Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Disks large homolog 1

Gene

DLG1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Essential multidomain scaffolding protein required for normal development (By similarity). Recruits channels, receptors and signaling molecules to discrete plasma membrane domains in polarized cells. May play a role in adherens junction assembly, signal transduction, cell proliferation, synaptogenesis and lymphocyte activation. Regulates the excitability of cardiac myocytes by modulating the functional expression of Kv4 channels. Functional regulator of Kv1.5 channel.By similarity6 Publications

GO - Molecular functioni

  • cadherin binding Source: BHF-UCL
  • cytoskeletal protein binding Source: ProtInc
  • guanylate kinase activity Source: ProtInc
  • ion channel binding Source: BHF-UCL
  • ionotropic glutamate receptor binding Source: GO_Central
  • L27 domain binding Source: BHF-UCL
  • ligand-gated ion channel activity Source: Reactome
  • mitogen-activated protein kinase kinase binding Source: UniProtKB
  • phosphatase binding Source: UniProtKB
  • phosphoprotein phosphatase activity Source: UniProtKB
  • potassium channel regulator activity Source: BHF-UCL
  • protein-containing complex scaffold activity Source: Ensembl
  • protein C-terminus binding Source: UniProtKB
  • protein kinase binding Source: UniProtKB

GO - Biological processi

  • actin filament organization Source: UniProtKB
  • activation of protein kinase activity Source: Ensembl
  • amyloid precursor protein metabolic process Source: Ensembl
  • astral microtubule organization Source: UniProtKB
  • bicellular tight junction assembly Source: BHF-UCL
  • branching involved in ureteric bud morphogenesis Source: Ensembl
  • cell-cell adhesion Source: UniProtKB
  • cellular protein-containing complex localization Source: UniProtKB
  • chemical synaptic transmission Source: GO_Central
  • cortical actin cytoskeleton organization Source: UniProtKB
  • cortical microtubule organization Source: UniProtKB
  • embryonic skeletal system morphogenesis Source: Ensembl
  • endothelial cell proliferation Source: UniProtKB
  • establishment of centrosome localization Source: UniProtKB
  • establishment or maintenance of cell polarity Source: UniProtKB
  • establishment or maintenance of epithelial cell apical/basal polarity Source: GO_Central
  • hard palate development Source: Ensembl
  • immunological synapse formation Source: Ensembl
  • lens development in camera-type eye Source: Ensembl
  • membrane raft organization Source: Ensembl
  • mitotic cell cycle checkpoint Source: UniProtKB
  • negative regulation of epithelial cell proliferation Source: Ensembl
  • negative regulation of ERK1 and ERK2 cascade Source: UniProtKB
  • negative regulation of mitotic cell cycle Source: UniProtKB
  • negative regulation of p38MAPK cascade Source: UniProtKB
  • negative regulation of protein kinase B signaling Source: Ensembl
  • negative regulation of T cell proliferation Source: Ensembl
  • negative regulation of transcription by RNA polymerase II Source: UniProtKB
  • nervous system development Source: GO_Central
  • peristalsis Source: Ensembl
  • positive regulation of actin filament polymerization Source: Ensembl
  • positive regulation of cell proliferation Source: Ensembl
  • positive regulation of potassium ion transport Source: BHF-UCL
  • positive regulation of protein localization to plasma membrane Source: BHF-UCL
  • protein localization to plasma membrane Source: BHF-UCL
  • receptor clustering Source: GO_Central
  • receptor localization to synapse Source: GO_Central
  • regulation of cell shape Source: UniProtKB
  • regulation of membrane potential Source: BHF-UCL
  • regulation of myelination Source: Ensembl
  • regulation of potassium ion export across plasma membrane Source: BHF-UCL
  • regulation of potassium ion import Source: BHF-UCL
  • regulation of sodium ion transmembrane transport Source: BHF-UCL
  • regulation of ventricular cardiac muscle cell action potential Source: BHF-UCL
  • regulation of voltage-gated potassium channel activity involved in ventricular cardiac muscle cell action potential repolarization Source: BHF-UCL
  • reproductive structure development Source: Ensembl
  • smooth muscle tissue development Source: Ensembl
  • T cell activation Source: Ensembl
  • T cell cytokine production Source: Ensembl
  • viral process Source: UniProtKB-KW

