Reviewed,
UniProtKB/Swiss-Prot Q12959 (DLG1_HUMAN)
Last modified
February 9, 2010.
Version 120.
History...
Clusters with 100%,
90%,
50% identity |
Documents (6) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Disks large homolog 1 Alternative name(s): Synapse-associated protein 97 Short name=SAP-97 Short name=SAP97 hDlg | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Complete proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 904 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Essential multidomain scaffolding protein required for normal development By similarity. Recruits channels, receptors and signaling molecules to discrete plasma membrane domains in polarized cells. May play a role in adherens junction assembly, signal transduction, cell proliferation, synaptogenesis and lymphocyte activation. Regulates the excitability of cardiac myocytes by modulating the functional expression of Kv4 channels. Functional regulator of Kv1.5 channel. Ref.11 Ref.14 Ref.17 Ref.18 Ref.28 |
| Subunit structure | Homotetramer Probable. Interacts through its guanylate kinase-like domain with DLGAP1, DLGAP2, DLGAP3, DLGAP4 and MAP1A. May interact with HTR2A By similarity. Interacts with LRFN1 By similarity. Interacts through its PDZ domains with GRIN2A, KCNA1, KCNA2, KCNA3, KCNA4, KCNA5, KCND2, KCND3, GRIA1, GPR124 and GPR125. Interacts with KCNF1. Interacts with CAMK2 (by similarity). Interacts with cytoskeleton-associated proteins EPB41 and EZR. Found in a complex with KCNA5 and CAV3. Found in a complex with APC and CTNNB1. Interacts with CDH1 through binding to PIK3R1. Forms multiprotein complexes with CASK, LIN7A, LIN7B, LIN7C, APBA1, and KCNJ12. Interacts through its guanylate kinase-like domain with KIF13B. Forms a tripartite complex composed of DLG1, MPP7 and LIN7 (LIN7A or LIN7C). May interact with TJAP1. Interacts with TOPK and the HTLV-1 viral Tax and HPV-18 E6 papillomavirus (HPV) oncoproteins. Interacts with PTEN By similarity. Interacts with FRMPD4 (via C-terminus). Ref.11 Ref.14 Ref.17 Ref.28 Ref.1 Ref.5 Ref.6 Ref.7 Ref.8 Ref.9 Ref.10 Ref.12 Ref.13 Ref.19 Ref.23 Ref.24 Ref.25 |
| Subcellular location | Membrane; Peripheral membrane protein By similarity. Basolateral cell membrane By similarity. Endoplasmic reticulum membrane By similarity. Cell junction › synapse › postsynaptic cell membrane › postsynaptic density By similarity. Cell junction › synapse. Cell membrane › sarcolemma. Note: Colocalizes with EPB41 at regions of intercellular contacts. Basolateral in epithelial cells. May also associate with endoplasmic reticulum membranes. Mainly found in neurons soma, moderately found at postsynaptic densities By similarity. Ref.14 Ref.1 Ref.6 Ref.10 Ref.15 Ref.16 |
| Tissue specificity | Abundantly expressed in atrial myocardium (at protein level). Expressed in lung fibroblasts, cervical epithelial and B-cells (at protein level). Widely expressed, with isoforms displaying different expression profiles. Ref.14 Ref.28 Ref.1 |
| Domain | The alternatively spliced domain I3 corresponding to amino acids (636-669) of isoform 4 is an EPB41 binding site mediating association to membranes in polarized and non-polarized cells. The PDZ domains may also mediate association to membranes by binding to EPB41 and GPR124 together with the L27 domain that binds CASK and DLG2. The L27 domain may regulate DLG1 self-association. The N-terminal alternatively spliced region is capable of binding several SH3 domains and also moderates the level of protein oligomerization. |
| Post-translational modification | Phosphorylation of Ser-232 regulates association with GRIN2A. Isoform 2 is phosphorylated on Ser-698. Isoform 3 is phosphorylated on Ser-665 By similarity. Ref.21 Ref.22 Ref.26 Ref.27 Ref.29 |
