Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Ral guanine nucleotide dissociation stimulator

Gene

RALGDS

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Stimulates the dissociation of GDP from the Ras-related RalA and RalB GTPases which allows GTP binding and activation of the GTPases. Interacts and acts as an effector molecule for R-Ras, H-Ras, K-Ras, and Rap.

GO - Molecular functioni

  • GTPase regulator activity Source: UniProtKB
  • guanyl-nucleotide exchange factor activity Source: UniProtKB-KW

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Guanine-nucleotide releasing factor

Enzyme and pathway databases

ReactomeiR-HSA-171007. p38MAPK events.

Names & Taxonomyi

Protein namesi
Recommended name:
Ral guanine nucleotide dissociation stimulator
Short name:
RalGDS
Alternative name(s):
Ral guanine nucleotide exchange factor
Short name:
RalGEF
Gene namesi
Name:RALGDS
Synonyms:KIAA1308, RGF
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 9

Organism-specific databases

HGNCiHGNC:9842. RALGDS.

Subcellular locationi

GO - Cellular componenti

  • brush border Source: UniProtKB
  • cytosol Source: UniProtKB
  • nucleus Source: UniProtKB
Complete GO annotation...

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA34200.

Polymorphism and mutation databases

DMDMi14549162.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 914914Ral guanine nucleotide dissociation stimulatorPRO_0000068877Add
BLAST

Proteomic databases

EPDiQ12967.
MaxQBiQ12967.
PaxDbiQ12967.
PRIDEiQ12967.

PTM databases

iPTMnetiQ12967.
PhosphoSiteiQ12967.

Expressioni

Gene expression databases

BgeeiQ12967.
CleanExiHS_RALGDS.
ExpressionAtlasiQ12967. baseline and differential.
GenevisibleiQ12967. HS.

Organism-specific databases

HPAiCAB032582.
HPA025961.

Interactioni

Subunit structurei

Interacts with RIT1 and RIT2.By similarity

Binary interactionsi

WithEntry#Exp.IntActNotes
HRASP011122EBI-365861,EBI-350145
RAP1BP612242EBI-365861,EBI-358143

Protein-protein interaction databases

BioGridi111836. 22 interactions.
DIPiDIP-31375N.
IntActiQ12967. 13 interactions.
MINTiMINT-3026888.
STRINGi9606.ENSP00000361120.

Structurei

Secondary structure

1
914
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi791 – 7933Combined sources
Beta strandi795 – 7973Combined sources
Beta strandi799 – 8079Combined sources
Beta strandi809 – 82012Combined sources
Helixi825 – 83511Combined sources
Turni836 – 8394Combined sources
Helixi843 – 8453Combined sources
Beta strandi846 – 8538Combined sources
Beta strandi856 – 8594Combined sources
Beta strandi862 – 8643Combined sources
Helixi866 – 8694Combined sources
Beta strandi877 – 8826Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
1RAXNMR-A775-886[»]
2B3ANMR-A798-884[»]
2RGFNMR-A788-884[»]
3KH0X-ray2.10A/B793-914[»]
ProteinModelPortaliQ12967.
SMRiQ12967. Positions 382-648, 793-885.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ12967.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini112 – 249138N-terminal Ras-GEFPROSITE-ProRule annotationAdd
BLAST
Domaini386 – 648263Ras-GEFPROSITE-ProRule annotationAdd
BLAST
Domaini798 – 88588Ras-associatingPROSITE-ProRule annotationAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi714 – 7174Poly-Ser
Compositional biasi753 – 76513Poly-SerAdd
BLAST
Compositional biasi839 – 8446Poly-Glu

Domaini

The Ras-associating domain interacts with Ras.

