Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q12968

- NFAC3_HUMAN

UniProt

Q12968 - NFAC3_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Nuclear factor of activated T-cells, cytoplasmic 3

Gene

NFATC3

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Acts as a regulator of transcriptional activation. Plays a role in the inducible expression of cytokine genes in T-cells, especially in the induction of the IL-2.1 Publication

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
DNA bindingi444 – 4518

GO - Molecular functioni

  1. chromatin binding Source: Ensembl
  2. RNA polymerase II core promoter proximal region sequence-specific DNA binding Source: NTNU_SB
  3. RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription Source: NTNU_SB

GO - Biological processi

  1. cellular respiration Source: Ensembl
  2. cellular response to calcium ion Source: Ensembl
  3. cellular response to lithium ion Source: Ensembl
  4. Fc-epsilon receptor signaling pathway Source: Reactome
  5. heart development Source: Ensembl
  6. inflammatory response Source: ProtInc
  7. innate immune response Source: Reactome
  8. muscle cell development Source: Ensembl
  9. patterning of blood vessels Source: Ensembl
  10. positive regulation of transcription from RNA polymerase II promoter Source: UniProtKB
  11. regulation of transcription from RNA polymerase II promoter Source: ProtInc
  12. smooth muscle cell differentiation Source: Ensembl
  13. transcription from RNA polymerase II promoter Source: ProtInc
Complete GO annotation...

Keywords - Molecular functioni

Activator

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding

Enzyme and pathway databases

ReactomeiREACT_163834. FCERI mediated Ca+2 mobilization.

Names & Taxonomyi

Protein namesi
Recommended name:
Nuclear factor of activated T-cells, cytoplasmic 3
Short name:
NF-ATc3
Short name:
NFATc3
Alternative name(s):
NFATx
T-cell transcription factor NFAT4
Short name:
NF-AT4
Gene namesi
Name:NFATC3
Synonyms:NFAT4
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 16

Organism-specific databases

HGNCiHGNC:7777. NFATC3.

Subcellular locationi

Cytoplasm 1 Publication. Nucleus 1 Publication
Note: Cytoplasmic for the phosphorylated form and nuclear after activation that is controlled by calcineurin-mediated dephosphorylation. Rapid nuclear exit of NFATC is thought to be one mechanism by which cells distinguish between sustained and transient calcium signals. The subcellular localization of NFATC plays a key role in the regulation of gene transcription.

GO - Cellular componenti

  1. cytoplasm Source: UniProtKB
  2. cytosol Source: Reactome
  3. nucleolus Source: HPA
  4. nucleoplasm Source: Reactome
  5. nucleus Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA247.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Initiator methioninei1 – 11Removed1 Publication
Chaini2 – 10751074Nuclear factor of activated T-cells, cytoplasmic 3PRO_0000205180Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei2 – 21N-acetylthreonine1 Publication

Post-translational modificationi

Phosphorylated by NFATC-kinase; dephosphorylated by calcineurin.By similarity

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

MaxQBiQ12968.
PaxDbiQ12968.
PRIDEiQ12968.

PTM databases

PhosphoSiteiQ12968.

Expressioni

Tissue specificityi

Isoform 1 is predominantly expressed in thymus and is also found in peripheral blood leukocytes and kidney. Isoform 2 is predominantly expressed in skeletal muscle and is also found in thymus, kidney, testis, spleen, prostate, ovary, small intestine, heart, placenta and pancreas. Isoform 3 is expressed in thymus and kidney. Isoform 4 is expressed in thymus and skeletal muscle.

Gene expression databases

BgeeiQ12968.
CleanExiHS_NFATC3.
ExpressionAtlasiQ12968. baseline and differential.
GenevestigatoriQ12968.

Organism-specific databases

HPAiCAB004514.
HPA023844.
HPA050665.

