Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q12981 (SEC20_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 121. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Vesicle transport protein SEC20
Alternative name(s):
BCL2/adenovirus E1B 19 kDa protein-interacting protein 1
Transformation-related gene 8 protein
Short name=TRG-8
Gene names
Name:BNIP1
Synonyms:NIP1, SEC20L
ORF Names:TRG8
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length228 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

SNARE that may be involved in targeting and fusion of Golgi-derived retrograde transport vesicles with the ER. Required for maintenance of ER network. Implicated in the suppression of cell death. May be involved in mitochondrial autophagy. Ref.7 Ref.9

Subunit structure

Component of a SNARE complex consisting of STX18, USE1L, BNIP1/SEC20L and SEC22B. Interacts directly with STX18, RINT1/TIP20L and NAPA. Interacts with ZW10 through RINT1. Interacts with BCL2 and adenovirus E1B 19 kDa protein. Ref.7

Subcellular location

Mitochondrion. Endoplasmic reticulum membrane; Single-pass type IV membrane protein Ref.7 Ref.9.

Tissue specificity

Isoform 1 is highly expressed in heart, brain, liver skeletal muscle and pancreas. Isoform 3 is moderately expressed in placenta, lung and kidney. Isoform 4 is highly expressed in testis and small intestine. Ref.2

Post-translational modification

'Lys-63'-linked polyubiquitination by RNF185 allows recruiting of autophagy receptor SQSTM1, which simultaneously binds both ubiquitin and LC3 to link ubiquitination and autophagy.

Miscellaneous

Silencing of BNIP1 disrupts ER morphology.

Sequence similarities

Belongs to the SEC20 family.

Ontologies

Keywords
   Biological processApoptosis
Autophagy
ER-Golgi transport
Transport
   Cellular componentEndoplasmic reticulum
Membrane
Mitochondrion
   Coding sequence diversityAlternative splicing
Polymorphism
   DomainCoiled coil
Transmembrane
Transmembrane helix
   PTMUbl conjugation
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processapoptotic process

Inferred from physical interaction Ref.1. Source: MGI

autophagy

Inferred from electronic annotation. Source: UniProtKB-KW

endoplasmic reticulum membrane fusion

Inferred from mutant phenotype Ref.7. Source: HGNC

endoplasmic reticulum organization

Inferred from mutant phenotype Ref.7. Source: HGNC

execution phase of apoptosis

Inferred by curator Ref.7. Source: BHF-UCL

negative regulation of apoptotic process

Traceable author statement Ref.1. Source: UniProtKB

vesicle-mediated transport

Inferred from electronic annotation. Source: UniProtKB-KW

   Cellular_componentSNARE complex

Inferred from direct assay Ref.7. Source: HGNC

cytoplasm

Inferred from direct assay Ref.1. Source: MGI

endoplasmic reticulum

Inferred from direct assay Ref.7. Source: HGNC

integral component of endoplasmic reticulum membrane

Traceable author statement Ref.7. Source: HGNC

intracellular membrane-bounded organelle

Inferred from direct assay Ref.1. Source: UniProtKB

mitochondrion

Inferred from electronic annotation. Source: UniProtKB-SubCell

nuclear envelope

Inferred from direct assay Ref.1. Source: UniProtKB

   Molecular_functionSNAP receptor activity

Inferred from direct assay Ref.7. Source: FlyBase

protein binding

Inferred from physical interaction Ref.1. Source: UniProtKB

Complete GO annotation...

Alternative products

This entry describes 4 isoforms produced by alternative splicing. [Align] [Select]

Note: Additional isoforms seem to exist.
Isoform 1 (identifier: Q12981-4)

Also known as: BNIP1; S4;

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q12981-2)

Also known as: BNIP1-a; S1;

The sequence of this isoform differs from the canonical sequence as follows:
     90-123: Missing.
Isoform 3 (identifier: Q12981-1)

Also known as: BNIP1-b; S2;

The sequence of this isoform differs from the canonical sequence as follows:
     59-59: Q → QPVLYQRAFIWTASTFFFKLTYSLTDFSSTQHDFNSPTTPVTFS
Isoform 4 (identifier: Q12981-3)