Sequence similaritiesi

Contains 1 N-terminal Ras-GEF domain.PROSITE-ProRule annotation
Contains 1 Ras-associating domain.PROSITE-ProRule annotation
Contains 1 Ras-GEF domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiKOG3629. Eukaryota.
ENOG410ZUT5. LUCA.
GeneTreeiENSGT00810000125349.
HOGENOMiHOG000231592.
HOVERGENiHBG005864.
InParanoidiQ12967.
KOiK08732.
OMAiCKVRTIK.
OrthoDBiEOG76DTRS.
PhylomeDBiQ12967.
TreeFamiTF315204.

Family and domain databases

Gene3Di1.10.840.10. 1 hit.
InterProiIPR000159. RA_dom.
IPR015758. RalGDS.
IPR000651. Ras-like_Gua-exchang_fac_N.
IPR019804. Ras_G-nucl-exch_fac_CS.
IPR023578. Ras_GEF_dom.
IPR001895. RASGEF_cat_dom.
IPR029071. Ubiquitin-rel_dom.
[Graphical view]
PANTHERiPTHR23113:SF35. PTHR23113:SF35. 4 hits.
PfamiPF00788. RA. 1 hit.
PF00617. RasGEF. 1 hit.
PF00618. RasGEF_N. 1 hit.
[Graphical view]
SMARTiSM00314. RA. 1 hit.
SM00147. RasGEF. 1 hit.
SM00229. RasGEFN. 1 hit.
[Graphical view]
SUPFAMiSSF48366. SSF48366. 2 hits.
SSF54236. SSF54236. 1 hit.
PROSITEiPS50200. RA. 1 hit.
PS00720. RASGEF. 1 hit.
PS50009. RASGEF_CAT. 1 hit.
PS50212. RASGEF_NTER. 1 hit.
[Graphical view]

Sequences (6)i

Sequence statusi: Complete.

This entry describes 6 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q12967-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MVQRMWAEAA GPAGGAEPLF PGSRRSRSVW DAVRLEVGVP DSCPVVLHSF
60 70 80 90 100
TQLDPDLPRP ESSTQEIGEE LINGVIYSIS LRKVQLHHGG NKGQRWLGYE
110 120 130 140 150
NESALNLYET CKVRTVKAGT LEKLVEHLVP AFQGSDLSYV TIFLCTYRAF
160 170 180 190 200
TTTQQVLDLL FKRYGRCDAL TASSRYGCIL PYSDEDGGPQ DQLKNAISSI
210 220 230 240 250
LGTWLDQYSE DFCQPPDFPC LKQLVAYVQL NMPGSDLERR AHLLLAQLEH
260 270 280 290 300
SEPIEAEPEA LSPVPALKPT PELELALTPA RAPSPVPAPA PEPEPAPTPA
310 320 330 340 350
PGSELEVAPA PAPELQQAPE PAVGLESAPA PALELEPAPE QDPAPSQTLE
360 370 380 390 400
LEPAPAPVPS LQPSWPSPVV AENGLSEEKP HLLVFPPDLV AEQFTLMDAE
410 420 430 440 450
LFKKVVPYHC LGSIWSQRDK KGKEHLAPTI RATVTQFNSV ANCVITTCLG
460 470 480 490 500
NRSTKAPDRA RVVEHWIEVA RECRILKNFS SLYAILSALQ SNSIHRLKKT
510 520 530 540 550
WEDVSRDSFR IFQKLSEIFS DENNYSLSRE LLIKEGTSKF ATLEMNPKRA
560 570 580 590 600
QKRPKETGII QGTVPYLGTF LTDLVMLDTA MKDYLYGRLI NFEKRRKEFE
610 620 630 640 650
VIAQIKLLQS ACNNYSIAPD EQFGAWFRAV ERLSETESYN LSCELEPPSE
660 670 680 690 700
SASNTLRTKK NTAIVKRWSD RQAPSTELST SGSSHSKSCD QLRCGPYLSS
710 720 730 740 750
GDIADALSVH SAGSSSSDVE EINISFVPES PDGQEKKFWE SASQSSPETS
760 770 780 790 800
GISSASSSTS SSSASTTPVA ATRTHKRSVS GLCNSSSALP LYNQQVGDCC
810 820 830 840 850
IIRVSLDVDN GNMYKSILVT SQDKAPAVIR KAMDKHNLEE EEPEDYELLQ
860 870 880 890 900
ILSDDRKLKI PENANVFYAM NSTANYDFVL KKRTFTKGVK VKHGASSTLP
910
RMKQKGLKIA KGIF
Length:914
Mass (Da):100,607
Last modified:June 20, 2001 - v2
Checksum:iEA5A5CF25AF3D523
GO
Isoform 2 (identifier: Q12967-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     738-912: FWESASQSSP...KQKGLKIAKG → VTACPSPQYP...KEQPCKAPRS