Interactioni

Subunit structurei

Member of the multicomponent NFATC transcription complex that consists of at least two components, a pre-existing cytoplasmic component NFATC2 and an inducible nuclear component NFATC1. Other members such as NFATC4, NFATC3 or members of the activating protein-1 family, MAF, GATA4 and Cbp/p300 can also bind the complex. NFATC proteins bind to DNA as monomers.

Binary interactionsi

WithEntry#Exp.IntActNotes
RAF1P040492EBI-5278441,EBI-365996

Protein-protein interaction databases

BioGridi110848. 7 interactions.
IntActiQ12968. 2 interactions.
STRINGi9606.ENSP00000300659.

Structurei

Secondary structure

1
1075
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Helixi146 – 1483Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2XRWX-ray1.33B141-154[»]
2XS0X-ray2.60B141-154[»]
ProteinModelPortaliQ12968.
SMRiQ12968. Positions 419-700.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Repeati207 – 223171Add
BLAST
Repeati236 – 252172Add
BLAST
Repeati292 – 308173Add
BLAST
Domaini415 – 596182RHDPROSITE-ProRule annotationAdd
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni109 – 1146Calcineurin-binding
Regioni207 – 3081023 X SP repeatsAdd
BLAST

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi273 – 2753Nuclear localization signal
Motifi686 – 6883Nuclear localization signal
Motifi1032 – 104110Nuclear export signal

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi24 – 296Poly-Pro

Domaini

Rel Similarity Domain (RSD) allows DNA-binding and cooperative interactions with AP1 factors.

Sequence similaritiesi

Contains 1 RHD (Rel-like) domain.PROSITE-ProRule annotation

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiNOG70055.
GeneTreeiENSGT00550000074562.
HOGENOMiHOG000231780.
HOVERGENiHBG069754.
InParanoidiQ12968.
KOiK17333.
OMAiHINDPER.
PhylomeDBiQ12968.
TreeFamiTF326480.

Family and domain databases

Gene3Di2.60.40.10. 1 hit.
2.60.40.340. 1 hit.
InterProiIPR013783. Ig-like_fold.
IPR014756. Ig_E-set.
IPR002909. IPT.
IPR008366. NFAT.
IPR008967. p53-like_TF_DNA-bd.
IPR011539. RHD.
[Graphical view]
PANTHERiPTHR12533. PTHR12533. 1 hit.
PfamiPF00554. RHD. 1 hit.
[Graphical view]
PRINTSiPR01789. NUCFACTORATC.
SMARTiSM00429. IPT. 1 hit.
[Graphical view]
SUPFAMiSSF49417. SSF49417. 1 hit.
SSF81296. SSF81296. 1 hit.
PROSITEiPS50254. REL_2. 1 hit.
[Graphical view]

Sequences (6)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 6 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q12968-1) [UniParc]FASTAAdd to Basket

