UniProtKB - Q12946 (FOXF1_HUMAN)
UniProt
Q12946 - FOXF1_HUMAN
Your basket is currently empty.
Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)
- BLAST>sp|Q12946|FOXF1_HUMAN Forkhead box protein F1 OS=Homo sapiens GN=FOXF1 PE=1 SV=2 MSSAPEKQQPPHGGGGGGGGGGGAAMDPASSGPSKAKKTNAGIRRPEKPPYSYIALIVMA IQSSPTKRLTLSEIYQFLQSRFPFFRGSYQGWKNSVRHNLSLNECFIKLPKGLGRPGKGH YWTIDPASEFMFEEGSFRRRPRGFRRKCQALKPMYSMMNGLGFNHLPDTYGFQGSAGGLS CPPNSLALEGGLGMMNGHLPGNVDGMALPSHSVPHLPSNGGHSYMGGCGGAAAGEYPHHD SSVPASPLLPTGAGGVMEPHAVYSGSAAAWPPSASAALNSGASYIKQQPLSPCNPAANPL SGSLSTHSLEQPYLHQNSHNAPAELQGIPRYHSQSPSMCDRKEFVFSFNAMASSSMHSAG GGSYYHQQVTYQDIKPCVM
- Align
- Format
- Add to basketAdded to basket
- History
- Other tutorials and videos
- Help video
- Feedback
Forkhead box protein F1
FOXF1
Select a section on the left to see content.
<p>Provides any useful information about the protein, mostly biological knowledge.</p><p><a href='../manual/function_section' target='_top'>More...</a></p>Functioni
Regions
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | Actions |
|---|---|---|---|---|---|---|
| <p>Specifies the position and type of each <span class="caps">DNA</span>-binding domain present within the protein.</p><p><a href='../manual/dna_bind' target='_top'>More...</a></p>DNA bindingi | 47 – 138 | 92 | Fork-headPROSITE-ProRule annotation <p>Manual validated information which has been generated by the UniProtKB automatic annotation system.</p> <p><a href="/manual/evidences#ECO:0000255">More…</a></p> Manual assertion according to rulesi |   | Add BLAST |
<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:</p><p><a href='../manual/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni
- DNA binding Source: UniProtKB
<p>Inferred from Direct Assay</p> <p>Used to indicate a direct assay for the function, process or component indicated by the GO term.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ida">GO evidence code guide</a></p> Inferred from direct assayi
- RNA polymerase II regulatory region sequence-specific DNA binding Source: NTNU_SB
<p>Inferred from Mutant Phenotype</p> <p>Describes annotations that are concluded from looking at variations or changes in a gene product such as mutations or abnormal levels and includes techniques such as knockouts, overexpression, anti-sense experiments and use of specific protein inhibitors.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#imp">GO evidence code guide</a></p> Inferred from mutant phenotypei
- sequence-specific DNA binding Source: UniProtKB
<p>Inferred from Sequence or Structural Similarity<br />Used for any analysis based on sequence alignment, structure comparison, or evaluation of sequence features such as composition.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#iss">GO evidence code guide</a></p> Inferred from sequence or structural similarityi
- transcriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding Source: NTNU_SB
<p>Inferred from Mutant Phenotype</p> <p>Describes annotations that are concluded from looking at variations or changes in a gene product such as mutations or abnormal levels and includes techniques such as knockouts, overexpression, anti-sense experiments and use of specific protein inhibitors.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#imp">GO evidence code guide</a></p> Inferred from mutant phenotypei
- transcription factor activity, RNA polymerase II distal enhancer sequence-specific binding Source: GO_Central
<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:</p><p><a href='../manual/gene_ontology' target='_top'>More...</a></p>GO - Biological processi
- blood vessel development Source: DFLAT
<p>Inferred from Mutant Phenotype</p> <p>Describes annotations that are concluded from looking at variations or changes in a gene product such as mutations or abnormal levels and includes techniques such as knockouts, overexpression, anti-sense experiments and use of specific protein inhibitors.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#imp">GO evidence code guide</a></p> Inferred from mutant phenotypei
- branching involved in open tracheal system development Source: DFLAT
<p>Inferred from Mutant Phenotype</p> <p>Describes annotations that are concluded from looking at variations or changes in a gene product such as mutations or abnormal levels and includes techniques such as knockouts, overexpression, anti-sense experiments and use of specific protein inhibitors.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#imp">GO evidence code guide</a></p> Inferred from mutant phenotypei
- cardiac left ventricle morphogenesis Source: DFLAT
<p>Inferred from Mutant Phenotype</p> <p>Describes annotations that are concluded from looking at variations or changes in a gene product such as mutations or abnormal levels and includes techniques such as knockouts, overexpression, anti-sense experiments and use of specific protein inhibitors.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#imp">GO evidence code guide</a></p> Inferred from mutant phenotypei
- cellular response to cytokine stimulus Source: Ensembl
- cellular response to organic cyclic compound Source: Ensembl
- detection of wounding Source: Ensembl
- determination of left/right symmetry Source: Ensembl
- digestive tract development Source: DFLAT
<p>Inferred from Mutant Phenotype</p> <p>Describes annotations that are concluded from looking at variations or changes in a gene product such as mutations or abnormal levels and includes techniques such as knockouts, overexpression, anti-sense experiments and use of specific protein inhibitors.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#imp">GO evidence code guide</a></p> Inferred from mutant phenotypei
- ductus arteriosus closure Source: DFLAT
<p>Inferred from Mutant Phenotype</p> <p>Describes annotations that are concluded from looking at variations or changes in a gene product such as mutations or abnormal levels and includes techniques such as knockouts, overexpression, anti-sense experiments and use of specific protein inhibitors.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#imp">GO evidence code guide</a></p> Inferred from mutant phenotypei
- embryonic digestive tract morphogenesis Source: DFLAT
<p>Inferred from Mutant Phenotype</p> <p>Describes annotations that are concluded from looking at variations or changes in a gene product such as mutations or abnormal levels and includes techniques such as knockouts, overexpression, anti-sense experiments and use of specific protein inhibitors.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#imp">GO evidence code guide</a></p> Inferred from mutant phenotypei