Note: No experimental confirmation available.
Show »
Length:951
Mass (Da):104,602
Checksum:i18593341C7EB71D5
GO
Isoform 3 (identifier: Q12967-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-61: MVQRMWAEAAGPAGGAEPLFPGSRRSRSVWDAVRLEVGVPDSCPVVLHSFTQLDPDLPRPE → MMVDCQ

Show »
Length:859
Mass (Da):94,690
Checksum:i938430024246A2BF
GO
Isoform 4 (identifier: Q12967-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-61: MVQRMWAEAA...QLDPDLPRPE → MCLWGHSTAP...GHPPGQVPRK
     163-174: Missing.

Note: No experimental confirmation available.
Show »
Length:885
Mass (Da):97,325
Checksum:iFCA0A0092D93700F
GO
Isoform 5 (identifier: Q12967-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-60: MVQRMWAEAA...TQLDPDLPRP → MAREAGQVCA...LAPLPAPATT

Note: No experimental confirmation available.Curated
Show »
Length:913
Mass (Da):100,323
Checksum:i238B0EF54522FD58
GO
Isoform 6 (identifier: Q12967-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     163-174: Missing.

Note: No experimental confirmation available.
Show »
Length:902
Mass (Da):99,325
Checksum:i5A4C99EB60D095DC
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti97 – 971L → F in BAC87018 (PubMed:14702039).Curated
Sequence conflicti869 – 8691A → T in BAH13489 (PubMed:14702039).Curated
Isoform 5 (identifier: Q12967-5)
Sequence conflicti3 – 31R → W in BAC87018 (PubMed:14702039).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti496 – 4961R → L in a colorectal cancer sample; somatic mutation. 1 Publication
VAR_035822

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 6161MVQRM…LPRPE → MMVDCQ in isoform 3. 1 PublicationVSP_043659Add
BLAST
Alternative sequencei1 – 6161MVQRM…LPRPE → MCLWGHSTAPAHTLSSPPLL FCSLPCALHLQPGTGHPPGQ VPRK in isoform 4. 1 PublicationVSP_055215Add
BLAST
Alternative sequencei1 – 6060MVQRM…DLPRP → MAREAGQVCARPAVPRGRKG SVFFACVSVVTARRRAVARR AALQSPTPWLAPLPAPATT in isoform 5. 1 PublicationVSP_055216Add
BLAST
Alternative sequencei163 – 17412Missing in isoform 4 and isoform 6. 2 PublicationsVSP_055217Add
BLAST
Alternative sequencei738 – 912175FWESA…KIAKG → VTACPSPQYPFPSPHSKSMH GARKPWILNTASRRFPIWQL AWGAPTGQWDLLILPSPSVL GISLTVIPGDLRHQLSLQQH LVLLSLHHARGCHTHPQALC LRALQLQLRAAALQPAGGRL LYHPRQPGRGQWQHVQEHPG KPAGVAWVPPSTGGKCTLNT VHHPCPPGVYLVVGGEGQMS ARYRNEEGSDQGQGWPEGRG GGKEQPCKAPRS in isoform 2. 1 PublicationVSP_035301Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF295773 mRNA. Translation: AAG02122.1.
AK127524 mRNA. Translation: BAC87018.1.
AK301470 mRNA. Translation: BAH13489.1.
AF295775, AF295778 Genomic DNA. Translation: AAG10221.1.
AF295780 Genomic DNA. Translation: AAG10225.1.
AF027169 mRNA. Translation: AAQ13414.1.
AL162417 Genomic DNA. Translation: CAI13415.1.
AL162417 Genomic DNA. Translation: CAI13417.1.
CH471090 Genomic DNA. Translation: EAW88040.1.
CH471090 Genomic DNA. Translation: EAW88042.1.
BC059362 mRNA. Translation: AAH59362.1.
AB037729 mRNA. Translation: BAA92546.1.
U14417 mRNA. Translation: AAA52360.1.
CCDSiCCDS43897.1. [Q12967-3]
CCDS65172.1. [Q12967-6]
CCDS65173.1. [Q12967-5]
CCDS65174.1. [Q12967-4]
CCDS6959.1. [Q12967-1]
PIRiI38853.
RefSeqiNP_001035827.1. NM_001042368.2. [Q12967-3]
NP_001258703.1. NM_001271774.1. [Q12967-4]
NP_001258704.1. NM_001271775.1. [Q12967-5]
NP_001258705.1. NM_001271776.1. [Q12967-6]
NP_006257.1. NM_006266.3. [Q12967-1]
UniGeneiHs.106185.

