Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q12981

- SEC20_HUMAN

UniProt

Q12981 - SEC20_HUMAN

Protein

Vesicle transport protein SEC20

Gene

BNIP1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 122 (01 Oct 2014)
      Sequence version 3 (18 Apr 2006)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    SNARE that may be involved in targeting and fusion of Golgi-derived retrograde transport vesicles with the ER. Required for maintenance of ER network. Implicated in the suppression of cell death. May be involved in mitochondrial autophagy.2 Publications

    GO - Molecular functioni

    1. protein binding Source: UniProtKB
    2. SNAP receptor activity Source: FlyBase

    GO - Biological processi

    1. apoptotic process Source: MGI
    2. autophagy Source: UniProtKB-KW
    3. endoplasmic reticulum membrane fusion Source: HGNC
    4. endoplasmic reticulum organization Source: HGNC
    5. execution phase of apoptosis Source: BHF-UCL
    6. negative regulation of apoptotic process Source: UniProtKB
    7. vesicle-mediated transport Source: UniProtKB-KW

    Keywords - Biological processi

    Apoptosis, Autophagy, ER-Golgi transport, Transport

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Vesicle transport protein SEC20
    Alternative name(s):
    BCL2/adenovirus E1B 19 kDa protein-interacting protein 1
    Transformation-related gene 8 protein
    Short name:
    TRG-8
    Gene namesi
    Name:BNIP1
    Synonyms:NIP1, SEC20L
    ORF Names:TRG8
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 5

    Organism-specific databases

    HGNCiHGNC:1082. BNIP1.

    Subcellular locationi

    GO - Cellular componenti

    1. cytoplasm Source: MGI
    2. endoplasmic reticulum Source: HGNC
    3. integral component of endoplasmic reticulum membrane Source: HGNC
    4. intracellular membrane-bounded organelle Source: UniProtKB
    5. mitochondrion Source: UniProtKB-SubCell
    6. nuclear envelope Source: UniProtKB
    7. SNARE complex Source: HGNC

    Keywords - Cellular componenti

    Endoplasmic reticulum, Membrane, Mitochondrion

    Pathology & Biotechi

    Mutagenesis

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Mutagenesisi114 – 1141L → A: Loss of proapoptotic effect. No effect on interaction with RINT1. 1 Publication

    Organism-specific databases

    PharmGKBiPA25392.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 228228Vesicle transport protein SEC20PRO_0000064960Add
    BLAST

    Post-translational modificationi

    'Lys-63'-linked polyubiquitination by RNF185 allows recruiting of autophagy receptor SQSTM1, which simultaneously binds both ubiquitin and LC3 to link ubiquitination and autophagy.1 Publication

    Keywords - PTMi

    Ubl conjugation

    Proteomic databases

    MaxQBiQ12981.
    PaxDbiQ12981.
    PRIDEiQ12981.

    PTM databases

    PhosphoSiteiQ12981.

    Expressioni

    Tissue specificityi

    Isoform 1 is highly expressed in heart, brain, liver skeletal muscle and pancreas. Isoform 3 is moderately expressed in placenta, lung and kidney. Isoform 4 is highly expressed in testis and small intestine.1 Publication

    Gene expression databases

    ArrayExpressiQ12981.
    BgeeiQ12981.
    CleanExiHS_BNIP1.
    GenevestigatoriQ12981.

    Organism-specific databases

    HPAiHPA008009.

    Interactioni

    Subunit structurei

    Component of a SNARE complex consisting of STX18, USE1L, BNIP1/SEC20L and SEC22B. Interacts directly with STX18, RINT1/TIP20L and NAPA. Interacts with ZW10 through RINT1. Interacts with BCL2 and adenovirus E1B 19 kDa protein.1 Publication

    Protein-protein interaction databases

    BioGridi107130. 9 interactions.
    MINTiMINT-1957109.
    STRINGi9606.ENSP00000231668.