- embryonic ectodermal digestive tract morphogenesis Source: DFLAT
<p>Inferred from Mutant Phenotype</p> <p>Describes annotations that are concluded from looking at variations or changes in a gene product such as mutations or abnormal levels and includes techniques such as knockouts, overexpression, anti-sense experiments and use of specific protein inhibitors.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#imp">GO evidence code guide</a></p> Inferred from mutant phenotypei
- embryonic foregut morphogenesis Source: Ensembl
- endocardial cushion development Source: DFLAT
<p>Inferred from Mutant Phenotype</p> <p>Describes annotations that are concluded from looking at variations or changes in a gene product such as mutations or abnormal levels and includes techniques such as knockouts, overexpression, anti-sense experiments and use of specific protein inhibitors.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#imp">GO evidence code guide</a></p> Inferred from mutant phenotypei
- epithelial cell differentiation involved in mammary gland alveolus development Source: Ensembl
- epithelial tube branching involved in lung morphogenesis Source: Ensembl
- establishment of epithelial cell apical/basal polarity Source: Ensembl
- extracellular matrix organization Source: Ensembl
- heart development Source: DFLAT
<p>Inferred from Mutant Phenotype</p> <p>Describes annotations that are concluded from looking at variations or changes in a gene product such as mutations or abnormal levels and includes techniques such as knockouts, overexpression, anti-sense experiments and use of specific protein inhibitors.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#imp">GO evidence code guide</a></p> Inferred from mutant phenotypei
- in utero embryonic development Source: DFLAT
<p>Inferred from Mutant Phenotype</p> <p>Describes annotations that are concluded from looking at variations or changes in a gene product such as mutations or abnormal levels and includes techniques such as knockouts, overexpression, anti-sense experiments and use of specific protein inhibitors.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#imp">GO evidence code guide</a></p> Inferred from mutant phenotypei
- lateral mesodermal cell differentiation Source: Ensembl
- lung alveolus development Source: Ensembl
- lung development Source: DFLAT
<p>Inferred from Mutant Phenotype</p> <p>Describes annotations that are concluded from looking at variations or changes in a gene product such as mutations or abnormal levels and includes techniques such as knockouts, overexpression, anti-sense experiments and use of specific protein inhibitors.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#imp">GO evidence code guide</a></p> Inferred from mutant phenotypei
- lung lobe morphogenesis Source: Ensembl
- lung vasculature development Source: DFLAT
<p>Inferred from Mutant Phenotype</p> <p>Describes annotations that are concluded from looking at variations or changes in a gene product such as mutations or abnormal levels and includes techniques such as knockouts, overexpression, anti-sense experiments and use of specific protein inhibitors.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#imp">GO evidence code guide</a></p> Inferred from mutant phenotypei
- mesenchyme migration Source: Ensembl
- midgut development Source: DFLAT
<p>Inferred from Mutant Phenotype</p> <p>Describes annotations that are concluded from looking at variations or changes in a gene product such as mutations or abnormal levels and includes techniques such as knockouts, overexpression, anti-sense experiments and use of specific protein inhibitors.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#imp">GO evidence code guide</a></p> Inferred from mutant phenotypei
- morphogenesis of a branching structure Source: DFLAT
<p>Inferred from Mutant Phenotype</p> <p>Describes annotations that are concluded from looking at variations or changes in a gene product such as mutations or abnormal levels and includes techniques such as knockouts, overexpression, anti-sense experiments and use of specific protein inhibitors.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#imp">GO evidence code guide</a></p> Inferred from mutant phenotypei
- negative regulation of inflammatory response Source: Ensembl
- negative regulation of mast cell degranulation Source: Ensembl
- negative regulation of transcription from RNA polymerase II promoter Source: Ensembl
- pancreas development Source: DFLAT
<p>Inferred from Mutant Phenotype</p> <p>Describes annotations that are concluded from looking at variations or changes in a gene product such as mutations or abnormal levels and includes techniques such as knockouts, overexpression, anti-sense experiments and use of specific protein inhibitors.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#imp">GO evidence code guide</a></p> Inferred from mutant phenotypei
- positive regulation of cell migration Source: Ensembl
- positive regulation of cell-substrate adhesion Source: Ensembl
- positive regulation of mesenchymal cell proliferation Source: Ensembl
- positive regulation of transcription, DNA-templated Source: UniProtKB
<p>Inferred from Direct Assay</p> <p>Used to indicate a direct assay for the function, process or component indicated by the GO term.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ida">GO evidence code guide</a></p> Inferred from direct assayi
- positive regulation of transcription from RNA polymerase II promoter Source: NTNU_SB
<p>Inferred from Mutant Phenotype</p> <p>Describes annotations that are concluded from looking at variations or changes in a gene product such as mutations or abnormal levels and includes techniques such as knockouts, overexpression, anti-sense experiments and use of specific protein inhibitors.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#imp">GO evidence code guide</a></p> Inferred from mutant phenotypei
- regulation of smooth muscle cell differentiation Source: Ensembl
- renal system development Source: DFLAT
<p>Inferred from Mutant Phenotype</p> <p>Describes annotations that are concluded from looking at variations or changes in a gene product such as mutations or abnormal levels and includes techniques such as knockouts, overexpression, anti-sense experiments and use of specific protein inhibitors.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#imp">GO evidence code guide</a></p> Inferred from mutant phenotypei
