic structures.

    GO - Cellular componenti

    1. cytoplasm Source: MGI
    2. cytosol Source: RefGenome
    3. intracellular membrane-bounded organelle Source: UniProtKB
    4. nuclear envelope Source: UniProtKB
    5. perinuclear region of cytoplasm Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Cytoplasm

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA25393.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 314314BCL2/adenovirus E1B 19 kDa protein-interacting protein 2PRO_0000064961Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei114 – 1141Phosphoserine3 Publications

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    MaxQBiQ12982.
    PaxDbiQ12982.
    PRIDEiQ12982.

    PTM databases

    PhosphoSiteiQ12982.

    Expressioni

    Gene expression databases

    ArrayExpressiQ12982.
    BgeeiQ12982.
    CleanExiHS_BNIP2.
    GenevestigatoriQ12982.

    Organism-specific databases

    HPAiHPA026843.

    Interactioni

    Protein-protein interaction databases

    BioGridi107131. 11 interactions.
    IntActiQ12982. 7 interactions.
    MINTiMINT-1446815.
    STRINGi9606.ENSP00000267859.

    Structurei

    3D structure databases

    ProteinModelPortaliQ12982.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini147 – 304158CRAL-TRIOPROSITE-ProRule annotationAdd
    BLAST

    Sequence similaritiesi

    Contains 1 CRAL-TRIO domain.PROSITE-ProRule annotation

    Phylogenomic databases

    eggNOGiNOG146204.
    HOGENOMiHOG000230952.
    HOVERGENiHBG054692.
    InParanoidiQ12982.
    OMAiLNGKQEQ.
    PhylomeDBiQ12982.

    Family and domain databases

    Gene3Di3.40.525.10. 1 hit.
    InterProiIPR022181. Bcl2-/adenovirus-E1B.
    IPR001251. CRAL-TRIO_dom.
    [Graphical view]
    PfamiPF12496. BNIP2. 1 hit.
    PF13716. CRAL_TRIO_2. 1 hit.
    [Graphical view]
    SMARTiSM00516. SEC14. 1 hit.
    [Graphical view]
    SUPFAMiSSF52087. SSF52087. 1 hit.
    PROSITEiPS50191. CRAL_TRIO. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q12982-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MEGVELKEEW QDEDFPIPLP EDDSIEADIL AITGPEDQPG SLEVNGNKVR    50
    KKLMAPDISL TLDPSDGSVL SDDLDESGEI DLDGLDTPSE NSNEFEWEDD 100
    LPKPKTTEVI RKGSITEYTA AEEKEDGRRW RMFRIGEQDH RVDMKAIEPY 150
    KKVISHGGYY GDGLNAIVVF AVCFMPESSQ PNYRYLMDNL FKYVIGTLEL 200
    LVAENYMIVY LNGATTRRKM PSLGWLRKCY QQIDRRLRKN LKSLIIVHPS 250
    WFIRTLLAVT RPFISSKFSQ KIRYVFNLAE LAELVPMEYV GIPECIKQVD 300
    QELNGKQDEP KNEQ 314
    Length:314
    Mass (Da):36,018
    Last modified:November 1, 1996 - v1
    Checksum:i0A3CEC636569DD2F
    GO
    Isoform 2 (identifier: Q12982-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MEPCPSSAPPPFYPGVGEVAGLRWFSIYDQRPSWYRTKKLGLLDIGSLDYQEFVVDIESRLRM

    Show »
    Length:376
    Mass (Da):43,135
    Checksum:i993DE21B8DF0D556
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti175 – 1751M → T in BAG61556. (PubMed:14702039)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti24 – 241S → T.1 Publication
    Corresponds to variant rs6151509 [ dbSNP | Ensembl ].
    VAR_018837

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 11M → MEPCPSSAPPPFYPGVGEVA GLRWFSIYDQRPSWYRTKKL GLLDIGSLDYQEFVVDIESR LRM in isoform 2. 1 PublicationVSP_038964

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U15173 mRNA. Translation: AAC00021.1.
    AK299628 mRNA. Translation: BAG61556.1.
    AY268590 Genomic DNA. Translation: AAP03429.1.
    AC092755 Genomic DNA. No translation available.
    BC002461 mRNA. Translation: AAH02461.1.
    PIRiI38864.
    RefSeqiNP_004321.2. NM_004330.2.
    UniGeneiHs.592515.
    Hs.646490.

    Genome annotation databases

    EnsembliENST00000415213; ENSP00000412767; ENSG00000140299. [Q12982-2]
    ENST00000607373; ENSP00000475320; ENSG00000140299. [Q12982-1]
    GeneIDi663.
    KEGGihsa:663.
    UCSCiuc010uhb.2. human. [Q12982-2]

    Polymorphism databases

    DMDMi6093506.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Web resourcesi

    NIEHS-SNPs

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U15173 mRNA. Translation: AAC00021.1 .
    AK299628 mRNA. Translation: BAG61556.1 .
    AY268590 Genomic DNA. Translation: AAP03429.1 .
    AC092755 Genomic DNA. No translation available.
    BC002461 mRNA. Translation: AAH02461.1 .
    PIRi I38864.
    RefSeqi NP_004321.2. NM_004330.2.
    UniGenei Hs.592515.
    Hs.646490.