Also known as: X1

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MTTANCGAHD ELDFKLVFGE DGAPAPPPPG SRPADLEPDD CASIYIFNVD
60 70 80 90 100
PPPSTLTTPL CLPHHGLPSH SSVLSPSFQL QSHKNYEGTC EIPESKYSPL
110 120 130 140 150
GGPKPFECPS IQITSISPNC HQELDAHEDD LQINDPEREF LERPSRDHLY
160 170 180 190 200
LPLEPSYRES SLSPSPASSI SSRSWFSDAS SCESLSHIYD DVDSELNEAA
210 220 230 240 250
ARFTLGSPLT SPGGSPGGCP GEETWHQQYG LGHSLSPRQS PCHSPRSSVT
260 270 280 290 300
DENWLSPRPA SGPSSRPTSP CGKRRHSSAE VCYAGSLSPH HSPVPSPGHS
310 320 330 340 350
PRGSVTEDTW LNASVHGGSG LGPAVFPFQY CVETDIPLKT RKTSEDQAAI
360 370 380 390 400
LPGKLELCSD DQGSLSPARE TSIDDGLGSQ YPLKKDSCGD QFLSVPSPFT
410 420 430 440 450
WSKPKPGHTP IFRTSSLPPL DWPLPAHFGQ CELKIEVQPK THHRAHYETE
460 470 480 490 500
GSRGAVKAST GGHPVVKLLG YNEKPINLQM FIGTADDRYL RPHAFYQVHR
510 520 530 540 550
ITGKTVATAS QEIIIASTKV LEIPLLPENN MSASIDCAGI LKLRNSDIEL
560 570 580 590 600
RKGETDIGRK NTRVRLVFRV HIPQPSGKVL SLQIASIPVE CSQRSAQELP
610 620 630 640 650
HIEKYSINSC SVNGGHEMVV TGSNFLPESK IIFLEKGQDG RPQWEVEGKI
660 670 680 690 700
IREKCQGAHI VLEVPPYHNP AVTAAVQVHF YLCNGKRKKS QSQRFTYTPV
710 720 730 740 750
LMKQEHREEI DLSSVPSLPV PHPAQTQRPS SDSGCSHDSV LSGQRSLICS
760 770 780 790 800
IPQTYASMVT SSHLPQLQCR DESVSKEQHM IPSPIVHQPF QVTPTPPVGS
810 820 830 840 850
SYQPMQTNVV YNGPTCLPIN AASSQEFDSV LFQQDATLSG LVNLGCQPLS
860 870 880 890 900
SIPFHSSNSG STGHLLAHTP HSVHTLPHLQ SMGYHCSNTG QRSLSSPVAD
910 920 930 940 950
QITGQPSSQL QPITYGPSHS GSATTASPAA SHPLASSPLS GPPSPQLQPM
960 970 980 990 1000
PYQSPSSGTA SSPSPATRMH SGQHSTQAQS TGQGGLSAPS SLICHSLCDP
1010 1020 1030 1040 1050
ASFPPDGATV SIKPEPEDRE PNFATIGLQD ITLDDVNEII GRDMSQISVS
1060 1070
QGAGVSRQAP LPSPESLDLG RSDGL
Length:1,075
Mass (Da):115,594
Last modified:November 1, 1996 - v1
Checksum:i0B25D61A2B56D898
GO
Isoform 2 (identifier: Q12968-2) [UniParc]FASTAAdd to Basket

Also known as: X2, C

The sequence of this isoform differs from the canonical sequence as follows:
     1036-1075: VNEIIGRDMSQISVSQGAGVSRQAPLPSPESLDLGRSDGL → DQFISDLEHQPSGSAEKWPNHSVLSCPAPFWRI

Show »
Length:1,068
Mass (Da):115,237
Checksum:iCD91817D06AD5D82
GO
Isoform 3 (identifier: Q12968-3) [UniParc]FASTAAdd to Basket

Also known as: X3

The sequence of this isoform differs from the canonical sequence as follows:
     1036-1075: VNEIIGRDMSQISVSQGAGVSRQAPLPSPESLDLGRSDGL → DLFTSNNFDLLQLRPTFWPVPAGRYLRNLE

Show »
Length:1,065
Mass (Da):115,050
Checksum:iB827F1D5CE01D033
GO
Isoform 4 (identifier: Q12968-4) [UniParc]FASTAAdd to Basket

Also known as: X4

The sequence of this isoform differs from the canonical sequence as follows:
     1036-1075: VNEIIGRDMSQISVSQGAGVSRQAPLPSPESLDLGRSDGL → GKFISDMFLK

Show »
Length:1,045
Mass (Da):112,642
Checksum:i44CE97FCF4A4EEAD
GO
Isoform 5 (identifier: Q12968-5) [UniParc]FASTAAdd to Basket

Also known as: A

The sequence of this isoform differs from the canonical sequence as follows:
     700-1075: VLMKQEHREE...SLDLGRSDGL → GTRSHDGLL

Show »
Length:708
Mass (Da):77,181
Checksum:iD96C59AEC592D0E0
GO
Isoform 6 (identifier: Q12968-6) [UniParc]FASTAAdd to Basket

