Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q12981

- SEC20_HUMAN

UniProt

Q12981 - SEC20_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Vesicle transport protein SEC20

Gene

BNIP1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

SNARE that may be involved in targeting and fusion of Golgi-derived retrograde transport vesicles with the ER. Required for maintenance of ER network. Implicated in the suppression of cell death. May be involved in mitochondrial autophagy.2 Publications

GO - Molecular functioni

  1. SNAP receptor activity Source: FlyBase

GO - Biological processi

  1. apoptotic process Source: MGI
  2. autophagy Source: UniProtKB-KW
  3. endoplasmic reticulum membrane fusion Source: HGNC
  4. endoplasmic reticulum organization Source: HGNC
  5. execution phase of apoptosis Source: BHF-UCL
  6. negative regulation of apoptotic process Source: UniProtKB
  7. vesicle-mediated transport Source: UniProtKB-KW
Complete GO annotation...

Keywords - Biological processi

Apoptosis, Autophagy, ER-Golgi transport, Transport

Names & Taxonomyi

Protein namesi
Recommended name:
Vesicle transport protein SEC20
Alternative name(s):
BCL2/adenovirus E1B 19 kDa protein-interacting protein 1
Transformation-related gene 8 protein
Short name:
TRG-8
Gene namesi
Name:BNIP1
Synonyms:NIP1, SEC20L
ORF Names:TRG8
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 5

Organism-specific databases

HGNCiHGNC:1082. BNIP1.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 199199CytoplasmicSequence AnalysisAdd
BLAST
Transmembranei200 – 22021Helical; Anchor for type IV membrane proteinSequence AnalysisAdd
BLAST
Topological domaini221 – 2288LumenalSequence Analysis

GO - Cellular componenti

  1. cytoplasm Source: MGI
  2. endoplasmic reticulum Source: HGNC
  3. integral component of endoplasmic reticulum membrane Source: HGNC
  4. intracellular membrane-bounded organelle Source: UniProtKB
  5. mitochondrion Source: UniProtKB-KW
  6. nuclear envelope Source: UniProtKB
  7. SNARE complex Source: HGNC
Complete GO annotation...

Keywords - Cellular componenti

Endoplasmic reticulum, Membrane, Mitochondrion

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi114 – 1141L → A: Loss of proapoptotic effect. No effect on interaction with RINT1. 1 Publication

Organism-specific databases

PharmGKBiPA25392.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 228228Vesicle transport protein SEC20PRO_0000064960Add
BLAST

Post-translational modificationi

'Lys-63'-linked polyubiquitination by RNF185 allows recruiting of autophagy receptor SQSTM1, which simultaneously binds both ubiquitin and LC3 to link ubiquitination and autophagy.1 Publication

Keywords - PTMi

Ubl conjugation

Proteomic databases

MaxQBiQ12981.
PaxDbiQ12981.
PRIDEiQ12981.

PTM databases

PhosphoSiteiQ12981.

Expressioni

Tissue specificityi

Isoform 1 is highly expressed in heart, brain, liver skeletal muscle and pancreas. Isoform 3 is moderately expressed in placenta, lung and kidney. Isoform 4 is highly expressed in testis and small intestine.1 Publication

Gene expression databases

BgeeiQ12981.
CleanExiHS_BNIP1.
ExpressionAtlasiQ12981. baseline and differential.
GenevestigatoriQ12981.

Organism-specific databases

HPAiHPA008009.

Interactioni

Subunit structurei

Component of a SNARE complex consisting of STX18, USE1L, BNIP1/SEC20L and SEC22B. Interacts directly with STX18, RINT1/TIP20L and NAPA. Interacts with ZW10 through RINT1. Interacts with BCL2 and adenovirus E1B 19 kDa protein.1 Publication

Protein-protein interaction databases

BioGridi107130. 20 interactions.
MINTiMINT-1957109.
STRINGi9606.ENSP00000231668.

Structurei

3D structure databases

ProteinModelPortaliQ12981.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili37 – 9054Sequence AnalysisAdd
BLAST

Sequence similaritiesi

Belongs to the SEC20 family.Curated

Keywords - Domaini

Coiled coil, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG73997.
GeneTreeiENSGT00390000014412.
HOVERGENiHBG050708.
InParanoidiQ12981.
KOiK08497.
OMAiAMTGTIQ.
OrthoDBiEOG7D2FG0.
PhylomeDBiQ12981.
TreeFamiTF324339.

Family and domain databases

InterProiIPR005606. Sec20.
[Graphical view]
PfamiPF03908. Sec20. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. Align

Note: Additional isoforms seem to exist.

