Q12981 (SEC20_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 109.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Vesicle transport protein SEC20 Alternative name(s): BCL2/adenovirus E1B 19 kDa protein-interacting protein 1 Transformation-related gene 8 protein Short name=TRG-8 | ||||||
| Gene names |
| ||||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||||
| Taxonomic identifier | 9606 [NCBI] | ||||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 228 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | SNARE that may be involved in targeting and fusion of Golgi-derived retrograde transport vesicles with the ER. Required for maintenance of ER network. Implicated in the suppression of cell death. May be involved in mitochondrial autophagy. Ref.7 Ref.9 |
| Subunit structure | Component of a SNARE complex consisting of STX18, USE1L, BNIP1/SEC20L and SEC22B. Interacts directly with STX18, RINT1/TIP20L and NAPA. Interacts with ZW10 through RINT1. Interacts with BCL2 and adenovirus E1B 19 kDa protein. Ref.7 |
| Subcellular location | Mitochondrion. Endoplasmic reticulum membrane; Single-pass type IV membrane protein Ref.7 Ref.9. |
| Tissue specificity | Isoform 1 is highly expressed in heart, brain, liver skeletal muscle and pancreas. Isoform 3 is moderately expressed in placenta, lung and kidney. Isoform 4 is highly expressed in testis and small intestine. Ref.2 |
| Post-translational modification | 'Lys-63'-linked polyubiquitination by RNF185 allows recruiting of autophagy receptor SQSTM1, which simultaneously binds both ubiquitin and LC3 to link ubiquitination and autophagy. |
| Miscellaneous | Silencing of BNIP1 disrupts ER morphology. |
| Sequence similarities | Belongs to the SEC20 family. |
Ontologies
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] Note: Additional isoforms seem to exist. | ||||||
| Isoform 1 (identifier: Q12981-4) Also known as: BNIP1; S4; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q12981-2) Also known as: BNIP1-a; S1; The sequence of this isoform differs from the canonical sequence as follows: 90-123: Missing. | ||||||
| Isoform 3 (identifier: Q12981-1) Also known as: BNIP1-b; S2; The sequence of this isoform differs from the canonical sequence as follows: 59-59: Q → QPVLYQRAFIWTASTFFFKLTYSLTDFSSTQHDFNSPTTPVTFS | ||||||
| Isoform 4 (identifier: Q12981-3) Also known as: BNIP1-c; S3; The sequence of this isoform differs from the canonical sequence as follows: 59-59: Q → QPVLYQRAFIWTASTFFFKLTYSLTDFSSTQHDFNSPTTPVTFS 90-123: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 228 | 228 | Vesicle transport protein SEC20 | PRO_0000064960 | |||||
Regions | |||||||||
| Topological domain | 1 – 199 | 199 | Cytoplasmic Potential | ||||||
| Transmembrane | 200 – 220 | 21 | Helical; Anchor for type IV membrane protein; Potential | ||||||
| Topological domain | 221 – 228 | 8 | Lumenal Potential | ||||||
| Coiled coil | 37 – 90 | 54 | Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 59 | 1 | Q → QPVLYQRAFIWTASTFFFKL TYSLTDFSSTQHDFNSPTTP VTFS in isoform 3 and isoform 4. | VSP_017901 | |||||
| Alternative sequence | 90 – 123 | 34 | Missing in isoform 2 and isoform 4. | VSP_004330 | |||||
| Natural variant | 14 | 1 | Q → H. Ref.4 Corresponds to variant rs5745100 [ dbSNP | Ensembl ]. | VAR_019169 | |||||
Experimental info | |||||||||
| Mutagenesis | 114 | 1 | L → A: Loss of proapoptotic effect. No effect on interaction with RINT1. Ref.7 | ||||||
| Sequence conflict | 14 | 1 | Q → R in AAO91805. Ref.3 | ||||||
| Sequence conflict | 66 | 1 | K → E in AAO91805. Ref.3 | ||||||
| Sequence conflict | 210 | 1 | A → R Ref.1 | ||||||
| Sequence conflict | 210 | 1 | A → R Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Adenovirus E1B 19 kDa and Bcl-2 proteins interact with a common set of cellular proteins." Boyd J.M., Malstrom S., Subramanian T., Venkatesh L.K., Schaeper U., Elangovan B., D'Sa-Eipper C., Chinnadurai G. Cell 79:341-351(1994) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [2] | "Novel BNIP1 variants and their interaction with BCL2 family members." Zhang H., Heim J., Meyhack B. FEBS Lett. 448:23-27(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2; 3 AND 4), TISSUE SPECIFICITY. |