Also known as: B

The sequence of this isoform differs from the canonical sequence as follows:
     717-1075: SLPVPHPAQT...SLDLGRSDGL → TLPQTSRQTLLGSQPPSASPPTV

Show »
Length:739
Mass (Da):80,582
Checksum:i8AB8BAFA1A319E50
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti702 – 7021M → L in AAB46595. (PubMed:9759864)Curated
Sequence conflicti702 – 7021M → L in AAB46596. (PubMed:9759864)Curated
Sequence conflicti702 – 7021M → L in AAB46597. (PubMed:9759864)Curated
Sequence conflicti831 – 8311L → W in AAB46595. (PubMed:9759864)Curated
Sequence conflicti831 – 8311L → W in AAB46596. (PubMed:9759864)Curated
Sequence conflicti831 – 8311L → W in AAB46597. (PubMed:9759864)Curated
Sequence conflicti899 – 8991A → G in AAB46595. (PubMed:9759864)Curated
Sequence conflicti899 – 8991A → G in AAB46596. (PubMed:9759864)Curated
Sequence conflicti899 – 8991A → G in AAB46597. (PubMed:9759864)Curated
Sequence conflicti923 – 9231A → V in AAB46595. (PubMed:9759864)Curated
Sequence conflicti923 – 9231A → V in AAB46596. (PubMed:9759864)Curated
Sequence conflicti923 – 9231A → V in AAB46597. (PubMed:9759864)Curated
Sequence conflicti935 – 9351A → G in AAB46595. (PubMed:9759864)Curated
Sequence conflicti935 – 9351A → G in AAB46596. (PubMed:9759864)Curated
Sequence conflicti935 – 9351A → G in AAB46597. (PubMed:9759864)Curated
Sequence conflicti947 – 9471L → F in AAB46595. (PubMed:9759864)Curated
Sequence conflicti947 – 9471L → F in AAB46596. (PubMed:9759864)Curated
Sequence conflicti947 – 9471L → F in AAB46597. (PubMed:9759864)Curated
Sequence conflicti960 – 9601A → G in AAB46595. (PubMed:9759864)Curated
Sequence conflicti960 – 9601A → G in AAB46596. (PubMed:9759864)Curated
Sequence conflicti960 – 9601A → G in AAB46597. (PubMed:9759864)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti75 – 751S → L.
Corresponds to variant rs2230092 [ dbSNP | Ensembl ].
VAR_051784
Natural varianti94 – 941E → A.
Corresponds to variant rs3743736 [ dbSNP | Ensembl ].
VAR_051785
Natural varianti100 – 1001L → S.
Corresponds to variant rs2230093 [ dbSNP | Ensembl ].
VAR_051786
Natural varianti136 – 1361P → L.
Corresponds to variant rs2230094 [ dbSNP | Ensembl ].
VAR_051787
Natural varianti382 – 3821P → S.
Corresponds to variant rs2230095 [ dbSNP | Ensembl ].
VAR_051788

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei700 – 1075376VLMKQ…RSDGL → GTRSHDGLL in isoform 5. 1 PublicationVSP_005598Add
BLAST
Alternative sequencei717 – 1075359SLPVP…RSDGL → TLPQTSRQTLLGSQPPSASP PTV in isoform 6. 1 PublicationVSP_005599Add
BLAST
Alternative sequencei1036 – 107540VNEII…RSDGL → DQFISDLEHQPSGSAEKWPN HSVLSCPAPFWRI in isoform 2. 2 PublicationsVSP_005600Add
BLAST
Alternative sequencei1036 – 107540VNEII…RSDGL → DLFTSNNFDLLQLRPTFWPV PAGRYLRNLE in isoform 3. 1 PublicationVSP_005601Add
BLAST
Alternative sequencei1036 – 107540VNEII…RSDGL → GKFISDMFLK in isoform 4. 1 PublicationVSP_005602Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L41067 mRNA. Translation: AAA79174.1.
U14510 mRNA. Translation: AAA86308.1.
U85428 mRNA. Translation: AAB46595.1.
U85429 mRNA. Translation: AAB46596.1.
U85430 mRNA. Translation: AAB46597.1.
AC130462 Genomic DNA. No translation available.
BC001050 mRNA. Translation: AAH01050.1.
CCDSiCCDS10860.1. [Q12968-1]
CCDS10861.1. [Q12968-3]
CCDS10862.1. [Q12968-2]
PIRiA57377.
RefSeqiNP_004546.1. NM_004555.3. [Q12968-2]
NP_775186.1. NM_173163.2. [Q12968-3]
NP_775188.1. NM_173165.2. [Q12968-1]
UniGeneiHs.436585.