    Structurei

    3D structure databases

    ProteinModelPortaliQ12981.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini1 – 199199CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini221 – 2288LumenalSequence Analysis

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei200 – 22021Helical; Anchor for type IV membrane proteinSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Coiled coil

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Coiled coili37 – 9054Sequence AnalysisAdd
    BLAST

    Sequence similaritiesi

    Belongs to the SEC20 family.Curated

    Keywords - Domaini

    Coiled coil, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG73997.
    HOVERGENiHBG050708.
    KOiK08497.
    OMAiAMTGTIQ.
    OrthoDBiEOG7D2FG0.
    PhylomeDBiQ12981.
    TreeFamiTF324339.

    Family and domain databases

    InterProiIPR005606. Sec20.
    [Graphical view]
    PfamiPF03908. Sec20. 1 hit.
    [Graphical view]

    Sequences (4)i

    Sequence statusi: Complete.

    This entry describes 4 isoformsi produced by alternative splicing. Align

    Note: Additional isoforms seem to exist.

    Isoform 1 (identifier: Q12981-4) [UniParc]FASTAAdd to Basket

    Also known as: BNIP1, S4

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MAAPQDVHVR ICNQEIVKFD LEVKALIQDI RDCSGPLSAL TELNTKVKEK    50
    FQQLRHRIQD LEQLAKEQDK ESEKQLLLQE VENHKKQMLS NQASWRKANL 100
    TCKIAIDNLE KAELLQGGDL LRQRKTTKES LAQTSSTITE SLMGISRMMA 150
    QQVQQSEEAM QSLVTSSRTI LDANEEFKSM SGTIQLGRKL ITKYNRRELT 200
    DKLLIFLALA LFLATVLYIV KKRLFPFL 228
    Length:228
    Mass (Da):26,132
    Last modified:April 18, 2006 - v3
    Checksum:i23F4C21E7327DE3D
    GO
    Isoform 2 (identifier: Q12981-2) [UniParc]FASTAAdd to Basket

    Also known as: BNIP1-a, S1

    The sequence of this isoform differs from the canonical sequence as follows:
         90-123: Missing.

    Show »
    Length:194
    Mass (Da):22,352
    Checksum:iE1AAA43E09F6F7F4
    GO
    Isoform 3 (identifier: Q12981-1) [UniParc]FASTAAdd to Basket

    Also known as: BNIP1-b, S2

    The sequence of this isoform differs from the canonical sequence as follows:
         59-59: Q → QPVLYQRAFIWTASTFFFKLTYSLTDFSSTQHDFNSPTTPVTFS

    Show »
    Length:271
    Mass (Da):31,113
    Checksum:i2E5226F028FF2D1A
    GO
    Isoform 4 (identifier: Q12981-3) [UniParc]FASTAAdd to Basket

    Also known as: BNIP1-c, S3

    The sequence of this isoform differs from the canonical sequence as follows:
         59-59: Q → QPVLYQRAFIWTASTFFFKLTYSLTDFSSTQHDFNSPTTPVTFS
         90-123: Missing.

    Show »
    Length:237
    Mass (Da):27,333
    Checksum:iFDE67A8CE1CE1AAB
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti14 – 141Q → R in AAO91805. 1 PublicationCurated
    Sequence conflicti66 – 661K → E in AAO91805. 1 PublicationCurated
    Sequence conflicti210 – 2101A → R(PubMed:7954800)Curated
    Sequence conflicti210 – 2101A → R(PubMed:10217402)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti14 – 141Q → H.1 Publication
    Corresponds to variant rs5745100 [ dbSNP | Ensembl ].
    VAR_019169