- respiratory tube development Source: DFLAT
<p>Inferred from Mutant Phenotype</p> <p>Describes annotations that are concluded from looking at variations or changes in a gene product such as mutations or abnormal levels and includes techniques such as knockouts, overexpression, anti-sense experiments and use of specific protein inhibitors.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#imp">GO evidence code guide</a></p> Inferred from mutant phenotypei
- right lung morphogenesis Source: Ensembl
- single organismal cell-cell adhesion Source: Ensembl
- smoothened signaling pathway Source: Ensembl
- smooth muscle cell differentiation Source: Ensembl
- somitogenesis Source: Ensembl
- trachea development Source: Ensembl
- ureter development Source: DFLAT
<p>Inferred from Mutant Phenotype</p> <p>Describes annotations that are concluded from looking at variations or changes in a gene product such as mutations or abnormal levels and includes techniques such as knockouts, overexpression, anti-sense experiments and use of specific protein inhibitors.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#imp">GO evidence code guide</a></p> Inferred from mutant phenotypei
- vasculogenesis Source: Ensembl
- venous blood vessel development Source: DFLAT
<p>Inferred from Mutant Phenotype</p> <p>Describes annotations that are concluded from looking at variations or changes in a gene product such as mutations or abnormal levels and includes techniques such as knockouts, overexpression, anti-sense experiments and use of specific protein inhibitors.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#imp">GO evidence code guide</a></p> Inferred from mutant phenotypei
<p>UniProtKB Keywords constitute a <a target="_top" href="/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Molecular functioni
Activator<p>UniProtKB Keywords constitute a <a target="_top" href="/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Biological processi
Transcription, Transcription regulation<p>UniProtKB Keywords constitute a <a target="_top" href="/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Ligandi
DNA-bindingEnzyme and pathway databases
| SignaLink: a signaling pathway resource with multi-layered regulatory networks<br/><a href='/database/179'>More..</a>SignaLinki | Q12946. |
<p>Provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.</p><p><a href='../manual/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi
| <p>Provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.</p><p><a href='../manual/protein_names' target='_top'>More...</a></p>Protein namesi | Recommended name: Forkhead box protein F1Alternative name(s): Forkhead-related activator 1 Short name: FREAC-1 Forkhead-related protein FKHL5 Forkhead-related transcription factor 1 |
| <p>Indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.</p><p><a href='../manual/gene_name' target='_top'>More...</a></p>Gene namesi | Name:FOXF1 Synonyms:FKHL5, FREAC1 |
| <p>Provides information on the name(s) of the organism that is the source of the protein sequence.</p><p><a href='../manual/organism-name' target='_top'>More...</a></p>Organismi | Homo sapiens (Human) |
| <p>Shows the unique identifier assigned by the <span class="caps">NCBI</span> to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.</p><p><a href='../manual/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri | 9606 [NCBI] |
| <p>Contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.</p><p><a href='../manual/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineagei | cellular organisms › Eukaryota › Opisthokonta › Metazoa › Eumetazoa › Bilateria › Deuterostomia › Chordata › Craniata › Vertebrata › Gnathostomata › Teleostomi › Euteleostomi › Sarcopterygii › Dipnotetrapodomorpha › Tetrapoda › Amniota › Mammalia › Theria › Eutheria › Boreoeutheria › Euarchontoglires › Primates › Haplorrhini › Simiiformes › Catarrhini › Hominoidea › Hominidae › Homininae › Homo |
| <p>Is present for entries that are part of a <a href="/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.</p><p><a href='../manual/proteomes_manual' target='_top'>More...</a></p>Proteomesi |
|
Organism-specific databases
| Human Gene Nomenclature Database<br/><a href='/database/42'>More..</a>HGNCi | HGNC:3809. FOXF1. |
<p>Provides information on the location and the topology of the mature protein in the cell.</p><p><a href='../manual/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi
- Nucleus Curated
<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:</p><p><a href='../manual/gene_ontology' target='_top'>More...</a></p>GO - Cellular componenti
- nucleus Source: UniProtKB
<p>Inferred by Curator</p> <p>Used for cases where an annotation is not supported by any evidence but can be reasonably inferred by a curator from other GO annotations for which evidence <br />is available.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ic">GO evidence code guide</a></p> Inferred by curatori
- transcription factor complex Source: ProtInc
<p>Traceable Author Statement</p> <p>Used for information from review articles where the original experiments are traceable through that article and also for information from text books or dictionaries.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#tas">GO evidence code guide</a></p> Traceable author statementi
<p>UniProtKB Keywords constitute a <a target="_top" href="/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti
Nucleus<p>Provides information on the disease(s) and phenotype(s) associated with a protein.</p><p><a href='../manual/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi
<p>Provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim"><span class="caps">OMIM</span></a> database are represented with a <a href="/diseases">controlled vocabulary</a> in the following way:</p><p><a href='../manual/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei
Alveolar capillary dysplasia with misalignment of pulmonary veins (ACDMPV)3 Publications
<p>Manually curated information for which there is published experimental evidence.</p>
<p><a href="/manual/evidences#ECO:0000269">More…</a></p> Manual assertion based on experiment ini
- Ref.7"Genomic and genic deletions of the FOX gene cluster on 16q24.1 and inactivating mutations of FOXF1 cause alveolar capillary dysplasia and other malformations."