Genome annotation databases

EnsembliENST00000329524; ENSP00000331324; ENSG00000072736. [Q12968-2]
ENST00000346183; ENSP00000300659; ENSG00000072736. [Q12968-1]
ENST00000349223; ENSP00000264008; ENSG00000072736. [Q12968-3]
GeneIDi4775.
KEGGihsa:4775.
UCSCiuc002evn.2. human. [Q12968-3]
uc002evo.2. human. [Q12968-1]

Polymorphism databases

DMDMi9087155.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L41067 mRNA. Translation: AAA79174.1 .
U14510 mRNA. Translation: AAA86308.1 .
U85428 mRNA. Translation: AAB46595.1 .
U85429 mRNA. Translation: AAB46596.1 .
U85430 mRNA. Translation: AAB46597.1 .
AC130462 Genomic DNA. No translation available.
BC001050 mRNA. Translation: AAH01050.1 .
CCDSi CCDS10860.1. [Q12968-1 ]
CCDS10861.1. [Q12968-3 ]
CCDS10862.1. [Q12968-2 ]
PIRi A57377.
RefSeqi NP_004546.1. NM_004555.3. [Q12968-2 ]
NP_775186.1. NM_173163.2. [Q12968-3 ]
NP_775188.1. NM_173165.2. [Q12968-1 ]
UniGenei Hs.436585.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
2XRW X-ray 1.33 B 141-154 [» ]
2XS0 X-ray 2.60 B 141-154 [» ]
ProteinModelPortali Q12968.
SMRi Q12968. Positions 419-700.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 110848. 7 interactions.
IntActi Q12968. 2 interactions.
STRINGi 9606.ENSP00000300659.

PTM databases

PhosphoSitei Q12968.

Polymorphism databases

DMDMi 9087155.

Proteomic databases

MaxQBi Q12968.
PaxDbi Q12968.
PRIDEi Q12968.

Protocols and materials databases

DNASUi 4775.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000329524 ; ENSP00000331324 ; ENSG00000072736 . [Q12968-2 ]
ENST00000346183 ; ENSP00000300659 ; ENSG00000072736 . [Q12968-1 ]
ENST00000349223 ; ENSP00000264008 ; ENSG00000072736 . [Q12968-3 ]
GeneIDi 4775.
KEGGi hsa:4775.
UCSCi uc002evn.2. human. [Q12968-3 ]
uc002evo.2. human. [Q12968-1 ]

Organism-specific databases

CTDi 4775.
GeneCardsi GC16P068119.
HGNCi HGNC:7777. NFATC3.
HPAi CAB004514.
HPA023844.
HPA050665.
MIMi 602698. gene.
neXtProti NX_Q12968.
PharmGKBi PA247.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG70055.
GeneTreei ENSGT00550000074562.
HOGENOMi HOG000231780.
HOVERGENi HBG069754.
InParanoidi Q12968.
KOi K17333.
OMAi HINDPER.
PhylomeDBi Q12968.
TreeFami TF326480.

Enzyme and pathway databases

Reactomei REACT_163834. FCERI mediated Ca+2 mobilization.