Isoform 1 (identifier: Q12981-4) [UniParc]FASTAAdd to Basket

Also known as: BNIP1, S4

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAAPQDVHVR ICNQEIVKFD LEVKALIQDI RDCSGPLSAL TELNTKVKEK
60 70 80 90 100
FQQLRHRIQD LEQLAKEQDK ESEKQLLLQE VENHKKQMLS NQASWRKANL
110 120 130 140 150
TCKIAIDNLE KAELLQGGDL LRQRKTTKES LAQTSSTITE SLMGISRMMA
160 170 180 190 200
QQVQQSEEAM QSLVTSSRTI LDANEEFKSM SGTIQLGRKL ITKYNRRELT
210 220
DKLLIFLALA LFLATVLYIV KKRLFPFL
Length:228
Mass (Da):26,132
Last modified:April 18, 2006 - v3
Checksum:i23F4C21E7327DE3D
GO
Isoform 2 (identifier: Q12981-2) [UniParc]FASTAAdd to Basket

Also known as: BNIP1-a, S1

The sequence of this isoform differs from the canonical sequence as follows:
     90-123: Missing.

Show »
Length:194
Mass (Da):22,352
Checksum:iE1AAA43E09F6F7F4
GO
Isoform 3 (identifier: Q12981-1) [UniParc]FASTAAdd to Basket

Also known as: BNIP1-b, S2

The sequence of this isoform differs from the canonical sequence as follows:
     59-59: Q → QPVLYQRAFIWTASTFFFKLTYSLTDFSSTQHDFNSPTTPVTFS

Show »
Length:271
Mass (Da):31,113
Checksum:i2E5226F028FF2D1A
GO
Isoform 4 (identifier: Q12981-3) [UniParc]FASTAAdd to Basket

Also known as: BNIP1-c, S3

The sequence of this isoform differs from the canonical sequence as follows:
     59-59: Q → QPVLYQRAFIWTASTFFFKLTYSLTDFSSTQHDFNSPTTPVTFS
     90-123: Missing.

Show »
Length:237
Mass (Da):27,333
Checksum:iFDE67A8CE1CE1AAB
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti14 – 141Q → R in AAO91805. 1 PublicationCurated
Sequence conflicti66 – 661K → E in AAO91805. 1 PublicationCurated
Sequence conflicti210 – 2101A → R(PubMed:7954800)Curated
Sequence conflicti210 – 2101A → R(PubMed:10217402)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti14 – 141Q → H.1 Publication
Corresponds to variant rs5745100 [ dbSNP | Ensembl ].
VAR_019169

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei59 – 591Q → QPVLYQRAFIWTASTFFFKL TYSLTDFSSTQHDFNSPTTP VTFS in isoform 3 and isoform 4. 1 PublicationVSP_017901
Alternative sequencei90 – 12334Missing in isoform 2 and isoform 4. 1 PublicationVSP_004330Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U15172 mRNA. Translation: AAC00020.1.
AF083956 mRNA. Translation: AAC33124.1.
AF083957 mRNA. Translation: AAC33125.1.
AF083958 mRNA. Translation: AAC33126.1.
AY216799 mRNA. Translation: AAO91805.1.
AY246554 Genomic DNA. Translation: AAO61090.1.
CH471062 Genomic DNA. Translation: EAW61405.1.
CH471062 Genomic DNA. Translation: EAW61406.1.
CH471062 Genomic DNA. Translation: EAW61408.1.
CH471062 Genomic DNA. Translation: EAW61409.1.
CH471062 Genomic DNA. Translation: EAW61410.1.
CH471062 Genomic DNA. Translation: EAW61411.1.
CH471062 Genomic DNA. Translation: EAW61412.1.
CH471062 Genomic DNA. Translation: EAW61413.1.
BC010959 mRNA. Translation: AAH10959.1.
CCDSiCCDS43400.1. [Q12981-2]
CCDS4384.1. [Q12981-4]
CCDS4385.1. [Q12981-1]
CCDS4386.1. [Q12981-3]
PIRiI38863.
RefSeqiNP_001196.2. NM_001205.2. [Q12981-4]
NP_053581.2. NM_013978.2. [Q12981-2]
NP_053582.2. NM_013979.2. [Q12981-1]
NP_053583.2. NM_013980.2. [Q12981-3]
UniGeneiHs.145726.

Genome annotation databases

EnsembliENST00000231668; ENSP00000231668; ENSG00000113734. [Q12981-1]
ENST00000351486; ENSP00000239215; ENSG00000113734. [Q12981-4]
ENST00000352523; ENSP00000239214; ENSG00000113734. [Q12981-3]
ENST00000393770; ENSP00000377365; ENSG00000113734. [Q12981-2]
GeneIDi662.
KEGGihsa:662.
UCSCiuc003mci.4. human. [Q12981-1]
uc003mcj.4. human. [Q12981-4]
uc003mck.4. human. [Q12981-3]
uc003mcl.4. human. [Q12981-2]