Genome annotation databases

EnsembliENST00000372047; ENSP00000361117; ENSG00000160271. [Q12967-6]
ENST00000372050; ENSP00000361120; ENSG00000160271. [Q12967-1]
ENST00000372062; ENSP00000361132; ENSG00000160271. [Q12967-4]
ENST00000393157; ENSP00000376864; ENSG00000160271. [Q12967-5]
ENST00000393160; ENSP00000376867; ENSG00000160271. [Q12967-3]
GeneIDi5900.
KEGGihsa:5900.
UCSCiuc004cco.5. human. [Q12967-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF295773 mRNA. Translation: AAG02122.1.
AK127524 mRNA. Translation: BAC87018.1.
AK301470 mRNA. Translation: BAH13489.1.
AF295775, AF295778 Genomic DNA. Translation: AAG10221.1.
AF295780 Genomic DNA. Translation: AAG10225.1.
AF027169 mRNA. Translation: AAQ13414.1.
AL162417 Genomic DNA. Translation: CAI13415.1.
AL162417 Genomic DNA. Translation: CAI13417.1.
CH471090 Genomic DNA. Translation: EAW88040.1.
CH471090 Genomic DNA. Translation: EAW88042.1.
BC059362 mRNA. Translation: AAH59362.1.
AB037729 mRNA. Translation: BAA92546.1.
U14417 mRNA. Translation: AAA52360.1.
CCDSiCCDS43897.1. [Q12967-3]
CCDS65172.1. [Q12967-6]
CCDS65173.1. [Q12967-5]
CCDS65174.1. [Q12967-4]
CCDS6959.1. [Q12967-1]
PIRiI38853.
RefSeqiNP_001035827.1. NM_001042368.2. [Q12967-3]
NP_001258703.1. NM_001271774.1. [Q12967-4]
NP_001258704.1. NM_001271775.1. [Q12967-5]
NP_001258705.1. NM_001271776.1. [Q12967-6]
NP_006257.1. NM_006266.3. [Q12967-1]
UniGeneiHs.106185.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
1RAXNMR-A775-886[»]
2B3ANMR-A798-884[»]
2RGFNMR-A788-884[»]
3KH0X-ray2.10A/B793-914[»]
ProteinModelPortaliQ12967.
SMRiQ12967. Positions 382-648, 793-885.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi111836. 22 interactions.
DIPiDIP-31375N.
IntActiQ12967. 13 interactions.
MINTiMINT-3026888.
STRINGi9606.ENSP00000361120.

PTM databases

iPTMnetiQ12967.
PhosphoSiteiQ12967.

Polymorphism and mutation databases

DMDMi14549162.

