Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q12968

- NFAC3_HUMAN

UniProt

Q12968 - NFAC3_HUMAN

Protein

Nuclear factor of activated T-cells, cytoplasmic 3

Gene

NFATC3

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 147 (01 Oct 2014)
      Sequence version 1 (01 Nov 1996)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Acts as a regulator of transcriptional activation. Plays a role in the inducible expression of cytokine genes in T-cells, especially in the induction of the IL-2.1 Publication

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    DNA bindingi444 – 4518

    GO - Molecular functioni

    1. chromatin binding Source: Ensembl
    2. protein binding Source: IntAct
    3. RNA polymerase II core promoter proximal region sequence-specific DNA binding Source: NTNU_SB
    4. RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription Source: NTNU_SB

    GO - Biological processi

    1. cellular respiration Source: Ensembl
    2. cellular response to lithium ion Source: Ensembl
    3. Fc-epsilon receptor signaling pathway Source: Reactome
    4. heart development Source: Ensembl
    5. inflammatory response Source: ProtInc
    6. innate immune response Source: Reactome
    7. muscle cell development Source: Ensembl
    8. patterning of blood vessels Source: Ensembl
    9. positive regulation of transcription from RNA polymerase II promoter Source: UniProtKB
    10. regulation of transcription from RNA polymerase II promoter Source: ProtInc
    11. smooth muscle cell differentiation Source: Ensembl
    12. transcription from RNA polymerase II promoter Source: ProtInc

    Keywords - Molecular functioni

    Activator

    Keywords - Biological processi

    Transcription, Transcription regulation

    Keywords - Ligandi

    DNA-binding

    Enzyme and pathway databases

    ReactomeiREACT_163834. FCERI mediated Ca+2 mobilization.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Nuclear factor of activated T-cells, cytoplasmic 3
    Short name:
    NF-ATc3
    Short name:
    NFATc3
    Alternative name(s):
    NFATx
    T-cell transcription factor NFAT4
    Short name:
    NF-AT4
    Gene namesi
    Name:NFATC3
    Synonyms:NFAT4
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 16

    Organism-specific databases

    HGNCiHGNC:7777. NFATC3.

    Subcellular locationi

    Cytoplasm 1 Publication. Nucleus 1 Publication
    Note: Cytoplasmic for the phosphorylated form and nuclear after activation that is controlled by calcineurin-mediated dephosphorylation. Rapid nuclear exit of NFATC is thought to be one mechanism by which cells distinguish between sustained and transient calcium signals. The subcellular localization of NFATC plays a key role in the regulation of gene transcription.

    GO - Cellular componenti

    1. cytoplasm Source: UniProtKB
    2. cytosol Source: Reactome
    3. nucleolus Source: HPA
    4. nucleoplasm Source: Reactome
    5. nucleus Source: UniProtKB

    Keywords - Cellular componenti

    Cytoplasm, Nucleus

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA247.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Initiator methioninei1 – 11Removed1 Publication
    Chaini2 – 10751074Nuclear factor of activated T-cells, cytoplasmic 3PRO_0000205180Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei2 – 21N-acetylthreonine1 Publication

    Post-translational modificationi

    Phosphorylated by NFATC-kinase; dephosphorylated by calcineurin.By similarity

    Keywords - PTMi

    Acetylation, Phosphoprotein

    Proteomic databases

    MaxQBiQ12968.
    PaxDbiQ12968.
    PRIDEiQ12968.

    PTM databases

    PhosphoSiteiQ12968.

    Expressioni

    Tissue specificityi

    Isoform 1 is predominantly expressed in thymus and is also found in peripheral blood leukocytes and kidney. Isoform 2 is predominantly expressed in skeletal muscle and is also found in thymus, kidney, testis, spleen, prostate, ovary, small intestine, heart, placenta and pancreas. Isoform 3 is expressed in thymus and kidney. Isoform 4 is expressed in thymus and skeletal muscle.

    Gene expression databases

    ArrayExpressiQ12968.
    BgeeiQ12968.
    CleanExiHS_NFATC3.
    GenevestigatoriQ12968.