Keywordsi

Biological processHost-virus interaction

Enzyme and pathway databases

ReactomeiR-HSA-399719 Trafficking of AMPA receptors
R-HSA-447038 NrCAM interactions
R-HSA-451308 Activation of Ca-permeable Kainate Receptor
R-HSA-8849932 Synaptic adhesion-like molecules
SIGNORiQ12959

Protein family/group databases

TCDBi8.A.24.1.7 the ezrin/radixin/moesin-binding phosphoprotein 50 (ebp50) family

Names & Taxonomyi

Protein namesi
Recommended name:
Disks large homolog 1Curated
Alternative name(s):
Synapse-associated protein 97
Short name:
SAP-97
Short name:
SAP97
hDlg
Gene namesi
Name:DLG1Imported
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 3

Organism-specific databases

EuPathDBiHostDB:ENSG00000075711.20
HGNCiHGNC:2900 DLG1
MIMi601014 gene
neXtProtiNX_Q12959

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell junction, Cell membrane, Cytoplasm, Endoplasmic reticulum, Membrane, Postsynaptic cell membrane, Synapse

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi38 – 40INI → ANA: Loss of membrane association and DLG2-binding. 1 Publication3

Organism-specific databases

DisGeNETi1739
OpenTargetsiENSG00000075711
PharmGKBiPA27356

Polymorphism and mutation databases

BioMutaiDLG1
DMDMi223590196

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000945481 – 904Disks large homolog 1Add BLAST904

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei115PhosphothreonineCombined sources1
Modified residuei122PhosphoserineCombined sources1
Modified residuei138PhosphoserineCombined sources1
Modified residuei158PhosphoserineCombined sources1
Modified residuei232PhosphoserineBy similarity1
Modified residuei399PhosphotyrosineBy similarity1
Modified residuei568PhosphoserineCombined sources1
Modified residuei573PhosphoserineCombined sources1
Modified residuei575PhosphoserineCombined sources1
Modified residuei579PhosphoserineCombined sources1
Modified residuei598PhosphoserineBy similarity1
Modified residuei619PhosphoserineCombined sources1
Modified residuei684PhosphoserineCombined sources1
Modified residuei687PhosphoserineCombined sources1
Modified residuei834PhosphoserineBy similarity1
Isoform 4 (identifier: Q12959-4)
Modified residuei676PhosphoserineCombined sourcesCurated1
Isoform 2 (identifier: Q12959-2)
Modified residuei709PhosphoserineCombined sources1

Post-translational modificationi

Phosphorylated by MAPK12. Phosphorylation of Ser-232 regulates association with GRIN2A (By similarity).By similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ12959
MaxQBiQ12959
PaxDbiQ12959
PeptideAtlasiQ12959
PRIDEiQ12959

PTM databases

iPTMnetiQ12959
PhosphoSitePlusiQ12959
SwissPalmiQ12959

Miscellaneous databases

PMAP-CutDBA5YKK7

Expressioni

Tissue specificityi

Abundantly expressed in atrial myocardium (at protein level). Expressed in lung fibroblasts, cervical epithelial and B-cells (at protein level). Widely expressed, with isoforms displaying different expression profiles.3 Publications

Gene expression databases

BgeeiENSG00000075711
CleanExiHS_DLG1
ExpressionAtlasiQ12959 baseline and differential
GenevisibleiQ12959 HS