Miscellaneous databases

ChiTaRSi NFATC3. human.
GeneWikii NFATC3.
GenomeRNAii 4775.
NextBioi 18410.
PROi Q12968.
SOURCEi Search...

Gene expression databases

Bgeei Q12968.
CleanExi HS_NFATC3.
ExpressionAtlasi Q12968. baseline and differential.
Genevestigatori Q12968.

Family and domain databases

Gene3Di 2.60.40.10. 1 hit.
2.60.40.340. 1 hit.
InterProi IPR013783. Ig-like_fold.
IPR014756. Ig_E-set.
IPR002909. IPT.
IPR008366. NFAT.
IPR008967. p53-like_TF_DNA-bd.
IPR011539. RHD.
[Graphical view ]
PANTHERi PTHR12533. PTHR12533. 1 hit.
Pfami PF00554. RHD. 1 hit.
[Graphical view ]
PRINTSi PR01789. NUCFACTORATC.
SMARTi SM00429. IPT. 1 hit.
[Graphical view ]
SUPFAMi SSF49417. SSF49417. 1 hit.
SSF81296. SSF81296. 1 hit.
PROSITEi PS50254. REL_2. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Isolation of two new members of the NF-AT gene family and functional characterization of the NF-AT proteins."
    Hoey T., Sun Y.-L., Williamson K., Xu X.
    Immunity 2:461-472(1995) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2; 5 AND 6).
    Tissue: Skeletal muscle and T-cell.
  2. "NFATx, a novel member of the nuclear factor of activated T cells family that is expressed predominantly in the thymus."
    Masuda E.S., Naito Y., Tokumitsu H., Campbell D., Saito F., Hannum C., Arai K., Arai N.
    Mol. Cell. Biol. 15:2697-2706(1995) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: T-cell.
  3. "Carboxy-terminal 15 amino acids sequence of NFATx1 is possibly created by tissue-specific splicing and is essential for transactivation activity in T cells."
    Imamura R., Masuda E.S., Naito Y., Imai S., Fujino T., Takano T., Arai K., Arai N.
    J. Immunol. 161:3455-3463(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2; 3 AND 4).
    Tissue: Fibroblast and T-cell.
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA] (ISOFORM 4).
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Kidney.
  6. Bienvenut W.V., Waridel P., Quadroni M.
    Submitted (MAR-2009) to UniProtKB
    Cited for: PROTEIN SEQUENCE OF 2-15; 468-488; 505-519 AND 579-594, CLEAVAGE OF INITIATOR METHIONINE, ACETYLATION AT THR-2, IDENTIFICATION BY MASS SPECTROMETRY.
    Tissue: Embryonic kidney.
  7. "Intramolecular masking of nuclear import signal on NF-AT4 by casein kinase I and MEKK1."
    Zhu J., Shibasaki F., Price R., Guillemot J.-C., Yano T., Doetsch V., Wagner G., Ferrara P., McKeon F.
    Cell 93:851-861(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: MUTAGENESIS.
  8. "Generic signals and specific outcomes: signaling through Ca2+, calcineurin, and NF-AT."
    Crabtree G.R.
    Cell 96:611-614(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: REVIEW.
  9. "CHP2 activates the calcineurin/nuclear factor of activated T cells signaling pathway and enhances the oncogenic potential of HEK293 cells."
    Li G.D., Zhang X., Li R., Wang Y.D., Wang Y.L., Han K.J., Qian X.P., Yang C.G., Liu P., Wei Q., Chen W.F., Zhang J., Zhang Y.
    J. Biol. Chem. 283:32660-32668(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, SUBCELLULAR LOCATION.

Entry informationi

Entry nameiNFAC3_HUMAN
AccessioniPrimary (citable) accession number: Q12968
Secondary accession number(s): O75211
, Q14516, Q99840, Q99841, Q99842
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 1, 2000
Last sequence update: November 1, 1996
Last modified: November 26, 2014
This is version 149 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3