Stankiewicz P., Sen P., Bhatt S.S., Storer M., Xia Z., Bejjani B.A., Ou Z., Wiszniewska J., Driscoll D.J., Maisenbacher M.K., Bolivar J., Bauer M., Zackai E.H., McDonald-McGinn D., Nowaczyk M.M., Murray M., Hustead V., Mascotti K. , Schultz R., Hallam L., McRae D., Nicholson A.G., Newbury R., Durham-O'Donnell J., Knight G., Kini U., Shaikh T.H., Martin V., Tyreman M., Simonic I., Willatt L., Paterson J., Mehta S., Rajan D., Fitzgerald T., Gribble S., Prigmore E., Patel A., Shaffer L.G., Carter N.P., Cheung S.W., Langston C., Shaw-Smith C.
Am. J. Hum. Genet. 84:780-791(2009) [PubMed] [Europe PMC] [Abstract]Cited for: INVOLVEMENT IN ACDMPV. - Ref.8"Novel FOXF1 mutations in sporadic and familial cases of alveolar capillary dysplasia with misaligned pulmonary veins imply a role for its DNA binding domain."
Sen P., Yang Y., Navarro C., Silva I., Szafranski P., Kolodziejska K.E., Dharmadhikari A.V., Mostafa H., Kozakewich H., Kearney D., Cahill J.B., Whitt M., Bilic M., Margraf L., Charles A., Goldblatt J., Gibson K., Lantz P.E. , Garvin A.J., Petty J., Kiblawi Z., Zuppan C., McConkie-Rosell A., McDonald M.T., Peterson-Carmichael S.L., Gaede J.T., Shivanna B., Schady D., Friedlich P.S., Hays S.R., Palafoll I.V., Siebers-Renelt U., Bohring A., Finn L.S., Siebert J.R., Galambos C., Nguyen L., Riley M., Chassaing N., Vigouroux A., Rocha G., Fernandes S., Brumbaugh J., Roberts K., Ho-Ming L., Lo I.F., Lam S., Gerychova R., Jezova M., Valaskova I., Fellmann F., Afshar K., Giannoni E., Muhlethaler V., Liang J., Beckmann J.S., Lioy J., Deshmukh H., Srinivasan L., Swarr D.T., Sloman M., Shaw-Smith C., van Loon R.L., Hagman C., Sznajer Y., Barrea C., Galant C., Detaille T., Wambach J.A., Cole F.S., Hamvas A., Prince L.S., Diderich K.E., Brooks A.S., Verdijk R.M., Ravindranathan H., Sugo E., Mowat D., Baker M.L., Langston C., Welty S., Stankiewicz P.
Hum. Mutat. 34:801-811(2013) [PubMed] [Europe PMC] [Abstract]Cited for: VARIANTS ACDMPV GLN-49; SER-49; PHE-52; CYS-53; ASN-74; ILE-85; LEU-85; SER-85; TRP-86; GLU-91; VAL-91; MET-96; HIS-97; GLN-98; LEU-101; LEU-106; 113-LEU--GLY-119 DEL; ASP-119; LEU-126; LEU-139 AND TRP-330. - Ref.9"Variable phenotypic presentation of a novel FOXF1 missense mutation in a single family."
Reiter J., Szafranski P., Breuer O., Perles Z., Dagan T., Stankiewicz P., Kerem E.
Pediatr. Pulmonol. 0:0-0(2016) [PubMed] [Europe PMC] [Abstract]Cited for: VARIANT ACDMPV LEU-77.
<p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More…</a></p> Manual assertion based on experiment ini
- Ref.7"Genomic and genic deletions of the FOX gene cluster on 16q24.1 and inactivating mutations of FOXF1 cause alveolar capillary dysplasia and other malformations."
Stankiewicz P., Sen P., Bhatt S.S., Storer M., Xia Z., Bejjani B.A., Ou Z., Wiszniewska J., Driscoll D.J., Maisenbacher M.K., Bolivar J., Bauer M., Zackai E.H., McDonald-McGinn D., Nowaczyk M.M., Murray M., Hustead V., Mascotti K. , Schultz R., Hallam L., McRae D., Nicholson A.G., Newbury R., Durham-O'Donnell J., Knight G., Kini U., Shaikh T.H., Martin V., Tyreman M., Simonic I., Willatt L., Paterson J., Mehta S., Rajan D., Fitzgerald T., Gribble S., Prigmore E., Patel A., Shaffer L.G., Carter N.P., Cheung S.W., Langston C., Shaw-Smith C.
Am. J. Hum. Genet. 84:780-791(2009) [PubMed] [Europe PMC] [Abstract]Cited for: INVOLVEMENT IN ACDMPV. - Ref.8"Novel FOXF1 mutations in sporadic and familial cases of alveolar capillary dysplasia with misaligned pulmonary veins imply a role for its DNA binding domain."
Sen P., Yang Y., Navarro C., Silva I., Szafranski P., Kolodziejska K.E., Dharmadhikari A.V., Mostafa H., Kozakewich H., Kearney D., Cahill J.B., Whitt M., Bilic M., Margraf L., Charles A., Goldblatt J., Gibson K., Lantz P.E. , Garvin A.J., Petty J., Kiblawi Z., Zuppan C., McConkie-Rosell A., McDonald M.T., Peterson-Carmichael S.L., Gaede J.T., Shivanna B., Schady D., Friedlich P.S., Hays S.R., Palafoll I.V., Siebers-Renelt U., Bohring A., Finn L.S., Siebert J.R., Galambos C., Nguyen L., Riley M., Chassaing N., Vigouroux A., Rocha G., Fernandes S., Brumbaugh J., Roberts K., Ho-Ming L., Lo I.F., Lam S., Gerychova R., Jezova M., Valaskova I., Fellmann F., Afshar K., Giannoni E., Muhlethaler V., Liang J., Beckmann J.S., Lioy J., Deshmukh H., Srinivasan L., Swarr D.T., Sloman M., Shaw-Smith C., van Loon R.L., Hagman C., Sznajer Y., Barrea C., Galant C., Detaille T., Wambach J.A., Cole F.S., Hamvas A., Prince L.S., Diderich K.E., Brooks A.S., Verdijk R.M., Ravindranathan H., Sugo E., Mowat D., Baker M.L., Langston C., Welty S., Stankiewicz P.