Organism-specific databases

HPAiCAB016307
HPA069593

Interactioni

Subunit structurei

Homotetramer (Probable). Interacts (via guanylate kinase-like domain) with DLGAP1, DLGAP2, DLGAP3, DLGAP4 and MAP1A (By similarity). Interacts (via guanylate kinase-like domain) with KIF13B (PubMed:10859302). May interact with HTR2A (By similarity). Interacts (via PDZ domains) with GRIA1 (By similarity). Interacts (via PDZ domains) with GRIN2A (By similarity). Interacts (via PDZ domains) with KCND2 and KCND3 (PubMed:19213956). Interacts (via PDZ domains) with KCNA1, KCNA2, KCNA3 and KCNA4 (PubMed:7477295). Interacts (via PDZ domains) with ADGRA3 (PubMed:15021905). Interacts with KCNF1 (PubMed:12445884). Interacts with CAMK2 (By similarity). Interacts with cytoskeleton-associated protein EPB41 (PubMed:7937897, PubMed:8922391). Interacts with cytoskeleton-associated protein EZR (By similarity). Found in a complex with KCNA5 and CAV3 (By similarity). Found in a complex with APC and CTNNB1 (PubMed:8638125, PubMed:10656683). Interacts with CDH1 through binding to PIK3R1 (PubMed:14699157). Forms multiprotein complexes with CASK, LIN7A, LIN7B, LIN7C, APBA1, and KCNJ12 (By similarity). Interacts with TOPK (PubMed:10779557). Forms a tripartite complex composed of DLG1, MPP7 and LIN7 (LIN7A or LIN7C) (PubMed:17237226, PubMed:17332497, PubMed:20702775). May interact with TJAP1 (PubMed:11602598). Interacts with PTEN (By similarity). Interacts with FRMPD4 (via C-terminus) (PubMed:19118189). Interacts with LRFN1, LRFN2 and LRFN4 (PubMed:16630835). Interacts with SFPQ (PubMed:20605917). Interacts (via PDZ domains) with ADGRA2 (via PDZ-binding motif) (PubMed:15021905, PubMed:25558062). Interacts with the HTLV-1 viral Tax and HPV-18 E6 papillomavirus (HPV) oncoproteins (PubMed:9192623, PubMed:10557085).By similarityCurated20 Publications

Binary interactionsi

Show more details

GO - Molecular functioni

  • cadherin binding Source: BHF-UCL
  • cytoskeletal protein binding Source: ProtInc
  • ion channel binding Source: BHF-UCL
  • ionotropic glutamate receptor binding Source: GO_Central
  • L27 domain binding Source: BHF-UCL
  • mitogen-activated protein kinase kinase binding Source: UniProtKB
  • phosphatase binding Source: UniProtKB
  • protein-containing complex scaffold activity Source: Ensembl
  • protein C-terminus binding Source: UniProtKB
  • protein kinase binding Source: UniProtKB

Protein-protein interaction databases

BioGridi108083, 67 interactors
CORUMiQ12959
DIPiDIP-33957N
ELMiQ12959
IntActiQ12959, 99 interactors
MINTiQ12959
STRINGi9606.ENSP00000345731