Also known as: BNIP1-c; S3;

The sequence of this isoform differs from the canonical sequence as follows:
     59-59: Q → QPVLYQRAFIWTASTFFFKLTYSLTDFSSTQHDFNSPTTPVTFS
     90-123: Missing.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 228228Vesicle transport protein SEC20
PRO_0000064960

Regions

Topological domain1 – 199199Cytoplasmic Potential
Transmembrane200 – 22021Helical; Anchor for type IV membrane protein; Potential
Topological domain221 – 2288Lumenal Potential
Coiled coil37 – 9054 Potential

Natural variations

Alternative sequence591Q → QPVLYQRAFIWTASTFFFKL TYSLTDFSSTQHDFNSPTTP VTFS in isoform 3 and isoform 4.
VSP_017901
Alternative sequence90 – 12334Missing in isoform 2 and isoform 4.
VSP_004330
Natural variant141Q → H. Ref.4
Corresponds to variant rs5745100 [ dbSNP | Ensembl ].
VAR_019169

Experimental info

Mutagenesis1141L → A: Loss of proapoptotic effect. No effect on interaction with RINT1. Ref.7
Sequence conflict141Q → R in AAO91805. Ref.3
Sequence conflict661K → E in AAO91805. Ref.3
Sequence conflict2101A → R Ref.1
Sequence conflict2101A → R Ref.2

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 (BNIP1) (S4) [UniParc].

Last modified April 18, 2006. Version 3.
Checksum: 23F4C21E7327DE3D

FASTA22826,132
        10         20         30         40         50         60 
MAAPQDVHVR ICNQEIVKFD LEVKALIQDI RDCSGPLSAL TELNTKVKEK FQQLRHRIQD 

        70         80         90        100        110        120 
LEQLAKEQDK ESEKQLLLQE VENHKKQMLS NQASWRKANL TCKIAIDNLE KAELLQGGDL 

       130        140        150        160        170        180 
LRQRKTTKES LAQTSSTITE SLMGISRMMA QQVQQSEEAM QSLVTSSRTI LDANEEFKSM 

       190        200        210        220 
SGTIQLGRKL ITKYNRRELT DKLLIFLALA LFLATVLYIV KKRLFPFL 

« Hide

Isoform 2 (BNIP1-a) (S1) [UniParc].

Checksum: E1AAA43E09F6F7F4
Show »

FASTA19422,352
Isoform 3 (BNIP1-b) (S2) [UniParc].

Checksum: 2E5226F028FF2D1A
Show »

FASTA27131,113
Isoform 4 (BNIP1-c) (S3) [UniParc].

Checksum: FDE67A8CE1CE1AAB
Show »

FASTA23727,333

References

« Hide 'large scale' references
[1]"Adenovirus E1B 19 kDa and Bcl-2 proteins interact with a common set of cellular proteins."
Boyd J.M., Malstrom S., Subramanian T., Venkatesh L.K., Schaeper U., Elangovan B., D'Sa-Eipper C., Chinnadurai G.
Cell 79:341-351(1994) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
[2]"Novel BNIP1 variants and their interaction with BCL2 family members."
Zhang H., Heim J., Meyhack B.
FEBS Lett. 448:23-27(1999) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2; 3 AND 4), TISSUE SPECIFICITY.
[3]"Identification of human transformation-related gene."
Kim J.W.
Submitted (JAN-2003) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA].
[4]NIEHS SNPs program
Submitted (FEB-2003) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANT HIS-14.
[5]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[6]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Kidney.
[7]"Involvement of BNIP1 in apoptosis and endoplasmic reticulum membrane fusion."
Nakajima K., Hirose H., Taniguchi M., Kurashina H., Arasaki K., Nagahama M., Tani K., Yamamoto A., Tagaya M.
EMBO J. 23:3216-3226(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION, SUBCELLULAR LOCATION, INTERACTION WITH STX18 AND RINT1, MUTAGENESIS OF LEU-114.
[8]"Initial characterization of the human central proteome."
Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.
BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
[9]"RNF185, a novel mitochondrial ubiquitin E3 ligase, regulates autophagy through interaction with BNIP1."
Tang F., Wang B., Li N., Wu Y., Jia J., Suo T., Chen Q., Liu Y.J., Tang J.
PLoS ONE 6:E24367-E24367(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION IN AUTOPHAGY, SUBCELLULAR LOCATION, UBIQUITINATION BY RNF185.
+Additional computationally mapped references.