Proteomic databases

EPDiQ12967.
MaxQBiQ12967.
PaxDbiQ12967.
PRIDEiQ12967.

Protocols and materials databases

DNASUi5900.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000372047; ENSP00000361117; ENSG00000160271. [Q12967-6]
ENST00000372050; ENSP00000361120; ENSG00000160271. [Q12967-1]
ENST00000372062; ENSP00000361132; ENSG00000160271. [Q12967-4]
ENST00000393157; ENSP00000376864; ENSG00000160271. [Q12967-5]
ENST00000393160; ENSP00000376867; ENSG00000160271. [Q12967-3]
GeneIDi5900.
KEGGihsa:5900.
UCSCiuc004cco.5. human. [Q12967-1]

Organism-specific databases

CTDi5900.
GeneCardsiRALGDS.
H-InvDBHIX0008210.
HGNCiHGNC:9842. RALGDS.
HPAiCAB032582.
HPA025961.
MIMi601619. gene.
neXtProtiNX_Q12967.
PharmGKBiPA34200.
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3629. Eukaryota.
ENOG410ZUT5. LUCA.
GeneTreeiENSGT00810000125349.
HOGENOMiHOG000231592.
HOVERGENiHBG005864.
InParanoidiQ12967.
KOiK08732.
OMAiCKVRTIK.
OrthoDBiEOG76DTRS.
PhylomeDBiQ12967.
TreeFamiTF315204.

Enzyme and pathway databases

ReactomeiR-HSA-171007. p38MAPK events.

Miscellaneous databases

ChiTaRSiRALGDS. human.
EvolutionaryTraceiQ12967.
GeneWikiiRALGDS.
GenomeRNAii5900.
NextBioi22950.
PROiQ12967.
SOURCEiSearch...

Gene expression databases

BgeeiQ12967.
CleanExiHS_RALGDS.
ExpressionAtlasiQ12967. baseline and differential.
GenevisibleiQ12967. HS.