Structurei

Secondary structure

1904
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi5 – 20Combined sources16
Beta strandi24 – 26Combined sources3
Helixi30 – 42Combined sources13
Helixi44 – 55Combined sources12
Turni60 – 62Combined sources3
Helixi64 – 66Combined sources3
Beta strandi221 – 228Combined sources8
Beta strandi233 – 239Combined sources7
Beta strandi254 – 258Combined sources5
Helixi263 – 267Combined sources5
Beta strandi275 – 279Combined sources5
Helixi289 – 298Combined sources10
Beta strandi301 – 309Combined sources9
Beta strandi317 – 323Combined sources7
Beta strandi331 – 337Combined sources7
Beta strandi348 – 353Combined sources6
Helixi358 – 362Combined sources5
Beta strandi370 – 374Combined sources5
Beta strandi377 – 382Combined sources6
Helixi384 – 392Combined sources9
Beta strandi396 – 403Combined sources8
Beta strandi465 – 470Combined sources6
Beta strandi472 – 474Combined sources3
Beta strandi477 – 482Combined sources6
Beta strandi484 – 487Combined sources4
Beta strandi489 – 494Combined sources6
Helixi499 – 503Combined sources5
Beta strandi510 – 515Combined sources6
Helixi525 – 533Combined sources9
Beta strandi537 – 545Combined sources9
Helixi547 – 554Combined sources8
Beta strandi717 – 721Combined sources5
Helixi724 – 734Combined sources11
Turni736 – 738Combined sources3
Turni756 – 758Combined sources3
Helixi766 – 774Combined sources9
Beta strandi778 – 784Combined sources7
Beta strandi787 – 792Combined sources6
Helixi793 – 800Combined sources8
Turni801 – 803Combined sources3
Beta strandi805 – 808Combined sources4
Helixi813 – 820Combined sources8
Beta strandi826 – 830Combined sources5
Helixi855 – 864Combined sources10
Helixi865 – 867Combined sources3
Beta strandi869 – 872Combined sources4
Helixi877 – 892Combined sources16
Helixi900 – 902Combined sources3

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1PDRX-ray2.80A457-555[»]
2M3MNMR-A318-406[»]
2OQSNMR-A318-406[»]
2X7ZX-ray2.00A311-407[»]
3LRAX-ray2.95A2-65[»]
3RL7X-ray2.30A/B/C/D/E/F220-317[»]
3RL8X-ray2.20A/B/C/D/E315-410[»]
3W9YX-ray2.20A712-904[»]
4AMHX-ray2.30A/B315-405[»]
4G69X-ray2.00A310-407[»]
ProteinModelPortaliQ12959
SMRiQ12959
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ12959

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini4 – 64L27PROSITE-ProRule annotationAdd BLAST61
Domaini224 – 310PDZ 1PROSITE-ProRule annotationAdd BLAST87
Domaini319 – 405PDZ 2PROSITE-ProRule annotationAdd BLAST87
Domaini466 – 546PDZ 3PROSITE-ProRule annotationAdd BLAST81
Domaini581 – 651SH3PROSITE-ProRule annotationAdd BLAST71
Domaini714 – 889Guanylate kinase-likePROSITE-ProRule annotationAdd BLAST176

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni162 – 212Interaction with SH3 domainsAdd BLAST51

Domaini

The alternatively spliced domain I3 corresponding to amino acids (636-669) of isoform 4 is an EPB41 binding site mediating association to membranes in polarized and non-polarized cells.
The PDZ domains may also mediate association to membranes by binding to EPB41 and ADGRA2 together with the L27 domain that binds CASK and DLG2.
The L27 domain may regulate DLG1 self-association. The N-terminal alternatively spliced region is capable of binding several SH3 domains and also moderates the level of protein oligomerization.

Sequence similaritiesi

Belongs to the MAGUK family.Curated

Keywords - Domaini

Repeat, SH3 domain

Phylogenomic databases

eggNOGiKOG0708 Eukaryota
COG0194 LUCA
GeneTreeiENSGT00760000118866
HOGENOMiHOG000232102
HOVERGENiHBG107814
InParanoidiQ12959
KOiK12076
OMAiNPKCIDH
OrthoDBiEOG091G0BB1
PhylomeDBiQ12959
TreeFamiTF323171