| Sequence similarities | Belongs to the MAGUK family. Contains 1 guanylate kinase-like domain. Contains 1 L27 domain. Contains 3 PDZ (DHR) domains. Contains 1 SH3 domain. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| KIF13B | Q9NQT8 | 3 | EBI-357500,EBI-766408 | |
| KIF13B | Q9NQT8 | 1 | EBI-357481,EBI-766408 | |
| KIF1B | O60333-3 | 1 | EBI-357481,EBI-465669 |
Alternative products
| This entry describes 7 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q12959-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q12959-2) The sequence of this isoform differs from the canonical sequence as follows: 669-680: EIPDDMGSKGLK → QSFNDKRKKNLFSRKFPFYKNKDQSEQETSDADQ | ||||||
| Note: Phosphorylated on Ser-698 (By similarity). | ||||||
| Isoform 3 (identifier: Q12959-3) The sequence of this isoform differs from the canonical sequence as follows: 162-194: Missing. | ||||||
| Isoform 4 (identifier: Q12959-4) The sequence of this isoform differs from the canonical sequence as follows: 162-194: Missing. 669-680: EIPDDMGSKGLK → QSFNDKRKKNLFSRKFPFYKNKDQSEQETSDADQ | ||||||
| Note: Phosphorylated on Ser-665 (By similarity). Ref.4 (AAI44652) sequence is in conflict in position: 636:Q->Missing. | ||||||
| Isoform 5 (identifier: Q12959-5) The sequence of this isoform differs from the canonical sequence as follows: 162-194: Missing. 195-212: Missing. | ||||||
| Isoform 6 (identifier: Q12959-6) The sequence of this isoform differs from the canonical sequence as follows: 681-693: Missing. | ||||||
| Isoform 7 (identifier: Q12959-7) The sequence of this isoform differs from the canonical sequence as follows: 693-693: Y → YLILITDEYGCSKG |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 904 | 904 | Disks large homolog 1 | PRO_0000094548 | |||||||||||||||||||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||||||||||||||||||
| Domain | 4 – 64 | 61 | L27 | ||||||||||||||||||||||||||||||||||||||||||
| Domain | 224 – 310 | 87 | PDZ 1 | ||||||||||||||||||||||||||||||||||||||||||
| Domain | 319 – 405 | 87 | PDZ 2 | ||||||||||||||||||||||||||||||||||||||||||
| Domain | 466 – 546 | 81 | PDZ 3 | ||||||||||||||||||||||||||||||||||||||||||
| Domain | 581 – 651 | 71 | SH3 | ||||||||||||||||||||||||||||||||||||||||||
| Domain | 714 – 889 | 176 | Guanylate kinase-like | ||||||||||||||||||||||||||||||||||||||||||
| Region | 162 – 212 | 51 | Interaction with SH3 domains | ||||||||||||||||||||||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 115 | 1 | Phosphothreonine Ref.27 | ||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 122 | 1 | Phosphoserine Ref.27 | ||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 232 | 1 | Phosphoserine By similarity | ||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 301 | 1 | Phosphoserine By similarity | ||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 399 | 1 | Phosphotyrosine By similarity | ||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 575 | 1 | Phosphoserine Ref.27 Ref.29 | ||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 619 | 1 | Phosphoserine Ref.26 | ||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 683 | 1 | Phosphothreonine By similarity | ||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 684 | 1 | Phosphoserine Ref.21 Ref.27 | ||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 687 | 1 | Phosphoserine Ref.21 Ref.27 | ||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 760 | 1 | Phosphotyrosine Ref.22 | ||||||||||||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 162 – 194 | 33 | Missing in isoform 3, isoform 4 and isoform 5. | VSP_012862 | |||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 195 – 212 | 18 | Missing in isoform 5. | VSP_012863 | |||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 669 – 680 | 12 | EIPDD…SKGLK → QSFNDKRKKNLFSRKFPFYK NKDQSEQETSDADQ in isoform 2 and isoform 4. | VSP_003150 | |||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 681 – 693 | 13 | Missing in isoform 6. | VSP_012864 | |||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 693 | 1 | Y → YLILITDEYGCSKG in isoform 7. | VSP_012865 | |||||||||||||||||||||||||||||||||||||||||