    3D structure databases

    ProteinModelPortali Q12982.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 107131. 11 interactions.
    IntActi Q12982. 7 interactions.
    MINTi MINT-1446815.
    STRINGi 9606.ENSP00000267859.

    PTM databases

    PhosphoSitei Q12982.

    Polymorphism databases

    DMDMi 6093506.

    Proteomic databases

    MaxQBi Q12982.
    PaxDbi Q12982.
    PRIDEi Q12982.

    Protocols and materials databases

    DNASUi 663.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000415213 ; ENSP00000412767 ; ENSG00000140299 . [Q12982-2 ]
    ENST00000607373 ; ENSP00000475320 ; ENSG00000140299 . [Q12982-1 ]
    GeneIDi 663.
    KEGGi hsa:663.
    UCSCi uc010uhb.2. human. [Q12982-2 ]

    Organism-specific databases

    CTDi 663.
    GeneCardsi GC15M059951.
    H-InvDB HIX0012296.
    HGNCi HGNC:1083. BNIP2.
    HPAi HPA026843.
    MIMi 603292. gene.
    neXtProti NX_Q12982.
    PharmGKBi PA25393.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG146204.
    HOGENOMi HOG000230952.
    HOVERGENi HBG054692.
    InParanoidi Q12982.
    OMAi LNGKQEQ.
    PhylomeDBi Q12982.

    Enzyme and pathway databases

    Reactomei REACT_21402. CDO in myogenesis.

    Miscellaneous databases

    GeneWikii BNIP2.
    GenomeRNAii 663.
    NextBioi 2704.
    PROi Q12982.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q12982.
    Bgeei Q12982.
    CleanExi HS_BNIP2.
    Genevestigatori Q12982.

    Family and domain databases

    Gene3Di 3.40.525.10. 1 hit.
    InterProi IPR022181. Bcl2-/adenovirus-E1B.
    IPR001251. CRAL-TRIO_dom.
    [Graphical view ]
    Pfami PF12496. BNIP2. 1 hit.
    PF13716. CRAL_TRIO_2. 1 hit.
    [Graphical view ]
    SMARTi SM00516. SEC14. 1 hit.
    [Graphical view ]
    SUPFAMi SSF52087. SSF52087. 1 hit.
    PROSITEi PS50191. CRAL_TRIO. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Adenovirus E1B 19 kDa and Bcl-2 proteins interact with a common set of cellular proteins."
      Boyd J.M., Malstrom S., Subramanian T., Venkatesh L.K., Schaeper U., Elangovan B., D'Sa-Eipper C., Chinnadurai G.
      Cell 79:341-351(1994) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: Brain.
    3. NIEHS SNPs program
      Submitted (APR-2003) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANT THR-24.
    4. "Analysis of the DNA sequence and duplication history of human chromosome 15."
      Zody M.C., Garber M., Sharpe T., Young S.K., Rowen L., O'Neill K., Whittaker C.A., Kamal M., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Kodira C.D., Madan A., Qin S., Yang X., Abbasi N., Abouelleil A.
      , Arachchi H.M., Baradarani L., Birditt B., Bloom S., Bloom T., Borowsky M.L., Burke J., Butler J., Cook A., DeArellano K., DeCaprio D., Dorris L. III, Dors M., Eichler E.E., Engels R., Fahey J., Fleetwood P., Friedman C., Gearin G., Hall J.L., Hensley G., Johnson E., Jones C., Kamat A., Kaur A., Locke D.P., Madan A., Munson G., Jaffe D.B., Lui A., Macdonald P., Mauceli E., Naylor J.W., Nesbitt R., Nicol R., O'Leary S.B., Ratcliffe A., Rounsley S., She X., Sneddon K.M.B., Stewart S., Sougnez C., Stone S.M., Topham K., Vincent D., Wang S., Zimmer A.R., Birren B.W., Hood L., Lander E.S., Nusbaum C.
      Nature 440:671-675(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Eye.
    6. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Platelet.
    7. "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle."
      Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M.
      Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    8. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-114, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    9. "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
      Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
      Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    10. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
      Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
      Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-114, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Leukemic T-cell.
    11. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
      Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
      Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    12. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
      Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
      Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-114, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

    Entry informationi

    Entry nameiBNIP2_HUMAN
    AccessioniPrimary (citable) accession number: Q12982
    Secondary accession number(s): B4DS94
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: July 15, 1999
    Last sequence update: November 1, 1996
    Last modified: October 1, 2014
    This is version 124 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 15
      Human chromosome 15: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3