Family and domain databases

InterProiView protein in InterPro
IPR016313 DLG1-like
IPR019590 DLG1_PEST_dom
IPR008145 GK/Ca_channel_bsu
IPR008144 Guanylate_kin-like_dom
IPR020590 Guanylate_kinase_CS
IPR015143 L27_1
IPR004172 L27_dom
IPR036892 L27_dom_sf
IPR027417 P-loop_NTPase
IPR001478 PDZ
IPR019583 PDZ_assoc
IPR036034 PDZ_sf
IPR036028 SH3-like_dom_sf
IPR001452 SH3_domain
PfamiView protein in Pfam
PF00625 Guanylate_kin, 1 hit
PF09058 L27_1, 1 hit
PF10608 MAGUK_N_PEST, 1 hit
PF00595 PDZ, 3 hits
PF10600 PDZ_assoc, 1 hit
PF07653 SH3_2, 1 hit
PIRSFiPIRSF001741 MAGUK_DLGH, 1 hit
SMARTiView protein in SMART
SM00072 GuKc, 1 hit
SM00569 L27, 1 hit
SM01277 MAGUK_N_PEST, 1 hit
SM00228 PDZ, 3 hits
SM00326 SH3, 1 hit
SUPFAMiSSF101288 SSF101288, 1 hit
SSF50044 SSF50044, 2 hits
SSF50156 SSF50156, 3 hits
SSF52540 SSF52540, 1 hit
PROSITEiView protein in PROSITE
PS00856 GUANYLATE_KINASE_1, 1 hit
PS50052 GUANYLATE_KINASE_2, 1 hit
PS51022 L27, 1 hit
PS50106 PDZ, 3 hits
PS50002 SH3, 1 hit

Sequences (9)i

Sequence statusi: Complete.

This entry describes 9 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q12959-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MPVRKQDTQR ALHLLEEYRS KLSQTEDRQL RSSIERVINI FQSNLFQALI
60 70 80 90 100
DIQEFYEVTL LDNPKCIDRS KPSEPIQPVN TWEISSLPSS TVTSETLPSS
110 120 130 140 150
LSPSVEKYRY QDEDTPPQEH ISPQITNEVI GPELVHVSEK NLSEIENVHG
160 170 180 190 200
FVSHSHISPI KPTEAVLPSP PTVPVIPVLP VPAENTVILP TIPQANPPPV
210 220 230 240 250
LVNTDSLETP TYVNGTDADY EYEEITLERG NSGLGFSIAG GTDNPHIGDD
260 270 280 290 300
SSIFITKIIT GGAAAQDGRL RVNDCILRVN EVDVRDVTHS KAVEALKEAG
310 320 330 340 350
SIVRLYVKRR KPVSEKIMEI KLIKGPKGLG FSIAGGVGNQ HIPGDNSIYV
360 370 380 390 400
TKIIEGGAAH KDGKLQIGDK LLAVNNVCLE EVTHEEAVTA LKNTSDFVYL
410 420 430 440 450
KVAKPTSMYM NDGYAPPDIT NSSSQPVDNH VSPSSFLGQT PASPARYSPV
460 470 480 490 500
SKAVLGDDEI TREPRKVVLH RGSTGLGFNI VGGEDGEGIF ISFILAGGPA
510 520 530 540 550
DLSGELRKGD RIISVNSVDL RAASHEQAAA ALKNAGQAVT IVAQYRPEEY
560 570 580 590 600
SRFEAKIHDL REQMMNSSIS SGSGSLRTSQ KRSLYVRALF DYDKTKDSGL
610 620 630 640 650
PSQGLNFKFG DILHVINASD DEWWQARQVT PDGESDEVGV IPSKRRVEKK
660 670 680 690 700
ERARLKTVKF NSKTRDKGEI PDDMGSKGLK HVTSNASDSE SSYRGQEEYV
710 720 730 740 750
LSYEPVNQQE VNYTRPVIIL GPMKDRINDD LISEFPDKFG SCVPHTTRPK
760 770 780 790 800
RDYEVDGRDY HFVTSREQME KDIQEHKFIE AGQYNNHLYG TSVQSVREVA
810 820 830 840 850
EKGKHCILDV SGNAIKRLQI AQLYPISIFI KPKSMENIME MNKRLTEEQA
860 870 880 890 900
RKTFERAMKL EQEFTEHFTA IVQGDTLEDI YNQVKQIIEE QSGSYIWVPA

KEKL
Length:904
Mass (Da):100,455
Last modified:February 10, 2009 - v2
Checksum:i6722993A84D0F761
GO
Isoform 2 (identifier: Q12959-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     669-680: EIPDDMGSKGLK → QSFNDKRKKNLFSRKFPFYKNKDQSEQETSDADQ

Show »
Length:926
Mass (Da):103,321
Checksum:i85BD4E93A17D74C4
GO
Isoform 3 (identifier: Q12959-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     162-194: Missing.