| Natural variant | 140 | 1 | K → R: dbSNP rs1802668. | VAR_054334 | |||||||||||||||||||||||||||||||||||||||||
| Natural variant | 278 | 1 | R → Q: dbSNP rs1134986. Ref.1 | VAR_054335 | |||||||||||||||||||||||||||||||||||||||||
| Natural variant | 899 | 1 | P → L: dbSNP rs34492126. | VAR_054336 | |||||||||||||||||||||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 38 – 40 | 3 | INI → ANA: Loss of membrane association and DLG2-binding. Ref.16 | ||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 801 | 1 | E → G in AAA50598. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 801 | 1 | E → G in AAA50599. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 319 – 323 | 5 | |||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 331 – 334 | 4 | |||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 347 – 349 | 3 | |||||||||||||||||||||||||||||||||||||||||||
| Helix | 358 – 362 | 5 | |||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 370 – 374 | 5 | |||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 377 – 382 | 6 | |||||||||||||||||||||||||||||||||||||||||||
| Helix | 384 – 392 | 9 | |||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 395 – 403 | 9 | |||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 465 – 470 | 6 | |||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 472 – 474 | 3 | |||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 477 – 482 | 6 | |||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 484 – 487 | 4 | |||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 489 – 494 | 6 | |||||||||||||||||||||||||||||||||||||||||||
| Helix | 499 – 503 | 5 | |||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 510 – 515 | 6 | |||||||||||||||||||||||||||||||||||||||||||
| Helix | 525 – 533 | 9 | |||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 537 – 545 | 9 | |||||||||||||||||||||||||||||||||||||||||||
| Helix | 547 – 552 | 6 | |||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Cloning and characterization of hdlg: the human homologue of the Drosophila discs large tumor suppressor binds to protein 4.1." Lue R.A., Marfatia S.M., Branton D., Chishti A.H. Proc. Natl. Acad. Sci. U.S.A. 91:9818-9822(1994) [PubMed: 7937897] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3 AND 4), TISSUE SPECIFICITY, SUBCELLULAR LOCATION, INTERACTION WITH EPB41, VARIANT GLN-278. |
| [2] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed: 17974005] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Liver. |
| [3] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 4). Tissue: Brain. |
| [5] | "Clustering of Shaker-type K+ channels by interaction with a family of membrane-associated guanylate kinases." Kim E., Niethammer M., Rothschild A., Jan Y.N., Sheng M. Nature 378:85-88(1995) [PubMed: 7477295] [Abstract] Cited for: INTERACTION WITH KCNA1; KCNA2; KCNA3 AND KCNA4. |
| [6] | "Two independent domains of hDlg are sufficient for subcellular targeting: the PDZ1-2 conformational unit and an alternatively spliced domain." Lue R.A., Brandin E., Chan E.P., Branton D. J. Cell Biol. 135:1125-1137(1996) [PubMed: 8922391] [Abstract] Cited for: INTERACTION WITH EPB41, SUBCELLULAR LOCATION. |