Hum. Mutat. 34:801-811(2013) [PubMed] [Europe PMC] [Abstract]Cited for: VARIANTS ACDMPV GLN-49; SER-49; PHE-52; CYS-53; ASN-74; ILE-85; LEU-85; SER-85; TRP-86; GLU-91; VAL-91; MET-96; HIS-97; GLN-98; LEU-101; LEU-106; 113-LEU--GLY-119 DEL; ASP-119; LEU-126; LEU-139 AND TRP-330. - Ref.9"Variable phenotypic presentation of a novel FOXF1 missense mutation in a single family."
Reiter J., Szafranski P., Breuer O., Perles Z., Dagan T., Stankiewicz P., Kerem E.
Pediatr. Pulmonol. 0:0-0(2016) [PubMed] [Europe PMC] [Abstract]Cited for: VARIANT ACDMPV LEU-77.
<p>UniProtKB Keywords constitute a <a target="_top" href="/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Diseasei
Disease mutationOrganism-specific databases
| MalaCards human disease database<br/><a href='/database/196'>More..</a>MalaCardsi | FOXF1. |
| Online Mendelian Inheritance in Man (OMIM)<br/><a href='/database/62'>More..</a>MIMi | 265380. phenotype. |
| Orphanet; a database dedicated to information on rare diseases and orphan drugs<br/><a href='/database/68'>More..</a>Orphaneti | 210122. Congenital alveolar capillary dysplasia. |
| The Pharmacogenetics and Pharmacogenomics Knowledge Base<br/><a href='/database/74'>More..</a>PharmGKBi | PA28226. |
Polymorphism and mutation databases
| BioMuta curated single-nucleotide variation and disease association database<br/><a href='/database/192'>More..</a>BioMutai | FOXF1. |
| Domain mapping of disease mutations (DMDM)<br/><a href='/database/166'>More..</a>DMDMi | 238054293. |
<p>Describes post-translational modifications (PTMs) and/or processing events.</p><p><a href='../manual/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi
Molecule processing
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | Actions |
|---|---|---|---|---|---|---|
| <p>Describes the extent of a polypeptide chain in the mature protein following processing.</p><p><a href='../manual/chain' target='_top'>More...</a></p>Chaini | 1 – 379 | 379 | Forkhead box protein F1 | | PRO_0000091832 | Add BLAST |
Proteomic databases
| MaxQB - The MaxQuant DataBase<br/><a href='/database/186'>More..</a>MaxQBi | Q12946. |
| PaxDb, a database of protein abundance averages across all three domains of life<br/><a href='/database/173'>More..</a>PaxDbi | Q12946. |
| PeptideAtlas<br/><a href='/database/71'>More..</a>PeptideAtlasi | Q12946. |
| PRoteomics IDEntifications database<br/><a href='/database/130'>More..</a>PRIDEi | Q12946. |
PTM databases
| iPTMnet integrated resource for PTMs in systems biology context<br/><a href='/database/200'>More..</a>iPTMneti | Q12946. |
| Comprehensive resource for the study of human and mouse PTMs<br/><a href='/database/123'>More..</a>PhosphoSitei | Q12946. |
<p>Provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.</p><p><a href='../manual/expression_section' target='_top'>More...</a></p>Expressioni
<p>Provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’.<br />Examples: <a href="/uniprot/P92958#expression"><span class="caps">P92958</span></a>, <a href="/uniprot/Q8TDN4#expression"><span class="caps">Q8TDN4</span></a>, <a href="/uniprot/O14734#expression"><span class="caps">O14734</span></a></p><p><a href='../manual/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi
<p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More…</a></p> Manual assertion based on experiment ini
- Ref.6"Cloning and characterization of seven human forkhead proteins: binding site specificity and DNA bending."
Pierrou S., Hellqvist M., Samuelsson L., Enerbaeck S., Carlsson P.
EMBO J. 13:5002-5012(1994) [PubMed] [Europe PMC] [Abstract]Cited for: PARTIAL NUCLEOTIDE SEQUENCE [MRNA], TISSUE SPECIFICITY, DEVELOPMENTAL STAGE.
<p>Provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified ‘at the protein level’.</p><p><a href='../manual/developmental_stage' target='_top'>More...</a></p>Developmental stagei
<p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More…</a></p> Manual assertion based on experiment ini
- Ref.6"Cloning and characterization of seven human forkhead proteins: binding site specificity and DNA bending."
Pierrou S., Hellqvist M., Samuelsson L., Enerbaeck S., Carlsson P.
EMBO J. 13:5002-5012(1994) [PubMed] [Europe PMC] [Abstract]Cited for: PARTIAL NUCLEOTIDE SEQUENCE [MRNA], TISSUE SPECIFICITY, DEVELOPMENTAL STAGE.