| [3] | "Identification of human transformation-related gene." Kim J.W. Submitted (JAN-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA]. |
| [4] | NIEHS SNPs program Submitted (FEB-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANT HIS-14. |
| [5] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Kidney. |
| [7] | "Involvement of BNIP1 in apoptosis and endoplasmic reticulum membrane fusion." Nakajima K., Hirose H., Taniguchi M., Kurashina H., Arasaki K., Nagahama M., Tani K., Yamamoto A., Tagaya M. EMBO J. 23:3216-3226(2004) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION, INTERACTION WITH STX18 AND RINT1, MUTAGENESIS OF LEU-114. |
| [8] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [9] | "RNF185, a novel mitochondrial ubiquitin E3 ligase, regulates autophagy through interaction with BNIP1." Tang F., Wang B., Li N., Wu Y., Jia J., Suo T., Chen Q., Liu Y.J., Tang J. PLoS ONE 6:E24367-E24367(2011) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION IN AUTOPHAGY, SUBCELLULAR LOCATION, UBIQUITINATION BY RNF185. |
| + | Additional computationally mapped references. |
Web resources
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | U15172 mRNA. Translation: AAC00020.1. AF083956 mRNA. Translation: AAC33124.1. AF083957 mRNA. Translation: AAC33125.1. AF083958 mRNA. Translation: AAC33126.1. AY216799 mRNA. Translation: AAO91805.1. AY246554 Genomic DNA. Translation: AAO61090.1. CH471062 Genomic DNA. Translation: EAW61405.1. CH471062 Genomic DNA. Translation: EAW61406.1. CH471062 Genomic DNA. Translation: EAW61408.1. CH471062 Genomic DNA. Translation: EAW61409.1. CH471062 Genomic DNA. Translation: EAW61410.1. CH471062 Genomic DNA. Translation: EAW61411.1. CH471062 Genomic DNA. Translation: EAW61412.1. CH471062 Genomic DNA. Translation: EAW61413.1. BC010959 mRNA. Translation: AAH10959.1. |
| IPI | IPI00030397. IPI00215701. IPI00215703. IPI00215704. |
| PIR | I38863. |
| RefSeq | NP_001196.2. NM_001205.2. NP_053581.2. NM_013978.2. NP_053582.2. NM_013979.2. NP_053583.2. NM_013980.2. |
| UniGene | Hs.145726. |
3D structure databases | |
| ProteinModelPortal | Q12981. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 9606.ENSP00000231668. |
PTM databases | |
| PhosphoSite | Q12981. |
Proteomic databases | |
| PaxDb | Q12981. |
| PRIDE | Q12981. |
Protocols and materials databases | |
| DNASU | 662. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000231668; ENSP00000231668; ENSG00000113734. ENST00000351486; ENSP00000239215; ENSG00000113734. ENST00000352523; ENSP00000239214; ENSG00000113734. ENST00000393770; ENSP00000377365; ENSG00000113734. |
| GeneID | 662. |
| KEGG | hsa:662. |
| UCSC | uc003mci.4. human. uc003mcj.4. human. uc003mck.4. human. uc003mcl.4. human. |
Organism-specific databases | |
| CTD | 662. |
| GeneCards | GC05P172504. |
| HGNC | HGNC:1082. BNIP1. |
| HPA | HPA008009. |
| MIM | 603291. gene. |
| neXtProt | NX_Q12981. |
| PharmGKB | PA25392. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG73997. |
| HOVERGEN | HBG050708. |
| KO | K08497. |
| OMA | AMTGTIQ. |
| OrthoDB | EOG4BRWMR. |
Gene expression databases | |
| ArrayExpress | Q12981. |
| Bgee | Q12981. |
| CleanEx | HS_BNIP1. |
| Genevestigator | Q12981. |
| GermOnline | ENSG00000113734. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR005606. Sec20. [Graphical view] |
| Pfam | PF03908. Sec20. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | BNIP1. human. |
| GenomeRNAi | 662. |
| NextBio | 2694. |
| SOURCE | Search... |
Entry information
| Entry name | SEC20_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q12981 Secondary accession number(s): D3DQM3 Q96FG4 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 5 Human chromosome 5: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