| [7] | "Binding of APC to the human homolog of the Drosophila discs large tumor suppressor protein." Matsumine A., Ogai A., Senda T., Okumura N., Satoh K., Baeg G.-H., Kawahara T., Kobayashi S., Okada M., Toyoshima K., Akiyama T. Science 272:1020-1023(1996) [PubMed: 8638125] [Abstract] Cited for: INTERACTION WITH APC. |
| [8] | "Binding of human virus oncoproteins to hDlg/SAP97, a mammalian homolog of the Drosophila discs large tumor suppressor protein." Lee S.S., Weiss R.S., Javier R.T. Proc. Natl. Acad. Sci. U.S.A. 94:6670-6675(1997) [PubMed: 9192623] [Abstract] Cited for: INTERACTION WITH VIRAL ONCOPROTEIN TAX AND HPV-18 E6. |
| [9] | "Tax oncoprotein of HTLV-1 binds to the human homologue of Drosophila discs large tumor suppressor protein, hDLG, and perturbs its function in cell growth control." Suzuki T., Ohsugi Y., Uchida-Toita M., Akiyama T., Yoshida M. Oncogene 18:5967-5972(1999) [PubMed: 10557085] [Abstract] Cited for: INTERACTION WITH HTLV-1 TAX-1. |
| [10] | "GAKIN, a novel kinesin-like protein associates with the human homologue of the Drosophila discs large tumor suppressor in T lymphocytes." Hanada T., Lin L., Tibaldi E.V., Reinherz E.L., Chishti A.H. J. Biol. Chem. 275:28774-28784(2000) [PubMed: 10859302] [Abstract] Cited for: INTERACTION WITH KIF13B, SUBCELLULAR LOCATION. |
| [11] | "The APC-hDLG complex negatively regulates cell cycle progression from the G0/G1 to S phase." Ishidate T., Matsumine A., Toyoshima K., Akiyama T. Oncogene 19:365-372(2000) [PubMed: 10656683] [Abstract] Cited for: INTERACTION WITH APC, FUNCTION IN CELL PROLIFERATION. |
| [12] | "Characterization of PDZ-binding kinase, a mitotic kinase." Gaudet S., Branton D., Lue R.A. Proc. Natl. Acad. Sci. U.S.A. 97:5167-5172(2000) [PubMed: 10779557] [Abstract] Cited for: INTERACTION WITH TOPK. |
| [13] | "Pilt, a novel peripheral membrane protein at tight junctions in epithelial cells." Kawabe H., Nakanishi H., Asada M., Fukuhara A., Morimoto K., Takeuchi M., Takai Y. J. Biol. Chem. 276:48350-48355(2001) [PubMed: 11602598] [Abstract] Cited for: POSSIBLE INTERACTION WITH TJAP1. |
| [14] | "Expression, regulation and role of the MAGUK protein SAP-97 in human atrial myocardium." Godreau D., Vranckx R., Maguy A., Rucker-Martin C., Goyenvalle C., Abdelshafy S., Tessier S., Couetil J.P., Hatem S.N. Cardiovasc. Res. 56:433-442(2002) [PubMed: 12445884] [Abstract] Cited for: FUNCTION, TISSUE SPECIFICITY, SUBCELLULAR LOCATION, INTERACTION WITH KCNF1. |
| [15] | "The distribution and function of alternatively spliced insertions in hDlg." McLaughlin M., Hale R., Ellston D., Gaudet S., Lue R.A., Viel A. J. Biol. Chem. 277:6406-6412(2002) [PubMed: 11723125] [Abstract] Cited for: ALTERNATIVE SPLICING (ISOFORMS 5; 6 AND 7), SUBCELLULAR LOCATION. |
| [16] | "Protein 4.1-mediated membrane targeting of human discs large in epithelial cells." Hanada T., Takeuchi A., Sondarva G., Chishti A.H. J. Biol. Chem. 278:34445-34450(2003) [PubMed: 12807908] [Abstract] Cited for: SUBCELLULAR LOCATION, MUTAGENESIS OF 38-ILE--ILE-40. |
| [17] | "Human homolog of disc-large is required for adherens junction assembly and differentiation of human intestinal epithelial cells." Laprise P., Viel A., Rivard N. J. Biol. Chem. 279:10157-10166(2004) [PubMed: 14699157] [Abstract] Cited for: INTERACTION WITH PIK3R1 AND CDH1, FUNCTION IN ADHERENS JUNCTION ASSEMBLY. |
| [18] | "Discs large (Dlg1) complexes in lymphocyte activation." Xavier R., Rabizadeh S., Ishiguro K., Andre N., Ortiz J.B., Wachtel H., Morris D.G., Lopez-Ilasaca M., Shaw A.C., Swat W., Seed B. J. Cell Biol. 166:173-178(2004) [PubMed: 15263016] [Abstract] Cited for: FUNCTION IN T-CELL ACTIVATION. |