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei59 – 591Q → QPVLYQRAFIWTASTFFFKL TYSLTDFSSTQHDFNSPTTP VTFS in isoform 3 and isoform 4. 1 PublicationVSP_017901
    Alternative sequencei90 – 12334Missing in isoform 2 and isoform 4. 1 PublicationVSP_004330Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U15172 mRNA. Translation: AAC00020.1.
    AF083956 mRNA. Translation: AAC33124.1.
    AF083957 mRNA. Translation: AAC33125.1.
    AF083958 mRNA. Translation: AAC33126.1.
    AY216799 mRNA. Translation: AAO91805.1.
    AY246554 Genomic DNA. Translation: AAO61090.1.
    CH471062 Genomic DNA. Translation: EAW61405.1.
    CH471062 Genomic DNA. Translation: EAW61406.1.
    CH471062 Genomic DNA. Translation: EAW61408.1.
    CH471062 Genomic DNA. Translation: EAW61409.1.
    CH471062 Genomic DNA. Translation: EAW61410.1.
    CH471062 Genomic DNA. Translation: EAW61411.1.
    CH471062 Genomic DNA. Translation: EAW61412.1.
    CH471062 Genomic DNA. Translation: EAW61413.1.
    BC010959 mRNA. Translation: AAH10959.1.
    CCDSiCCDS43400.1. [Q12981-2]
    CCDS4384.1. [Q12981-4]
    CCDS4385.1. [Q12981-1]
    CCDS4386.1. [Q12981-3]
    PIRiI38863.
    RefSeqiNP_001196.2. NM_001205.2. [Q12981-4]
    NP_053581.2. NM_013978.2. [Q12981-2]
    NP_053582.2. NM_013979.2. [Q12981-1]
    NP_053583.2. NM_013980.2. [Q12981-3]
    UniGeneiHs.145726.

    Genome annotation databases

    EnsembliENST00000231668; ENSP00000231668; ENSG00000113734. [Q12981-1]
    ENST00000351486; ENSP00000239215; ENSG00000113734. [Q12981-4]
    ENST00000352523; ENSP00000239214; ENSG00000113734. [Q12981-3]
    ENST00000393770; ENSP00000377365; ENSG00000113734. [Q12981-2]
    GeneIDi662.
    KEGGihsa:662.
    UCSCiuc003mci.4. human. [Q12981-1]
    uc003mcj.4. human. [Q12981-4]
    uc003mck.4. human. [Q12981-3]
    uc003mcl.4. human. [Q12981-2]

    Polymorphism databases

    DMDMi93141310.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Web resourcesi

    NIEHS-SNPs

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U15172 mRNA. Translation: AAC00020.1 .
    AF083956 mRNA. Translation: AAC33124.1 .
    AF083957 mRNA. Translation: AAC33125.1 .
    AF083958 mRNA. Translation: AAC33126.1 .
    AY216799 mRNA. Translation: AAO91805.1 .
    AY246554 Genomic DNA. Translation: AAO61090.1 .
    CH471062 Genomic DNA. Translation: EAW61405.1 .
    CH471062 Genomic DNA. Translation: EAW61406.1 .
    CH471062 Genomic DNA. Translation: EAW61408.1 .
    CH471062 Genomic DNA. Translation: EAW61409.1 .
    CH471062 Genomic DNA. Translation: EAW61410.1 .
    CH471062 Genomic DNA. Translation: EAW61411.1 .
    CH471062 Genomic DNA. Translation: EAW61412.1 .
    CH471062 Genomic DNA. Translation: EAW61413.1 .
    BC010959 mRNA. Translation: AAH10959.1 .
    CCDSi CCDS43400.1. [Q12981-2 ]
    CCDS4384.1. [Q12981-4 ]
    CCDS4385.1. [Q12981-1 ]
    CCDS4386.1. [Q12981-3 ]
    PIRi I38863.
    RefSeqi NP_001196.2. NM_001205.2. [Q12981-4 ]
    NP_053581.2. NM_013978.2. [Q12981-2 ]
    NP_053582.2. NM_013979.2. [Q12981-1 ]
    NP_053583.2. NM_013980.2. [Q12981-3 ]
    UniGenei Hs.145726.

    3D structure databases

    ProteinModelPortali Q12981.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 107130. 9 interactions.
    MINTi MINT-1957109.
    STRINGi 9606.ENSP00000231668.

    PTM databases

    PhosphoSitei Q12981.

    Polymorphism databases

    DMDMi 93141310.