Gene expression databases
| Bgee dataBase for Gene Expression Evolution<br/><a href='/database/133'>More..</a>Bgeei | ENSG00000103241. |
| CleanEx database of gene expression profiles<br/><a href='/database/8'>More..</a>CleanExi | HS_FOXF1. |
| Genevisible search portal to normalized and curated expression data from Genevestigator<br/><a href='/database/194'>More..</a>Genevisiblei | Q12946. HS. |
Organism-specific databases
| Human Protein Atlas<br/><a href='/database/46'>More..</a>HPAi | HPA028886. |
<p>Provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.</p><p><a href='../manual/interaction_section' target='_top'>More...</a></p>Interactioni
Protein-protein interaction databases
| The Biological General Repository for Interaction Datasets (BioGrid)<br/><a href='/database/184'>More..</a>BioGridi | 108583. 17 interactions. |
| Protein interaction database and analysis system<br/><a href='/database/51'>More..</a>IntActi | Q12946. 13 interactions. |
| STRING: functional protein association networks<br/><a href='/database/141'>More..</a>STRINGi | 9606.ENSP00000262426. |
<p>Provides information on the tertiary and secondary structure of a protein.</p><p><a href='../manual/structure_section' target='_top'>More...</a></p>Structurei
3D structure databases
| Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase<br/><a href='/database/159'>More..</a>ProteinModelPortali | Q12946. |
| SWISS-MODEL Repository - a database of annotated 3D protein structure models<br/><a href='/database/98'>More..</a>SMRi | Q12946. Positions 48-137. |
| Database of comparative protein structure models<br/><a href='/database/63'>More..</a>ModBasei | Search... |
| MobiDB: a database of protein disorder and mobility annotations<br/><a href='/database/183'>More..</a>MobiDBi | Search... |
<p>Provides information on sequence similarities with other proteins and the domain(s) present in a protein.</p><p><a href='../manual/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi
<p>Provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.</p><p><a href='../manual/domain_cc' target='_top'>More...</a></p>Domaini
<p>Provides information about the sequence similarity with other proteins.</p><p><a href='../manual/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi
<p>Manual validated information which has been generated by the UniProtKB automatic annotation system.</p> <p><a href="/manual/evidences#ECO:0000255">More…</a></p> Manual assertion according to rulesi
Phylogenomic databases
| evolutionary genealogy of genes: Non-supervised Orthologous Groups<br/><a href='/database/152'>More..</a>eggNOGi | KOG2294. Eukaryota. COG5025. LUCA. |
| Ensembl GeneTree<br/><a href='/database/162'>More..</a>GeneTreei | ENSGT00800000124014. |
| The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms<br/><a href='/database/44'>More..</a>HOGENOMi | HOG000060124. |
| The HOVERGEN Database of Homologous Vertebrate Genes<br/><a href='/database/45'>More..</a>HOVERGENi | HBG051644. |
| InParanoid: Eukaryotic Ortholog Groups<br/><a href='/database/146'>More..</a>InParanoidi | Q12946. |
| KEGG Orthology (KO)<br/><a href='/database/164'>More..</a>KOi | K09399. |
| Identification of Orthologs from Complete Genome Data<br/><a href='/database/137'>More..</a>OMAi | MTAEVQQ. |
| Database of Orthologous Groups<br/><a href='/database/143'>More..</a>OrthoDBi | EOG091G11UK. |
| Database for complete collections of gene phylogenies<br/><a href='/database/144'>More..</a>PhylomeDBi | Q12946. |
| TreeFam database of animal gene trees<br/><a href='/database/185'>More..</a>TreeFami | TF351598. |
Family and domain databases
| Gene3D Structural and Functional Annotation of Protein Families<br/><a href='/database/29'>More..</a>Gene3Di | 1.10.10.10. 1 hit. |
| Integrated resource of protein families, domains and functional sites<br/><a href='/database/52'>More..</a>InterProi | IPR001766. Fork_head_dom. IPR018122. TF_fork_head_CS_1. IPR030456. TF_fork_head_CS_2. IPR011991. WHTH_DNA-bd_dom. [Graphical view] |
| Pfam protein domain database<br/><a href='/database/73'>More..</a>Pfami | PF00250. Forkhead. 1 hit. [Graphical view] |
| Protein Motif fingerprint database; a protein domain database<br/><a href='/database/82'>More..</a>PRINTSi | PR00053. FORKHEAD. |
| Simple Modular Architecture Research Tool; a protein domain database<br/><a href='/database/97'>More..</a>SMARTi | SM00339. FH. 1 hit. [Graphical view] |
| Superfamily database of structural and functional annotation<br/><a href='/database/155'>More..</a>SUPFAMi | SSF46785. SSF46785. 1 hit. |
| PROSITE; a protein domain and family database<br/><a href='/database/84'>More..</a>PROSITEi | PS00657. FORK_HEAD_1. 1 hit. PS00658. FORK_HEAD_2. 1 hit. PS50039. FORK_HEAD_3. 1 hit. [Graphical view] |
<p>Displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including length and molecular weight.</p><p><a href='../manual/sequences_section' target='_top'>More...</a></p>Sequencei
<p>Indicates if the <a href="/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.</p><p><a href='../manual/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.