| [19] | "Direct binding of the human homologue of the Drosophila disc large tumor suppressor gene to seven-pass transmembrane proteins, tumor endothelial marker 5 (TEM5), and a novel TEM5-like protein." Yamamoto Y., Irie K., Asada M., Mino A., Mandai K., Takai Y. Oncogene 23:3889-3897(2004) [PubMed: 15021905] [Abstract] Cited for: INTERACTION WITH GPR124 AND GPR125. |
| [20] | "Dlg, Scribble and Lgl in cell polarity, cell proliferation and cancer." Humbert P., Russell S., Richardson H. Bioessays 25:542-553(2003) [PubMed: 12766944] [Abstract] Cited for: REVIEW. |
| [21] | "Large-scale characterization of HeLa cell nuclear phosphoproteins." Beausoleil S.A., Jedrychowski M., Schwartz D., Elias J.E., Villen J., Li J., Cohn M.A., Cantley L.C., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 101:12130-12135(2004) [PubMed: 15302935] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-684 AND SER-687, MASS SPECTROMETRY. Tissue: Epithelium. |
| [22] | "Global survey of phosphotyrosine signaling identifies oncogenic kinases in lung cancer." Rikova K., Guo A., Zeng Q., Possemato A., Yu J., Haack H., Nardone J., Lee K., Reeves C., Li Y., Hu Y., Tan Z., Stokes M., Sullivan L., Mitchell J., Wetzel R., Macneill J., Ren J.M. Comb M.J.Cell 131:1190-1203(2007) [PubMed: 18083107] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-760, MASS SPECTROMETRY. |
| [23] | "The stardust family protein MPP7 forms a tripartite complex with LIN7 and DLG1 that regulates the stability and localization of DLG1 to cell junctions." Bohl J., Brimer N., Lyons C., Vande Pol S.B. J. Biol. Chem. 282:9392-9400(2007) [PubMed: 17237226] [Abstract] Cited for: INTERACTION WITH LIN7A; LIN7C AND MPP7. |
| [24] | "The MAGUK protein MPP7 binds to the polarity protein hDlg1 and facilitates epithelial tight junction formation." Stucke V.M., Timmerman E., Vandekerckhove J., Gevaert K., Hall A. Mol. Biol. Cell 18:1744-1755(2007) [PubMed: 17332497] [Abstract] Cited for: INTERACTION WITH MPP7. |
| [25] | "Preso, a novel PSD-95-interacting FERM and PDZ domain protein that regulates dendritic spine morphogenesis." Lee H.W., Choi J., Shin H., Kim K., Yang J., Na M., Choi S.Y., Kang G.B., Eom S.H., Kim H., Kim E. J. Neurosci. 28:14546-14556(2008) [PubMed: 19118189] [Abstract] Cited for: INTERACTION WITH FRMPD4. |
| [26] | "Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis." Cantin G.T., Yi W., Lu B., Park S.K., Xu T., Lee J.-D., Yates J.R. III J. Proteome Res. 7:1346-1351(2008) [PubMed: 18220336] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-619, MASS SPECTROMETRY. |
| [27] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed: 18669648] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-115; SER-122; SER-575; SER-684 AND SER-687, MASS SPECTROMETRY. |
| [28] | "Kv4 potassium channels form a tripartite complex with the anchoring protein SAP97 and CaMKII in cardiac myocytes." El-Haou S., Balse E., Neyroud N., Dilanian G., Gavillet B., Abriel H., Coulombe A., Jeromin A., Hatem S.N. Circ. Res. 104:758-769(2009) [PubMed: 19213956] [Abstract] Cited for: FUNCTION, TISSUE SPECIFICITY, INTERACTION WITH KCND2 AND KCND3. |
| [29] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed: 19690332] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-575, MASS SPECTROMETRY. Tissue: T-cell. |
| [30] | "Crystal structure of a PDZ domain." Cabral J.H., Petosa C., Sutcliffe M.J., Raza S., Byron O., Poy F., Marfatia S.M., Chishti A.H., Liddington R.C. Nature 382:649-652(1996) [PubMed: 8757139] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.8 ANGSTROMS) OF 460-555. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | U13896 mRNA. Translation: AAA50598.1. U13897 mRNA. Translation: AAA50599.1. EF553524 mRNA. Translation: ABQ66269.1. CH471191 Genomic DNA. Translation: EAW53610.1. CH471191 Genomic DNA. Translation: EAW53611.1. BC140841 mRNA. Translation: AAI40842.1. BC144651 mRNA. Translation: AAI44652.1. | ||||||||||||||||||