Polymorphism databases

DMDMi93141310.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

NIEHS-SNPs

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U15172 mRNA. Translation: AAC00020.1 .
AF083956 mRNA. Translation: AAC33124.1 .
AF083957 mRNA. Translation: AAC33125.1 .
AF083958 mRNA. Translation: AAC33126.1 .
AY216799 mRNA. Translation: AAO91805.1 .
AY246554 Genomic DNA. Translation: AAO61090.1 .
CH471062 Genomic DNA. Translation: EAW61405.1 .
CH471062 Genomic DNA. Translation: EAW61406.1 .
CH471062 Genomic DNA. Translation: EAW61408.1 .
CH471062 Genomic DNA. Translation: EAW61409.1 .
CH471062 Genomic DNA. Translation: EAW61410.1 .
CH471062 Genomic DNA. Translation: EAW61411.1 .
CH471062 Genomic DNA. Translation: EAW61412.1 .
CH471062 Genomic DNA. Translation: EAW61413.1 .
BC010959 mRNA. Translation: AAH10959.1 .
CCDSi CCDS43400.1. [Q12981-2 ]
CCDS4384.1. [Q12981-4 ]
CCDS4385.1. [Q12981-1 ]
CCDS4386.1. [Q12981-3 ]
PIRi I38863.
RefSeqi NP_001196.2. NM_001205.2. [Q12981-4 ]
NP_053581.2. NM_013978.2. [Q12981-2 ]
NP_053582.2. NM_013979.2. [Q12981-1 ]
NP_053583.2. NM_013980.2. [Q12981-3 ]
UniGenei Hs.145726.

3D structure databases

ProteinModelPortali Q12981.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 107130. 20 interactions.
MINTi MINT-1957109.
STRINGi 9606.ENSP00000231668.

PTM databases

PhosphoSitei Q12981.

Polymorphism databases

DMDMi 93141310.

Proteomic databases

MaxQBi Q12981.
PaxDbi Q12981.
PRIDEi Q12981.

Protocols and materials databases

DNASUi 662.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000231668 ; ENSP00000231668 ; ENSG00000113734 . [Q12981-1 ]
ENST00000351486 ; ENSP00000239215 ; ENSG00000113734 . [Q12981-4 ]
ENST00000352523 ; ENSP00000239214 ; ENSG00000113734 . [Q12981-3 ]
ENST00000393770 ; ENSP00000377365 ; ENSG00000113734 . [Q12981-2 ]
GeneIDi 662.
KEGGi hsa:662.
UCSCi uc003mci.4. human. [Q12981-1 ]
uc003mcj.4. human. [Q12981-4 ]
uc003mck.4. human. [Q12981-3 ]
uc003mcl.4. human. [Q12981-2 ]

Organism-specific databases

CTDi 662.
GeneCardsi GC05P172504.
HGNCi HGNC:1082. BNIP1.
HPAi HPA008009.
MIMi 603291. gene.
neXtProti NX_Q12981.
PharmGKBi PA25392.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG73997.
GeneTreei ENSGT00390000014412.
HOVERGENi HBG050708.
InParanoidi Q12981.
KOi K08497.
OMAi AMTGTIQ.
OrthoDBi EOG7D2FG0.
PhylomeDBi Q12981.
TreeFami TF324339.

Miscellaneous databases

ChiTaRSi BNIP1. human.
GenomeRNAii 662.
NextBioi 2694.
PROi Q12981.
SOURCEi Search...

Gene expression databases

Bgeei Q12981.
CleanExi HS_BNIP1.
ExpressionAtlasi Q12981. baseline and differential.
Genevestigatori Q12981.

Family and domain databases

InterProi IPR005606. Sec20.
[Graphical view ]
Pfami PF03908. Sec20. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Adenovirus E1B 19 kDa and Bcl-2 proteins interact with a common set of cellular proteins."
    Boyd J.M., Malstrom S., Subramanian T., Venkatesh L.K., Schaeper U., Elangovan B., D'Sa-Eipper C., Chinnadurai G.
    Cell 79:341-351(1994) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  2. "Novel BNIP1 variants and their interaction with BCL2 family members."
    Zhang H., Heim J., Meyhack B.
    FEBS Lett. 448:23-27(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2; 3 AND 4), TISSUE SPECIFICITY.
  3. "Identification of human transformation-related gene."
    Kim J.W.
    Submitted (JAN-2003) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA].
  4. NIEHS SNPs program
    Submitted (FEB-2003) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANT HIS-14.
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Kidney.
  7. "Involvement of BNIP1 in apoptosis and endoplasmic reticulum membrane fusion."
    Nakajima K., Hirose H., Taniguchi M., Kurashina H., Arasaki K., Nagahama M., Tani K., Yamamoto A., Tagaya M.
    EMBO J. 23:3216-3226(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, SUBCELLULAR LOCATION, INTERACTION WITH STX18 AND RINT1, MUTAGENESIS OF LEU-114.
  8. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  9. "RNF185, a novel mitochondrial ubiquitin E3 ligase, regulates autophagy through interaction with BNIP1."
    Tang F., Wang B., Li N., Wu Y., Jia J., Suo T., Chen Q., Liu Y.J., Tang J.
    PLoS ONE 6:E24367-E24367(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION IN AUTOPHAGY, SUBCELLULAR LOCATION, UBIQUITINATION BY RNF185.

Entry informationi

Entry nameiSEC20_HUMAN
AccessioniPrimary (citable) accession number: Q12981
Secondary accession number(s): D3DQM3
, D3DQM4, D3DQM5, D3DQM6, O75622, O75623, O75624, Q6K044, Q96FG4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 15, 1999
Last sequence update: April 18, 2006
Last modified: October 29, 2014
This is version 123 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Miscellaneous

Silencing of BNIP1 disrupts ER morphology.

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3