10 20 30 40 50
MSSAPEKQQP PHGGGGGGGG GGGAAMDPAS SGPSKAKKTN AGIRRPEKPP
60 70 80 90 100
YSYIALIVMA IQSSPTKRLT LSEIYQFLQS RFPFFRGSYQ GWKNSVRHNL
110 120 130 140 150
SLNECFIKLP KGLGRPGKGH YWTIDPASEF MFEEGSFRRR PRGFRRKCQA
160 170 180 190 200
LKPMYSMMNG LGFNHLPDTY GFQGSAGGLS CPPNSLALEG GLGMMNGHLP
210 220 230 240 250
GNVDGMALPS HSVPHLPSNG GHSYMGGCGG AAAGEYPHHD SSVPASPLLP
260 270 280 290 300
TGAGGVMEPH AVYSGSAAAW PPSASAALNS GASYIKQQPL SPCNPAANPL
310 320 330 340 350
SGSLSTHSLE QPYLHQNSHN APAELQGIPR YHSQSPSMCD RKEFVFSFNA
360 370
MASSSMHSAG GGSYYHQQVT YQDIKPCVM
<p>Reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.</p><p><a href='../manual/sequence_caution' target='_top'>More...</a></p>Sequence cautioni
Natural variant
Sequence databases
|
Select the link destinations: EMBL nucleotide sequence database<br/><a href='/database/22'>More..</a>EMBLi GenBank nucleotide sequence database<br/><a href='/database/28'>More..</a>GenBanki DNA Data Bank of Japan; a nucleotide sequence database<br/><a href='/database/14'>More..</a>DDBJi Links Updated | U13219 mRNA. Translation: AAC50399.1. Different initiation. AF085343, AF085342 Genomic DNA. Translation: AAC61576.1. Different initiation. AK314167 mRNA. Translation: BAG36851.1. Frameshift. AC009108 Genomic DNA. No translation available. BC089442 mRNA. Translation: AAH89442.1. Different initiation. |
| The Consensus CDS (CCDS) project<br/><a href='/database/187'>More..</a>CCDSi | CCDS10957.2. |
| Protein sequence database of the Protein Information Resource<br/><a href='/database/78'>More..</a>PIRi | S51624. |
| NCBI Reference Sequences<br/><a href='/database/117'>More..</a>RefSeqi | NP_001442.2. NM_001451.2. |
| UniGene gene-oriented nucleotide sequence clusters<br/><a href='/database/107'>More..</a>UniGenei | Hs.155591. Hs.690163. |
Genome annotation databases
| Ensembl eukaryotic genome annotation project<br/><a href='/database/23'>More..</a>Ensembli | ENST00000262426; ENSP00000262426; ENSG00000103241. |
| Database of genes from NCBI RefSeq genomes<br/><a href='/database/118'>More..</a>GeneIDi | 2294. |
| KEGG: Kyoto Encyclopedia of Genes and Genomes<br/><a href='/database/53'>More..</a>KEGGi | hsa:2294. |
| UCSC genome browser<br/><a href='/database/139'>More..</a>UCSCi | uc002fjl.4. human. |
<p>Is used to point to information related to entries and found in data collections other than UniProtKB.</p><p><a href='../manual/cross_references_section' target='_top'>More...</a></p>Cross-referencesi
<p>Provides links to various web resources that are relevant for a specific protein.</p><p><a href='../manual/web_resource' target='_top'>More...</a></p>Web resourcesi
| Atlas of Genetics and Cytogenetics in Oncology and Haematology |
Sequence databases
|
Select the link destinations: EMBL nucleotide sequence database<br/><a href='/database/22'>More..</a>EMBLi GenBank nucleotide sequence database<br/><a href='/database/28'>More..</a>GenBanki DNA Data Bank of Japan; a nucleotide sequence database<br/><a href='/database/14'>More..</a>DDBJi Links Updated | U13219 mRNA. Translation: AAC50399.1. Different initiation. AF085343, AF085342 Genomic DNA. Translation: AAC61576.1. Different initiation. AK314167 mRNA. Translation: BAG36851.1. Frameshift. AC009108 Genomic DNA. No translation available. BC089442 mRNA. Translation: AAH89442.1. Different initiation. |
| The Consensus CDS (CCDS) project<br/><a href='/database/187'>More..</a>CCDSi | CCDS10957.2. |
| Protein sequence database of the Protein Information Resource<br/><a href='/database/78'>More..</a>PIRi | S51624. |
| NCBI Reference Sequences<br/><a href='/database/117'>More..</a>RefSeqi | NP_001442.2. NM_001451.2. |
| UniGene gene-oriented nucleotide sequence clusters<br/><a href='/database/107'>More..</a>UniGenei | Hs.155591. Hs.690163. |
3D structure databases
| Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase<br/><a href='/database/159'>More..</a>ProteinModelPortali | Q12946. |
| SWISS-MODEL Repository - a database of annotated 3D protein structure models<br/><a href='/database/98'>More..</a>SMRi | Q12946. Positions 48-137. |
| Database of comparative protein structure models<br/><a href='/database/63'>More..</a>ModBasei | Search... |
| MobiDB: a database of protein disorder and mobility annotations<br/><a href='/database/183'>More..</a>MobiDBi | Search... |
Protein-protein interaction databases
| The Biological General Repository for Interaction Datasets (BioGrid)<br/><a href='/database/184'>More..</a>BioGridi | 108583. 17 interactions. |
| Protein interaction database and analysis system<br/><a href='/database/51'>More..</a>IntActi | Q12946. 13 interactions. |
| STRING: functional protein association networks<br/><a href='/database/141'>More..</a>STRINGi | 9606.ENSP00000262426. |
PTM databases
| iPTMnet integrated resource for PTMs in systems biology context<br/><a href='/database/200'>More..</a>iPTMneti | Q12946. |
| Comprehensive resource for the study of human and mouse PTMs<br/><a href='/database/123'>More..</a>PhosphoSitei | Q12946. |
Polymorphism and mutation databases
| BioMuta curated single-nucleotide variation and disease association database<br/><a href='/database/192'>More..</a>BioMutai | FOXF1. |
| Domain mapping of disease mutations (DMDM)<br/><a href='/database/166'>More..</a>DMDMi | 238054293. |
Proteomic databases
| MaxQB - The MaxQuant DataBase<br/><a href='/database/186'>More..</a>MaxQBi | Q12946. |