| IPI | IPI00030351. IPI00218729. IPI00552213. IPI00552376. IPI00552511. IPI00552682. IPI00553029. | ||||||||||||||||||
| PIR | I38756. I38757. | ||||||||||||||||||
| RefSeq | NP_001091894.1. NP_004078.2. | ||||||||||||||||||
| UniGene | Hs.292549 | ||||||||||||||||||
3D structure databases | |||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||
| SMR | Q12959. Positions 4-63, 221-311, 315-548, 584-904. | ||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||
| IntAct | Q12959. 6 interactions. | ||||||||||||||||||
| STRING | Q12959. | ||||||||||||||||||
PTM databases | |||||||||||||||||||
| PhosphoSite | Q12959. | ||||||||||||||||||
Proteomic databases | |||||||||||||||||||
| PRIDE | Q12959. | ||||||||||||||||||
Genome annotation databases | |||||||||||||||||||
| Ensembl | ENST00000419354; ENSP00000407531; ENSG00000075711; Homo sapiens. [Genome view] ENST00000448528; ENSP00000391732; ENSG00000075711; Homo sapiens. [Genome view] | ||||||||||||||||||
| GeneID | 1739. | ||||||||||||||||||
| KEGG | hsa:1739. | ||||||||||||||||||
| UCSC | uc003fxn.2. human. | ||||||||||||||||||
Organism-specific databases | |||||||||||||||||||
| CTD | 1739. | ||||||||||||||||||
| GeneCards | GC03M198259. | ||||||||||||||||||
| H-InvDB | HIX0020777. | ||||||||||||||||||
| HGNC | HGNC:2900. DLG1. | ||||||||||||||||||
| HPA | CAB016307. | ||||||||||||||||||
| MIM | 601014. gene. | ||||||||||||||||||
| PharmGKB | PA27356. | ||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||
| eggNOG | prNOG11698. | ||||||||||||||||||
| HOVERGEN | Q12959. | ||||||||||||||||||
| OrthoDB | EOG98GZNH. | ||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||
| Reactome | REACT_13685. Synaptic Transmission. | ||||||||||||||||||
Gene expression databases | |||||||||||||||||||
| ArrayExpress | Q12959. | ||||||||||||||||||
| Bgee | Q12959. | ||||||||||||||||||
| CleanEx | HS_DLG1. | ||||||||||||||||||
| Genevestigator | Q12959. | ||||||||||||||||||
| GermOnline | ENSG00000075711. Homo sapiens. | ||||||||||||||||||
Family and domain databases | |||||||||||||||||||
| InterPro | IPR008144. Guanylate_kin. IPR008145. Guanylate_kin/L-typ_Ca_channel. IPR020590. Guanylate_kinase_CS. IPR004172. L27. IPR015143. L27_1. IPR016313. M-assoc_guanylate_kinase. IPR019590. MAGUK_PEST_N. IPR001478. PDZ/DHR/GLGF. IPR019583. PDZ_assoc. IPR011511. SH3_2. IPR001452. SH3_domain. [Graphical view] | ||||||||||||||||||
| Pfam | PF00625. Guanylate_kin. 1 hit. PF09058. L27_1. 1 hit. PF10608. MAGUK_N_PEST. 1 hit. PF00595. PDZ. 3 hits. PF10600. PDZ_assoc. 1 hit. PF07653. SH3_2. 1 hit. [Graphical view] | ||||||||||||||||||
| PIRSF | PIRSF001741. MAGUK_DLGH. 1 hit. | ||||||||||||||||||
| SMART | SM00072. GuKc. 1 hit. SM00569. L27. 1 hit. SM00228. PDZ. 3 hits. SM00326. SH3. 1 hit. [Graphical view] | ||||||||||||||||||
| PROSITE | PS00856. GUANYLATE_KINASE_1. 1 hit. PS50052. GUANYLATE_KINASE_2. 1 hit. PS51022. L27. 1 hit. PS50106. PDZ. 3 hits. PS50002. SH3. 1 hit. [Graphical view] | ||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||
Other Resources | |||||||||||||||||||
| NextBio | 7051. | ||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||
Entry information
| Entry name | DLG1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q12959 Secondary accession number(s): A5YKK7 Q12958 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 3 Human chromosome 3: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with