    Organism-specific databases

    HPAiCAB004514.
    HPA023844.
    HPA050665.

    Interactioni

    Subunit structurei

    Member of the multicomponent NFATC transcription complex that consists of at least two components, a pre-existing cytoplasmic component NFATC2 and an inducible nuclear component NFATC1. Other members such as NFATC4, NFATC3 or members of the activating protein-1 family, MAF, GATA4 and Cbp/p300 can also bind the complex. NFATC proteins bind to DNA as monomers.

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    RAF1P040492EBI-5278441,EBI-365996

    Protein-protein interaction databases

    BioGridi110848. 5 interactions.
    IntActiQ12968. 2 interactions.
    STRINGi9606.ENSP00000300659.

    Structurei

    Secondary structure

    1
    1075
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Helixi146 – 1483

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    2XRWX-ray1.33B141-154[»]
    2XS0X-ray2.60B141-154[»]
    ProteinModelPortaliQ12968.
    SMRiQ12968. Positions 419-700.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Repeati207 – 223171Add
    BLAST
    Repeati236 – 252172Add
    BLAST
    Repeati292 – 308173Add
    BLAST
    Domaini415 – 596182RHDPROSITE-ProRule annotationAdd
    BLAST

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni109 – 1146Calcineurin-binding
    Regioni207 – 3081023 X SP repeatsAdd
    BLAST

    Motif

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Motifi273 – 2753Nuclear localization signal
    Motifi686 – 6883Nuclear localization signal
    Motifi1032 – 104110Nuclear export signal

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi24 – 296Poly-Pro

    Domaini

    Rel Similarity Domain (RSD) allows DNA-binding and cooperative interactions with AP1 factors.

    Sequence similaritiesi

    Contains 1 RHD (Rel-like) domain.PROSITE-ProRule annotation

    Keywords - Domaini

    Repeat

    Phylogenomic databases

    eggNOGiNOG70055.
    HOGENOMiHOG000231780.
    HOVERGENiHBG069754.
    InParanoidiQ12968.
    KOiK17333.
    OMAiHINDPER.
    PhylomeDBiQ12968.
    TreeFamiTF326480.

    Family and domain databases

    Gene3Di2.60.40.10. 1 hit.
    2.60.40.340. 1 hit.
    InterProiIPR013783. Ig-like_fold.
    IPR014756. Ig_E-set.
    IPR002909. IPT.
    IPR008366. NFAT.
    IPR008967. p53-like_TF_DNA-bd.
    IPR011539. RHD.
    [Graphical view]
    PANTHERiPTHR12533. PTHR12533. 1 hit.
    PfamiPF00554. RHD. 1 hit.
    [Graphical view]
    PRINTSiPR01789. NUCFACTORATC.
    SMARTiSM00429. IPT. 1 hit.
    [Graphical view]
    SUPFAMiSSF49417. SSF49417. 1 hit.
    SSF81296. SSF81296. 1 hit.
    PROSITEiPS50254. REL_2. 1 hit.
    [Graphical view]

    Sequences (6)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 6 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q12968-1) [UniParc]FASTAAdd to Basket

