Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

BCL2/adenovirus E1B 19 kDa protein-interacting protein 2

Gene

BNIP2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Implicated in the suppression of cell death. Interacts with the BCL-2 and adenovirus E1B 19 kDa proteins.

GO - Molecular functioni

  • calcium ion binding Source: UniProtKB
  • GTPase activator activity Source: ProtInc
  • identical protein binding Source: GO_Central

GO - Biological processi

  • apoptotic process Source: MGI
  • negative regulation of apoptotic process Source: UniProtKB
  • positive regulation of muscle cell differentiation Source: Reactome
Complete GO annotation...

Keywords - Biological processi

Apoptosis

Enzyme and pathway databases

BioCyciZFISH:ENSG00000140299-MONOMER.
ReactomeiR-HSA-375170. CDO in myogenesis.
SIGNORiQ12982.

Chemistry databases

SwissLipidsiSLP:000001512.

Names & Taxonomyi

Protein namesi
Recommended name:
BCL2/adenovirus E1B 19 kDa protein-interacting protein 2
Gene namesi
Name:BNIP2
Synonyms:NIP2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 15

Organism-specific databases

HGNCiHGNC:1083. BNIP2.

Subcellular locationi

GO - Cellular componenti

  • cytoplasm Source: MGI
  • cytosol Source: GO_Central
  • intracellular membrane-bounded organelle Source: UniProtKB
  • nuclear envelope Source: UniProtKB
  • perinuclear region of cytoplasm Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Organism-specific databases

DisGeNETi663.
OpenTargetsiENSG00000140299.
PharmGKBiPA25393.

Polymorphism and mutation databases

BioMutaiBNIP2.
DMDMi6093506.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000649611 – 314BCL2/adenovirus E1B 19 kDa protein-interacting protein 2Add BLAST314

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei41PhosphoserineCombined sources1
Modified residuei77PhosphoserineCombined sources1
Modified residuei87PhosphothreonineCombined sources1
Modified residuei89PhosphoserineCombined sources1
Modified residuei92PhosphoserineCombined sources1
Modified residuei114PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ12982.
MaxQBiQ12982.
PaxDbiQ12982.
PeptideAtlasiQ12982.
PRIDEiQ12982.

PTM databases

iPTMnetiQ12982.
PhosphoSitePlusiQ12982.

Expressioni

Gene expression databases

BgeeiENSG00000140299.
CleanExiHS_BNIP2.
ExpressionAtlasiQ12982. baseline and differential.
GenevisibleiQ12982. HS.

Organism-specific databases

HPAiHPA026843.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
B2R9H73EBI-752094,EBI-10175711
FATE1Q969F05EBI-752094,EBI-743099
FRKP426854EBI-752094,EBI-1383583
KLC1Q078663EBI-752094,EBI-721019
MYO5BA0A0A0MR364EBI-752094,EBI-12001098
MYO5BQ9ULV05EBI-752094,EBI-311356

GO - Molecular functioni

Protein-protein interaction databases

BioGridi107131. 17 interactors.
IntActiQ12982. 17 interactors.
MINTiMINT-1446815.
STRINGi9606.ENSP00000267859.

Structurei

3D structure databases

ProteinModelPortaliQ12982.
SMRiQ12982.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini147 – 304CRAL-TRIOPROSITE-ProRule annotationAdd BLAST158

Sequence similaritiesi

Contains 1 CRAL-TRIO domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiENOG410IFPU. Eukaryota.
ENOG410YCZE. LUCA.
GeneTreeiENSGT00420000029688.
HOGENOMiHOG000230952.
HOVERGENiHBG054692.
InParanoidiQ12982.
KOiK18448.
OMAiLNGKQEQ.
PhylomeDBiQ12982.

Family and domain databases

Gene3Di3.40.525.10. 1 hit.
InterProiIPR022181. Bcl2-/adenovirus-E1B.
IPR001251. CRAL-TRIO_dom.
[Graphical view]
PfamiPF12496. BNIP2. 1 hit.
PF13716. CRAL_TRIO_2. 1 hit.
[Graphical view]
SMARTiSM00516. SEC14. 1 hit.
[Graphical view]
SUPFAMiSSF52087. SSF52087. 1 hit.
PROSITEiPS50191. CRAL_TRIO. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q12982-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEGVELKEEW QDEDFPIPLP EDDSIEADIL AITGPEDQPG SLEVNGNKVR
60 70 80 90 100
KKLMAPDISL TLDPSDGSVL SDDLDESGEI DLDGLDTPSE NSNEFEWEDD
110 120 130 140 150
LPKPKTTEVI RKGSITEYTA AEEKEDGRRW RMFRIGEQDH RVDMKAIEPY
160 170 180 190 200
KKVISHGGYY GDGLNAIVVF AVCFMPESSQ PNYRYLMDNL FKYVIGTLEL
210 220 230 240 250
LVAENYMIVY LNGATTRRKM PSLGWLRKCY QQIDRRLRKN LKSLIIVHPS
260 270 280 290 300
WFIRTLLAVT RPFISSKFSQ KIRYVFNLAE LAELVPMEYV GIPECIKQVD
310
QELNGKQDEP KNEQ
Length:314
Mass (Da):36,018
Last modified:November 1, 1996 - v1
Checksum:i0A3CEC636569DD2F
GO
Isoform 2 (identifier: Q12982-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MEPCPSSAPPPFYPGVGEVAGLRWFSIYDQRPSWYRTKKLGLLDIGSLDYQEFVVDIESRLRM