Show »
Length:871
Mass (Da):97,076
Checksum:i78CB64FC6DE66BB1
GO
Isoform 4 (identifier: Q12959-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     162-194: Missing.
     669-680: EIPDDMGSKGLK → QSFNDKRKKNLFSRKFPFYKNKDQSEQETSDADQ

Show »
Length:893
Mass (Da):99,942
Checksum:i3A026E9BAA62FFB7
GO
Isoform 5 (identifier: Q12959-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     162-194: Missing.
     195-212: Missing.

Show »
Length:853
Mass (Da):95,166
Checksum:i2E7EE3F5954BA3E0
GO
Isoform 6 (identifier: Q12959-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     681-693: Missing.

Show »
Length:891
Mass (Da):99,090
Checksum:i5DB5256100623D0B
GO
Isoform 7 (identifier: Q12959-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     693-693: Y → YLILITDEYGCSKG

Show »
Length:917
Mass (Da):101,849
Checksum:iFE8911BB05B03211
GO
Isoform 8 (identifier: Q12959-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-77: MPVRKQDTQR...DRSKPSEPIQ → MNYIFGNNTL...DCISVATSST
     78-193: Missing.

Note: No experimental confirmation available.
Show »
Length:788
Mass (Da):87,248
Checksum:i8EB77B3368768FBD
GO
Isoform 9 (identifier: Q12959-9) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-77: MPVRKQDTQR...DRSKPSEPIQ → MNYIFGNNTL...DCISVATSST
     78-193: Missing.
     693-693: Y → YLILITDEYGCSKG
     694-694: Missing.