    Also known as: X1

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MTTANCGAHD ELDFKLVFGE DGAPAPPPPG SRPADLEPDD CASIYIFNVD     50
    PPPSTLTTPL CLPHHGLPSH SSVLSPSFQL QSHKNYEGTC EIPESKYSPL 100
    GGPKPFECPS IQITSISPNC HQELDAHEDD LQINDPEREF LERPSRDHLY 150
    LPLEPSYRES SLSPSPASSI SSRSWFSDAS SCESLSHIYD DVDSELNEAA 200
    ARFTLGSPLT SPGGSPGGCP GEETWHQQYG LGHSLSPRQS PCHSPRSSVT 250
    DENWLSPRPA SGPSSRPTSP CGKRRHSSAE VCYAGSLSPH HSPVPSPGHS 300
    PRGSVTEDTW LNASVHGGSG LGPAVFPFQY CVETDIPLKT RKTSEDQAAI 350
    LPGKLELCSD DQGSLSPARE TSIDDGLGSQ YPLKKDSCGD QFLSVPSPFT 400
    WSKPKPGHTP IFRTSSLPPL DWPLPAHFGQ CELKIEVQPK THHRAHYETE 450
    GSRGAVKAST GGHPVVKLLG YNEKPINLQM FIGTADDRYL RPHAFYQVHR 500
    ITGKTVATAS QEIIIASTKV LEIPLLPENN MSASIDCAGI LKLRNSDIEL 550
    RKGETDIGRK NTRVRLVFRV HIPQPSGKVL SLQIASIPVE CSQRSAQELP 600
    HIEKYSINSC SVNGGHEMVV TGSNFLPESK IIFLEKGQDG RPQWEVEGKI 650
    IREKCQGAHI VLEVPPYHNP AVTAAVQVHF YLCNGKRKKS QSQRFTYTPV 700
    LMKQEHREEI DLSSVPSLPV PHPAQTQRPS SDSGCSHDSV LSGQRSLICS 750
    IPQTYASMVT SSHLPQLQCR DESVSKEQHM IPSPIVHQPF QVTPTPPVGS 800
    SYQPMQTNVV YNGPTCLPIN AASSQEFDSV LFQQDATLSG LVNLGCQPLS 850
    SIPFHSSNSG STGHLLAHTP HSVHTLPHLQ SMGYHCSNTG QRSLSSPVAD 900
    QITGQPSSQL QPITYGPSHS GSATTASPAA SHPLASSPLS GPPSPQLQPM 950
    PYQSPSSGTA SSPSPATRMH SGQHSTQAQS TGQGGLSAPS SLICHSLCDP 1000
    ASFPPDGATV SIKPEPEDRE PNFATIGLQD ITLDDVNEII GRDMSQISVS 1050
    QGAGVSRQAP LPSPESLDLG RSDGL 1075
    Length:1,075
    Mass (Da):115,594
    Last modified:November 1, 1996 - v1
    Checksum:i0B25D61A2B56D898
    GO
    Isoform 2 (identifier: Q12968-2) [UniParc]FASTAAdd to Basket

    Also known as: X2, C

    The sequence of this isoform differs from the canonical sequence as follows:
         1036-1075: VNEIIGRDMSQISVSQGAGVSRQAPLPSPESLDLGRSDGL → DQFISDLEHQPSGSAEKWPNHSVLSCPAPFWRI

    Show »
    Length:1,068
    Mass (Da):115,237
    Checksum:iCD91817D06AD5D82
    GO
    Isoform 3 (identifier: Q12968-3) [UniParc]FASTAAdd to Basket

    Also known as: X3

    The sequence of this isoform differs from the canonical sequence as follows:
         1036-1075: VNEIIGRDMSQISVSQGAGVSRQAPLPSPESLDLGRSDGL → DLFTSNNFDLLQLRPTFWPVPAGRYLRNLE

    Show »
    Length:1,065
    Mass (Da):115,050
    Checksum:iB827F1D5CE01D033
    GO
    Isoform 4 (identifier: Q12968-4) [UniParc]FASTAAdd to Basket

    Also known as: X4

    The sequence of this isoform differs from the canonical sequence as follows:
         1036-1075: VNEIIGRDMSQISVSQGAGVSRQAPLPSPESLDLGRSDGL → GKFISDMFLK

    Show »
    Length:1,045
    Mass (Da):112,642
    Checksum:i44CE97FCF4A4EEAD
    GO
    Isoform 5 (identifier: Q12968-5) [UniParc]FASTAAdd to Basket

    Also known as: A

    The sequence of this isoform differs from the canonical sequence as follows:
         700-1075: VLMKQEHREE...SLDLGRSDGL → GTRSHDGLL

    Show »
    Length:708
    Mass (Da):77,181
    Checksum:iD96C59AEC592D0E0
    GO
    Isoform 6 (identifier: Q12968-6) [UniParc]FASTAAdd to Basket