Family and domain databases

Gene3Di1.10.840.10. 1 hit.
InterProiIPR000159. RA_dom.
IPR015758. RalGDS.
IPR000651. Ras-like_Gua-exchang_fac_N.
IPR019804. Ras_G-nucl-exch_fac_CS.
IPR023578. Ras_GEF_dom.
IPR001895. RASGEF_cat_dom.
IPR029071. Ubiquitin-rel_dom.
[Graphical view]
PANTHERiPTHR23113:SF35. PTHR23113:SF35. 4 hits.
PfamiPF00788. RA. 1 hit.
PF00617. RasGEF. 1 hit.
PF00618. RasGEF_N. 1 hit.
[Graphical view]
SMARTiSM00314. RA. 1 hit.
SM00147. RasGEF. 1 hit.
SM00229. RasGEFN. 1 hit.
[Graphical view]
SUPFAMiSSF48366. SSF48366. 2 hits.
SSF54236. SSF54236. 1 hit.
PROSITEiPS50200. RA. 1 hit.
PS00720. RASGEF. 1 hit.
PS50009. RASGEF_CAT. 1 hit.
PS50212. RASGEF_NTER. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Cloning and evaluation of RALGDS as a candidate for the tuberous sclerosis gene TSC1."
    Humphrey D., Kwiatkowska J., Henske E.P., Haines J.L., Halley D., van Slegtenhorst M., Kwiatkowski D.J.
    Ann. Hum. Genet. 61:299-305(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORM 1).
    Tissue: Brain.
  2. Yu L., Zhao S.Y.
    Submitted (SEP-1997) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3).
  3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 4 AND 5).
  4. "DNA sequence and analysis of human chromosome 9."
    Humphray S.J., Oliver K., Hunt A.R., Plumb R.W., Loveland J.E., Howe K.L., Andrews T.D., Searle S., Hunt S.E., Scott C.E., Jones M.C., Ainscough R., Almeida J.P., Ambrose K.D., Ashwell R.I.S., Babbage A.K., Babbage S., Bagguley C.L.
    , Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beasley H., Beasley O., Bird C.P., Bray-Allen S., Brown A.J., Brown J.Y., Burford D., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Chen Y., Clarke G., Clark S.Y., Clee C.M., Clegg S., Collier R.E., Corby N., Crosier M., Cummings A.T., Davies J., Dhami P., Dunn M., Dutta I., Dyer L.W., Earthrowl M.E., Faulkner L., Fleming C.J., Frankish A., Frankland J.A., French L., Fricker D.G., Garner P., Garnett J., Ghori J., Gilbert J.G.R., Glison C., Grafham D.V., Gribble S., Griffiths C., Griffiths-Jones S., Grocock R., Guy J., Hall R.E., Hammond S., Harley J.L., Harrison E.S.I., Hart E.A., Heath P.D., Henderson C.D., Hopkins B.L., Howard P.J., Howden P.J., Huckle E., Johnson C., Johnson D., Joy A.A., Kay M., Keenan S., Kershaw J.K., Kimberley A.M., King A., Knights A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C., Lloyd D.M., Lovell J., Martin S., Mashreghi-Mohammadi M., Matthews L., McLaren S., McLay K.E., McMurray A., Milne S., Nickerson T., Nisbett J., Nordsiek G., Pearce A.V., Peck A.I., Porter K.M., Pandian R., Pelan S., Phillimore B., Povey S., Ramsey Y., Rand V., Scharfe M., Sehra H.K., Shownkeen R., Sims S.K., Skuce C.D., Smith M., Steward C.A., Swarbreck D., Sycamore N., Tester J., Thorpe A., Tracey A., Tromans A., Thomas D.W., Wall M., Wallis J.M., West A.P., Whitehead S.L., Willey D.L., Williams S.A., Wilming L., Wray P.W., Young L., Ashurst J.L., Coulson A., Blocker H., Durbin R.M., Sulston J.E., Hubbard T., Jackson M.J., Bentley D.R., Beck S., Rogers J., Dunham I.
    Nature 429:369-374(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 6).
    Tissue: Placenta.
  7. "Prediction of the coding sequences of unidentified human genes. XVI. The complete sequences of 150 new cDNA clones from brain which code for large proteins in vitro."
    Nagase T., Kikuno R., Ishikawa K., Hirosawa M., Ohara O.
    DNA Res. 7:65-73(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 205-912 (ISOFORM 2).
    Tissue: Brain.
  8. "Activated Ras interacts with the Ral guanine nucleotide dissociation stimulator."
    Hofer F., Fields S., Schneider C., Martin G.S.
    Proc. Natl. Acad. Sci. U.S.A. 91:11089-11093(1994) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 587-914 (ISOFORM 1).
  9. "Structure of the Ras-binding domain of RalGEF and implications for Ras binding and signalling."
    Geyer M., Herrmann C., Wohlgemuth S., Wittinghofer A., Kalbitzer H.R.
    Nat. Struct. Biol. 4:694-699(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: STRUCTURE BY NMR OF 788-884.
  10. "High-resolution structure of the RA-domain of human RalGDS and a dynamics study of its binding loop to Ras."
    Mueller T.D., Handel L., Schmieder P., Oschkinat H.
    Submitted (MAR-1999) to the PDB data bank
    Cited for: STRUCTURE BY NMR OF 771-886.
  11. Cited for: VARIANT [LARGE SCALE ANALYSIS] LEU-496.

Entry informationi

Entry nameiGNDS_HUMAN
AccessioniPrimary (citable) accession number: Q12967
Secondary accession number(s): B7Z753
, E7ER93, E7ERZ0, Q5T7V4, Q6KH11, Q6PCE1, Q6ZSD5, Q9HAX7, Q9HAY1, Q9HCT1, Q9P2N8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 15, 1998
Last sequence update: June 20, 2001
Last modified: May 11, 2016
This is version 158 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 9
    Human chromosome 9: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.