    Proteomic databases

    MaxQBi Q12981.
    PaxDbi Q12981.
    PRIDEi Q12981.

    Protocols and materials databases

    DNASUi 662.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000231668 ; ENSP00000231668 ; ENSG00000113734 . [Q12981-1 ]
    ENST00000351486 ; ENSP00000239215 ; ENSG00000113734 . [Q12981-4 ]
    ENST00000352523 ; ENSP00000239214 ; ENSG00000113734 . [Q12981-3 ]
    ENST00000393770 ; ENSP00000377365 ; ENSG00000113734 . [Q12981-2 ]
    GeneIDi 662.
    KEGGi hsa:662.
    UCSCi uc003mci.4. human. [Q12981-1 ]
    uc003mcj.4. human. [Q12981-4 ]
    uc003mck.4. human. [Q12981-3 ]
    uc003mcl.4. human. [Q12981-2 ]

    Organism-specific databases

    CTDi 662.
    GeneCardsi GC05P172504.
    HGNCi HGNC:1082. BNIP1.
    HPAi HPA008009.
    MIMi 603291. gene.
    neXtProti NX_Q12981.
    PharmGKBi PA25392.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG73997.
    HOVERGENi HBG050708.
    KOi K08497.
    OMAi AMTGTIQ.
    OrthoDBi EOG7D2FG0.
    PhylomeDBi Q12981.
    TreeFami TF324339.

    Miscellaneous databases

    ChiTaRSi BNIP1. human.
    GenomeRNAii 662.
    NextBioi 2694.
    PROi Q12981.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q12981.
    Bgeei Q12981.
    CleanExi HS_BNIP1.
    Genevestigatori Q12981.

    Family and domain databases

    InterProi IPR005606. Sec20.
    [Graphical view ]
    Pfami PF03908. Sec20. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Adenovirus E1B 19 kDa and Bcl-2 proteins interact with a common set of cellular proteins."
      Boyd J.M., Malstrom S., Subramanian T., Venkatesh L.K., Schaeper U., Elangovan B., D'Sa-Eipper C., Chinnadurai G.
      Cell 79:341-351(1994) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    2. "Novel BNIP1 variants and their interaction with BCL2 family members."
      Zhang H., Heim J., Meyhack B.
      FEBS Lett. 448:23-27(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2; 3 AND 4), TISSUE SPECIFICITY.
    3. "Identification of human transformation-related gene."
      Kim J.W.
      Submitted (JAN-2003) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA].
    4. NIEHS SNPs program
      Submitted (FEB-2003) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANT HIS-14.
    5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Kidney.
    7. "Involvement of BNIP1 in apoptosis and endoplasmic reticulum membrane fusion."
      Nakajima K., Hirose H., Taniguchi M., Kurashina H., Arasaki K., Nagahama M., Tani K., Yamamoto A., Tagaya M.
      EMBO J. 23:3216-3226(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, SUBCELLULAR LOCATION, INTERACTION WITH STX18 AND RINT1, MUTAGENESIS OF LEU-114.
    8. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    9. "RNF185, a novel mitochondrial ubiquitin E3 ligase, regulates autophagy through interaction with BNIP1."
      Tang F., Wang B., Li N., Wu Y., Jia J., Suo T., Chen Q., Liu Y.J., Tang J.
      PLoS ONE 6:E24367-E24367(2011) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION IN AUTOPHAGY, SUBCELLULAR LOCATION, UBIQUITINATION BY RNF185.

    Entry informationi

    Entry nameiSEC20_HUMAN
    AccessioniPrimary (citable) accession number: Q12981
    Secondary accession number(s): D3DQM3
    , D3DQM4, D3DQM5, D3DQM6, O75622, O75623, O75624, Q6K044, Q96FG4
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: July 15, 1999
    Last sequence update: April 18, 2006
    Last modified: October 1, 2014
    This is version 122 of the entry and version 3 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Miscellaneous

    Silencing of BNIP1 disrupts ER morphology.

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 5
      Human chromosome 5: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3