    Also known as: B

    The sequence of this isoform differs from the canonical sequence as follows:
         717-1075: SLPVPHPAQT...SLDLGRSDGL → TLPQTSRQTLLGSQPPSASPPTV

    Show »
    Length:739
    Mass (Da):80,582
    Checksum:i8AB8BAFA1A319E50
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti702 – 7021M → L in AAB46595. (PubMed:9759864)Curated
    Sequence conflicti702 – 7021M → L in AAB46596. (PubMed:9759864)Curated
    Sequence conflicti702 – 7021M → L in AAB46597. (PubMed:9759864)Curated
    Sequence conflicti831 – 8311L → W in AAB46595. (PubMed:9759864)Curated
    Sequence conflicti831 – 8311L → W in AAB46596. (PubMed:9759864)Curated
    Sequence conflicti831 – 8311L → W in AAB46597. (PubMed:9759864)Curated
    Sequence conflicti899 – 8991A → G in AAB46595. (PubMed:9759864)Curated
    Sequence conflicti899 – 8991A → G in AAB46596. (PubMed:9759864)Curated
    Sequence conflicti899 – 8991A → G in AAB46597. (PubMed:9759864)Curated
    Sequence conflicti923 – 9231A → V in AAB46595. (PubMed:9759864)Curated
    Sequence conflicti923 – 9231A → V in AAB46596. (PubMed:9759864)Curated
    Sequence conflicti923 – 9231A → V in AAB46597. (PubMed:9759864)Curated
    Sequence conflicti935 – 9351A → G in AAB46595. (PubMed:9759864)Curated
    Sequence conflicti935 – 9351A → G in AAB46596. (PubMed:9759864)Curated
    Sequence conflicti935 – 9351A → G in AAB46597. (PubMed:9759864)Curated
    Sequence conflicti947 – 9471L → F in AAB46595. (PubMed:9759864)Curated
    Sequence conflicti947 – 9471L → F in AAB46596. (PubMed:9759864)Curated
    Sequence conflicti947 – 9471L → F in AAB46597. (PubMed:9759864)Curated
    Sequence conflicti960 – 9601A → G in AAB46595. (PubMed:9759864)Curated
    Sequence conflicti960 – 9601A → G in AAB46596. (PubMed:9759864)Curated
    Sequence conflicti960 – 9601A → G in AAB46597. (PubMed:9759864)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti75 – 751S → L.
    Corresponds to variant rs2230092 [ dbSNP | Ensembl ].
    VAR_051784
    Natural varianti94 – 941E → A.
    Corresponds to variant rs3743736 [ dbSNP | Ensembl ].
    VAR_051785
    Natural varianti100 – 1001L → S.
    Corresponds to variant rs2230093 [ dbSNP | Ensembl ].
    VAR_051786
    Natural varianti136 – 1361P → L.
    Corresponds to variant rs2230094 [ dbSNP | Ensembl ].
    VAR_051787
    Natural varianti382 – 3821P → S.
    Corresponds to variant rs2230095 [ dbSNP | Ensembl ].
    VAR_051788

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei700 – 1075376VLMKQ…RSDGL → GTRSHDGLL in isoform 5. 1 PublicationVSP_005598Add
    BLAST
    Alternative sequencei717 – 1075359SLPVP…RSDGL → TLPQTSRQTLLGSQPPSASP PTV in isoform 6. 1 PublicationVSP_005599Add
    BLAST
    Alternative sequencei1036 – 107540VNEII…RSDGL → DQFISDLEHQPSGSAEKWPN HSVLSCPAPFWRI in isoform 2. 2 PublicationsVSP_005600Add
    BLAST
    Alternative sequencei1036 – 107540VNEII…RSDGL → DLFTSNNFDLLQLRPTFWPV PAGRYLRNLE in isoform 3. 1 PublicationVSP_005601Add
    BLAST
    Alternative sequencei1036 – 107540VNEII…RSDGL → GKFISDMFLK in isoform 4. 1 PublicationVSP_005602Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    L41067 mRNA. Translation: AAA79174.1.
    U14510 mRNA. Translation: AAA86308.1.
    U85428 mRNA. Translation: AAB46595.1.
    U85429 mRNA. Translation: AAB46596.1.
    U85430 mRNA. Translation: AAB46597.1.
    AC130462 Genomic DNA. No translation available.
    BC001050 mRNA. Translation: AAH01050.1.
    CCDSiCCDS10860.1. [Q12968-1]
    CCDS10861.1. [Q12968-3]
    CCDS10862.1. [Q12968-2]
    PIRiA57377.
    RefSeqiNP_004546.1. NM_004555.3. [Q12968-2]
    NP_775186.1. NM_173163.2. [Q12968-3]
    NP_775188.1. NM_173165.2. [Q12968-1]
    UniGeneiHs.436585.