Web resources

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
U15172 mRNA. Translation: AAC00020.1.
AF083956 mRNA. Translation: AAC33124.1.
AF083957 mRNA. Translation: AAC33125.1.
AF083958 mRNA. Translation: AAC33126.1.
AY216799 mRNA. Translation: AAO91805.1.
AY246554 Genomic DNA. Translation: AAO61090.1.
CH471062 Genomic DNA. Translation: EAW61405.1.
CH471062 Genomic DNA. Translation: EAW61406.1.
CH471062 Genomic DNA. Translation: EAW61408.1.
CH471062 Genomic DNA. Translation: EAW61409.1.
CH471062 Genomic DNA. Translation: EAW61410.1.
CH471062 Genomic DNA. Translation: EAW61411.1.
CH471062 Genomic DNA. Translation: EAW61412.1.
CH471062 Genomic DNA. Translation: EAW61413.1.
BC010959 mRNA. Translation: AAH10959.1.
CCDSCCDS43400.1. [Q12981-2]
CCDS4384.1. [Q12981-4]
CCDS4385.1. [Q12981-1]
CCDS4386.1. [Q12981-3]
PIRI38863.
RefSeqNP_001196.2. NM_001205.2. [Q12981-4]
NP_053581.2. NM_013978.2. [Q12981-2]
NP_053582.2. NM_013979.2. [Q12981-1]
NP_053583.2. NM_013980.2. [Q12981-3]
UniGeneHs.145726.

3D structure databases

ProteinModelPortalQ12981.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid107130. 9 interactions.
MINTMINT-1957109.
STRING9606.ENSP00000231668.

PTM databases

PhosphoSiteQ12981.

Polymorphism databases

DMDM93141310.

Proteomic databases

MaxQBQ12981.
PaxDbQ12981.
PRIDEQ12981.

Protocols and materials databases

DNASU662.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000231668; ENSP00000231668; ENSG00000113734. [Q12981-1]
ENST00000351486; ENSP00000239215; ENSG00000113734. [Q12981-4]
ENST00000352523; ENSP00000239214; ENSG00000113734. [Q12981-3]
ENST00000393770; ENSP00000377365; ENSG00000113734. [Q12981-2]
GeneID662.
KEGGhsa:662.
UCSCuc003mci.4. human. [Q12981-1]
uc003mcj.4. human. [Q12981-4]
uc003mck.4. human. [Q12981-3]
uc003mcl.4. human. [Q12981-2]

Organism-specific databases

CTD662.
GeneCardsGC05P172504.
HGNCHGNC:1082. BNIP1.
HPAHPA008009.
MIM603291. gene.
neXtProtNX_Q12981.
PharmGKBPA25392.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG73997.
HOVERGENHBG050708.
KOK08497.
OMAAMTGTIQ.
OrthoDBEOG7D2FG0.
PhylomeDBQ12981.
TreeFamTF324339.

Gene expression databases

ArrayExpressQ12981.
BgeeQ12981.
CleanExHS_BNIP1.
GenevestigatorQ12981.

Family and domain databases

InterProIPR005606. Sec20.
[Graphical view]
PfamPF03908. Sec20. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSBNIP1. human.
GenomeRNAi662.
NextBio2694.
PROQ12981.
SOURCESearch...

Entry information

Entry nameSEC20_HUMAN
AccessionPrimary (citable) accession number: Q12981
Secondary accession number(s): D3DQM3 expand/collapse secondary AC list , D3DQM4, D3DQM5, D3DQM6, O75622, O75623, O75624, Q6K044, Q96FG4
Entry history
Integrated into UniProtKB/Swiss-Prot: July 15, 1999
Last sequence update: April 18, 2006
Last modified: July 9, 2014
This is version 121 of the entry and version 3 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 5

Human chromosome 5: entries, gene names and cross-references to MIM