Show »
Length:376
Mass (Da):43,135
Checksum:i993DE21B8DF0D556
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti175M → T in BAG61556 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_01883724S → T.1 PublicationCorresponds to variant rs6151509dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0389641M → MEPCPSSAPPPFYPGVGEVA GLRWFSIYDQRPSWYRTKKL GLLDIGSLDYQEFVVDIESR LRM in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U15173 mRNA. Translation: AAC00021.1.
AK299628 mRNA. Translation: BAG61556.1.
AY268590 Genomic DNA. Translation: AAP03429.1.
AC092755 Genomic DNA. No translation available.
BC002461 mRNA. Translation: AAH02461.1.
CCDSiCCDS81889.1. [Q12982-2]
PIRiI38864.
RefSeqiNP_001307604.1. NM_001320675.1. [Q12982-2]
NP_004321.2. NM_004330.3.
UniGeneiHs.592515.
Hs.646490.

Genome annotation databases

EnsembliENST00000415213; ENSP00000412767; ENSG00000140299. [Q12982-2]
ENST00000607373; ENSP00000475320; ENSG00000140299. [Q12982-1]
GeneIDi663.
KEGGihsa:663.
UCSCiuc010uhb.3. human. [Q12982-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

NIEHS-SNPs

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U15173 mRNA. Translation: AAC00021.1.
AK299628 mRNA. Translation: BAG61556.1.
AY268590 Genomic DNA. Translation: AAP03429.1.
AC092755 Genomic DNA. No translation available.
BC002461 mRNA. Translation: AAH02461.1.
CCDSiCCDS81889.1. [Q12982-2]
PIRiI38864.
RefSeqiNP_001307604.1. NM_001320675.1. [Q12982-2]
NP_004321.2. NM_004330.3.
UniGeneiHs.592515.
Hs.646490.

3D structure databases

ProteinModelPortaliQ12982.
SMRiQ12982.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi107131. 17 interactors.
IntActiQ12982. 17 interactors.
MINTiMINT-1446815.
STRINGi9606.ENSP00000267859.

Chemistry databases

SwissLipidsiSLP:000001512.

PTM databases

iPTMnetiQ12982.
PhosphoSitePlusiQ12982.

Polymorphism and mutation databases

BioMutaiBNIP2.
DMDMi6093506.

Proteomic databases

EPDiQ12982.
MaxQBiQ12982.
PaxDbiQ12982.
PeptideAtlasiQ12982.
PRIDEiQ12982.

Protocols and materials databases

DNASUi663.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000415213; ENSP00000412767; ENSG00000140299. [Q12982-2]
ENST00000607373; ENSP00000475320; ENSG00000140299. [Q12982-1]
GeneIDi663.
KEGGihsa:663.
UCSCiuc010uhb.3. human. [Q12982-1]

Organism-specific databases

CTDi663.
DisGeNETi663.
GeneCardsiBNIP2.
H-InvDBHIX0012296.
HGNCiHGNC:1083. BNIP2.
HPAiHPA026843.
MIMi603292. gene.
neXtProtiNX_Q12982.
OpenTargetsiENSG00000140299.
PharmGKBiPA25393.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IFPU. Eukaryota.
ENOG410YCZE. LUCA.
GeneTreeiENSGT00420000029688.
HOGENOMiHOG000230952.
HOVERGENiHBG054692.
InParanoidiQ12982.
KOiK18448.
OMAiLNGKQEQ.
PhylomeDBiQ12982.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000140299-MONOMER.
ReactomeiR-HSA-375170. CDO in myogenesis.
SIGNORiQ12982.

Miscellaneous databases

GeneWikiiBNIP2.
GenomeRNAii663.
PROiQ12982.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000140299.
CleanExiHS_BNIP2.
ExpressionAtlasiQ12982. baseline and differential.
GenevisibleiQ12982. HS.

Family and domain databases

Gene3Di3.40.525.10. 1 hit.
InterProiIPR022181. Bcl2-/adenovirus-E1B.
IPR001251. CRAL-TRIO_dom.
[Graphical view]
PfamiPF12496. BNIP2. 1 hit.
PF13716. CRAL_TRIO_2. 1 hit.
[Graphical view]
SMARTiSM00516. SEC14. 1 hit.
[Graphical view]
SUPFAMiSSF52087. SSF52087. 1 hit.
PROSITEiPS50191. CRAL_TRIO. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiBNIP2_HUMAN
AccessioniPrimary (citable) accession number: Q12982
Secondary accession number(s): B4DS94
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 15, 1999
Last sequence update: November 1, 1996
Last modified: November 30, 2016
This is version 144 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 15
    Human chromosome 15: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.