    Genome annotation databases

    EnsembliENST00000329524; ENSP00000331324; ENSG00000072736. [Q12968-2]
    ENST00000346183; ENSP00000300659; ENSG00000072736. [Q12968-1]
    ENST00000349223; ENSP00000264008; ENSG00000072736. [Q12968-3]
    GeneIDi4775.
    KEGGihsa:4775.
    UCSCiuc002evn.2. human. [Q12968-3]
    uc002evo.2. human. [Q12968-1]

    Polymorphism databases

    DMDMi9087155.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    L41067 mRNA. Translation: AAA79174.1 .
    U14510 mRNA. Translation: AAA86308.1 .
    U85428 mRNA. Translation: AAB46595.1 .
    U85429 mRNA. Translation: AAB46596.1 .
    U85430 mRNA. Translation: AAB46597.1 .
    AC130462 Genomic DNA. No translation available.
    BC001050 mRNA. Translation: AAH01050.1 .
    CCDSi CCDS10860.1. [Q12968-1 ]
    CCDS10861.1. [Q12968-3 ]
    CCDS10862.1. [Q12968-2 ]
    PIRi A57377.
    RefSeqi NP_004546.1. NM_004555.3. [Q12968-2 ]
    NP_775186.1. NM_173163.2. [Q12968-3 ]
    NP_775188.1. NM_173165.2. [Q12968-1 ]
    UniGenei Hs.436585.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    2XRW X-ray 1.33 B 141-154 [» ]
    2XS0 X-ray 2.60 B 141-154 [» ]
    ProteinModelPortali Q12968.
    SMRi Q12968. Positions 419-700.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 110848. 5 interactions.
    IntActi Q12968. 2 interactions.
    STRINGi 9606.ENSP00000300659.

    PTM databases

    PhosphoSitei Q12968.

    Polymorphism databases

    DMDMi 9087155.

    Proteomic databases

    MaxQBi Q12968.
    PaxDbi Q12968.
    PRIDEi Q12968.

    Protocols and materials databases

    DNASUi 4775.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000329524 ; ENSP00000331324 ; ENSG00000072736 . [Q12968-2 ]
    ENST00000346183 ; ENSP00000300659 ; ENSG00000072736 . [Q12968-1 ]
    ENST00000349223 ; ENSP00000264008 ; ENSG00000072736 . [Q12968-3 ]
    GeneIDi 4775.
    KEGGi hsa:4775.
    UCSCi uc002evn.2. human. [Q12968-3 ]
    uc002evo.2. human. [Q12968-1 ]

    Organism-specific databases

    CTDi 4775.
    GeneCardsi GC16P068119.
    HGNCi HGNC:7777. NFATC3.
    HPAi CAB004514.
    HPA023844.
    HPA050665.
    MIMi 602698. gene.
    neXtProti NX_Q12968.
    PharmGKBi PA247.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG70055.
    HOGENOMi HOG000231780.
    HOVERGENi HBG069754.
    InParanoidi Q12968.
    KOi K17333.
    OMAi HINDPER.
    PhylomeDBi Q12968.
    TreeFami TF326480.

    Enzyme and pathway databases

    Reactomei REACT_163834. FCERI mediated Ca+2 mobilization.