Note: No experimental confirmation available.
Show »
Length:800
Mass (Da):88,485
Checksum:iC67306E88A5A473D
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti237S → N in BAG57902 (PubMed:14702039).Curated1
Sequence conflicti801E → G in AAA50598 (PubMed:7937897).Curated1
Sequence conflicti801E → G in AAA50599 (PubMed:7937897).Curated1
Isoform 4 (identifier: Q12959-4)
Sequence conflicti636Missing in AAI44652 (PubMed:15489334).Combined sourcesCurated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_054334140K → R. Corresponds to variant dbSNP:rs1802668Ensembl.1
Natural variantiVAR_054335278R → Q2 PublicationsCorresponds to variant dbSNP:rs1134986Ensembl.1
Natural variantiVAR_054336899P → L. Corresponds to variant dbSNP:rs34492126Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0458961 – 77MPVRK…SEPIQ → MNYIFGNNTLLYSRGSRGGN TSSSHGSAGPKQKHWAKKGS SDELQAEPEPSRWQQIVAFF TRRHSFIDCISVATSST in isoform 8 and isoform 9. 1 PublicationAdd BLAST77
Alternative sequenceiVSP_04589778 – 193Missing in isoform 8 and isoform 9. 1 PublicationAdd BLAST116
Alternative sequenceiVSP_012862162 – 194Missing in isoform 3, isoform 4 and isoform 5. 2 PublicationsAdd BLAST33
Alternative sequenceiVSP_012863195 – 212Missing in isoform 5. CuratedAdd BLAST18
Alternative sequenceiVSP_003150669 – 680EIPDD…SKGLK → QSFNDKRKKNLFSRKFPFYK NKDQSEQETSDADQ in isoform 2 and isoform 4. 2 PublicationsAdd BLAST12
Alternative sequenceiVSP_012864681 – 693Missing in isoform 6. CuratedAdd BLAST13
Alternative sequenceiVSP_012865693Y → YLILITDEYGCSKG in isoform 7 and isoform 9. 1 Publication1
Alternative sequenceiVSP_045898694Missing in isoform 9. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U13896 mRNA Translation: AAA50598.1
U13897 mRNA Translation: AAA50599.1
AK294772 mRNA Translation: BAG57902.1
AK294855 mRNA Translation: BAG57959.1
EF553524 mRNA Translation: ABQ66269.1
AC068302 Genomic DNA No translation available.
AC092937 Genomic DNA No translation available.
CH471191 Genomic DNA Translation: EAW53610.1
CH471191 Genomic DNA Translation: EAW53611.1
CH471191 Genomic DNA Translation: EAW53612.1
CH471191 Genomic DNA Translation: EAW53614.1
BC140841 mRNA Translation: AAI40842.1
BC144651 mRNA Translation: AAI44652.1
CCDSiCCDS3327.1 [Q12959-2]
CCDS43194.1 [Q12959-1]
CCDS56300.1 [Q12959-8]
CCDS56301.1 [Q12959-9]
PIRiI38756
I38757
RefSeqiNP_001091894.1, NM_001098424.1 [Q12959-1]
NP_001191315.1, NM_001204386.1
NP_001191316.1, NM_001204387.1 [Q12959-9]
NP_001191317.1, NM_001204388.1 [Q12959-8]
NP_001277912.1, NM_001290983.1 [Q12959-1]
NP_004078.2, NM_004087.2 [Q12959-2]
XP_005269346.1, XM_005269289.3 [Q12959-2]
XP_011510804.1, XM_011512502.2 [Q12959-1]
XP_011510805.1, XM_011512503.1
XP_011510807.1, XM_011512505.1 [Q12959-3]
XP_011510808.1, XM_011512506.1 [Q12959-5]
XP_016861289.1, XM_017005800.1 [Q12959-2]
XP_016861290.1, XM_017005801.1 [Q12959-2]
XP_016861291.1, XM_017005802.1 [Q12959-2]
XP_016861292.1, XM_017005803.1 [Q12959-2]
XP_016861294.1, XM_017005805.1 [Q12959-1]
XP_016861295.1, XM_017005806.1 [Q12959-4]
XP_016861296.1, XM_017005807.1 [Q12959-4]
XP_016861297.1, XM_017005808.1 [Q12959-4]
XP_016861298.1, XM_017005809.1 [Q12959-4]
XP_016861299.1, XM_017005810.1
XP_016861305.1, XM_017005816.1 [Q12959-3]
XP_016861306.1, XM_017005817.1 [Q12959-3]
XP_016861307.1, XM_017005818.1 [Q12959-3]
XP_016861308.1, XM_017005819.1 [Q12959-3]
XP_016861309.1, XM_017005820.1 [Q12959-5]
UniGeneiHs.292549

Genome annotation databases

EnsembliENST00000346964; ENSP00000345731; ENSG00000075711 [Q12959-2]
ENST00000392382; ENSP00000376187; ENSG00000075711 [Q12959-3]
ENST00000419354; ENSP00000407531; ENSG00000075711 [Q12959-1]
ENST00000422288; ENSP00000413238; ENSG00000075711 [Q12959-5]
ENST00000443183; ENSP00000396658; ENSG00000075711 [Q12959-9]
ENST00000448528; ENSP00000391732; ENSG00000075711 [Q12959-1]
ENST00000450955; ENSP00000411278; ENSG00000075711 [Q12959-4]
ENST00000452595; ENSP00000398939; ENSG00000075711 [Q12959-8]
GeneIDi1739
KEGGihsa:1739
UCSCiuc003fxn.4 human [Q12959-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiDLG1_HUMAN
AccessioniPrimary (citable) accession number: Q12959
Secondary accession number(s): A5YKK7
, B4DGU1, B4DGZ8, B7ZMM0, B9EIQ5, D3DXB8, D3DXB9, E7EWL7, E9PG21, Q12958
Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: February 10, 2009
Last modified: May 23, 2018
This is version 209 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health