    Miscellaneous databases

    ChiTaRSi NFATC3. human.
    GeneWikii NFATC3.
    GenomeRNAii 4775.
    NextBioi 18410.
    PROi Q12968.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q12968.
    Bgeei Q12968.
    CleanExi HS_NFATC3.
    Genevestigatori Q12968.

    Family and domain databases

    Gene3Di 2.60.40.10. 1 hit.
    2.60.40.340. 1 hit.
    InterProi IPR013783. Ig-like_fold.
    IPR014756. Ig_E-set.
    IPR002909. IPT.
    IPR008366. NFAT.
    IPR008967. p53-like_TF_DNA-bd.
    IPR011539. RHD.
    [Graphical view ]
    PANTHERi PTHR12533. PTHR12533. 1 hit.
    Pfami PF00554. RHD. 1 hit.
    [Graphical view ]
    PRINTSi PR01789. NUCFACTORATC.
    SMARTi SM00429. IPT. 1 hit.
    [Graphical view ]
    SUPFAMi SSF49417. SSF49417. 1 hit.
    SSF81296. SSF81296. 1 hit.
    PROSITEi PS50254. REL_2. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Isolation of two new members of the NF-AT gene family and functional characterization of the NF-AT proteins."
      Hoey T., Sun Y.-L., Williamson K., Xu X.
      Immunity 2:461-472(1995) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2; 5 AND 6).
      Tissue: Skeletal muscle and T-cell.
    2. "NFATx, a novel member of the nuclear factor of activated T cells family that is expressed predominantly in the thymus."
      Masuda E.S., Naito Y., Tokumitsu H., Campbell D., Saito F., Hannum C., Arai K., Arai N.
      Mol. Cell. Biol. 15:2697-2706(1995) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
      Tissue: T-cell.
    3. "Carboxy-terminal 15 amino acids sequence of NFATx1 is possibly created by tissue-specific splicing and is essential for transactivation activity in T cells."
      Imamura R., Masuda E.S., Naito Y., Imai S., Fujino T., Takano T., Arai K., Arai N.
      J. Immunol. 161:3455-3463(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2; 3 AND 4).
      Tissue: Fibroblast and T-cell.
    4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA] (ISOFORM 4).
    5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Kidney.
    6. Bienvenut W.V., Waridel P., Quadroni M.
      Submitted (MAR-2009) to UniProtKB
      Cited for: PROTEIN SEQUENCE OF 2-15; 468-488; 505-519 AND 579-594, CLEAVAGE OF INITIATOR METHIONINE, ACETYLATION AT THR-2, IDENTIFICATION BY MASS SPECTROMETRY.
      Tissue: Embryonic kidney.
    7. "Intramolecular masking of nuclear import signal on NF-AT4 by casein kinase I and MEKK1."
      Zhu J., Shibasaki F., Price R., Guillemot J.-C., Yano T., Doetsch V., Wagner G., Ferrara P., McKeon F.
      Cell 93:851-861(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: MUTAGENESIS.
    8. "Generic signals and specific outcomes: signaling through Ca2+, calcineurin, and NF-AT."
      Crabtree G.R.
      Cell 96:611-614(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: REVIEW.
    9. "CHP2 activates the calcineurin/nuclear factor of activated T cells signaling pathway and enhances the oncogenic potential of HEK293 cells."
      Li G.D., Zhang X., Li R., Wang Y.D., Wang Y.L., Han K.J., Qian X.P., Yang C.G., Liu P., Wei Q., Chen W.F., Zhang J., Zhang Y.
      J. Biol. Chem. 283:32660-32668(2008) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, SUBCELLULAR LOCATION.

    Entry informationi

    Entry nameiNFAC3_HUMAN
    AccessioniPrimary (citable) accession number: Q12968
    Secondary accession number(s): O75211
    , Q14516, Q99840, Q99841, Q99842
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: December 1, 2000
    Last sequence update: November 1, 1996
    Last modified: October 1, 2014
    This is version 147 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

    Documents

    1. Human chromosome 16
      Human chromosome 16: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    6. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3