| PaxDb, a database of protein abundance averages across all three domains of life<br/><a href='/database/173'>More..</a>PaxDbi | Q12946. |
| PeptideAtlas<br/><a href='/database/71'>More..</a>PeptideAtlasi | Q12946. |
| PRoteomics IDEntifications database<br/><a href='/database/130'>More..</a>PRIDEi | Q12946. |
Protocols and materials databases
| The DNASU plasmid repository<br/><a href='/database/167'>More..</a>DNASUi | 2294. |
| Structural Biology Knowledgebase | Search... |
Genome annotation databases
| Ensembl eukaryotic genome annotation project<br/><a href='/database/23'>More..</a>Ensembli | ENST00000262426; ENSP00000262426; ENSG00000103241. |
| Database of genes from NCBI RefSeq genomes<br/><a href='/database/118'>More..</a>GeneIDi | 2294. |
| KEGG: Kyoto Encyclopedia of Genes and Genomes<br/><a href='/database/53'>More..</a>KEGGi | hsa:2294. |
| UCSC genome browser<br/><a href='/database/139'>More..</a>UCSCi | uc002fjl.4. human. |
Organism-specific databases
| Comparative Toxicogenomics Database<br/><a href='/database/140'>More..</a>CTDi | 2294. |
| GeneCards: human genes, protein and diseases<br/><a href='/database/30'>More..</a>GeneCardsi | FOXF1. |
| Human Gene Nomenclature Database<br/><a href='/database/42'>More..</a>HGNCi | HGNC:3809. FOXF1. |
| Human Protein Atlas<br/><a href='/database/46'>More..</a>HPAi | HPA028886. |
| MalaCards human disease database<br/><a href='/database/196'>More..</a>MalaCardsi | FOXF1. |
| Online Mendelian Inheritance in Man (OMIM)<br/><a href='/database/62'>More..</a>MIMi | 265380. phenotype. 601089. gene. |
| neXtProt; the human protein knowledge platform<br/><a href='/database/161'>More..</a>neXtProti | NX_Q12946. |
| Orphanet; a database dedicated to information on rare diseases and orphan drugs<br/><a href='/database/68'>More..</a>Orphaneti | 210122. Congenital alveolar capillary dysplasia. |
| The Pharmacogenetics and Pharmacogenomics Knowledge Base<br/><a href='/database/74'>More..</a>PharmGKBi | PA28226. |
| GenAtlas: human gene database<br/><a href='/database/27'>More..</a>GenAtlasi | Search... |
Phylogenomic databases
| evolutionary genealogy of genes: Non-supervised Orthologous Groups<br/><a href='/database/152'>More..</a>eggNOGi | KOG2294. Eukaryota. COG5025. LUCA. |
| Ensembl GeneTree<br/><a href='/database/162'>More..</a>GeneTreei | ENSGT00800000124014. |
| The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms<br/><a href='/database/44'>More..</a>HOGENOMi | HOG000060124. |
| The HOVERGEN Database of Homologous Vertebrate Genes<br/><a href='/database/45'>More..</a>HOVERGENi | HBG051644. |
| InParanoid: Eukaryotic Ortholog Groups<br/><a href='/database/146'>More..</a>InParanoidi | Q12946. |
| KEGG Orthology (KO)<br/><a href='/database/164'>More..</a>KOi | K09399. |
| Identification of Orthologs from Complete Genome Data<br/><a href='/database/137'>More..</a>OMAi | MTAEVQQ. |
| Database of Orthologous Groups<br/><a href='/database/143'>More..</a>OrthoDBi | EOG091G11UK. |
| Database for complete collections of gene phylogenies<br/><a href='/database/144'>More..</a>PhylomeDBi | Q12946. |
| TreeFam database of animal gene trees<br/><a href='/database/185'>More..</a>TreeFami | TF351598. |
Enzyme and pathway databases
| SignaLink: a signaling pathway resource with multi-layered regulatory networks<br/><a href='/database/179'>More..</a>SignaLinki | Q12946. |
Miscellaneous databases
| The Gene Wiki collection of pages on human genes and proteins<br/><a href='/database/180'>More..</a>GeneWikii | FOXF1. |
| Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens<br/><a href='/database/169'>More..</a>GenomeRNAii | 2294. |
| Protein Ontology<br/><a href='/database/181'>More..</a>PROi | Q12946. |
| The Stanford Online Universal Resource for Clones and ESTs<br/><a href='/database/99'>More..</a>SOURCEi | Search... |
Gene expression databases
| Bgee dataBase for Gene Expression Evolution<br/><a href='/database/133'>More..</a>Bgeei | ENSG00000103241. |
| CleanEx database of gene expression profiles<br/><a href='/database/8'>More..</a>CleanExi | HS_FOXF1. |
| Genevisible search portal to normalized and curated expression data from Genevestigator<br/><a href='/database/194'>More..</a>Genevisiblei | Q12946. HS. |
Family and domain databases
| Gene3D Structural and Functional Annotation of Protein Families<br/><a href='/database/29'>More..</a>Gene3Di | 1.10.10.10. 1 hit. |
| Integrated resource of protein families, domains and functional sites<br/><a href='/database/52'>More..</a>InterProi | IPR001766. Fork_head_dom. IPR018122. TF_fork_head_CS_1. IPR030456. TF_fork_head_CS_2. IPR011991. WHTH_DNA-bd_dom. [Graphical view] |
| Pfam protein domain database<br/><a href='/database/73'>More..</a>Pfami | PF00250. Forkhead. 1 hit. [Graphical view] |
| Protein Motif fingerprint database; a protein domain database<br/><a href='/database/82'>More..</a>PRINTSi | PR00053. FORKHEAD. |
| Simple Modular Architecture Research Tool; a protein domain database<br/><a href='/database/97'>More..</a>SMARTi | SM00339. FH. 1 hit. [Graphical view] |
| Superfamily database of structural and functional annotation<br/><a href='/database/155'>More..</a>SUPFAMi | SSF46785. SSF46785. 1 hit. |
| PROSITE; a protein domain and family database<br/><a href='/database/84'>More..</a>PROSITEi | PS00657. FORK_HEAD_1. 1 hit. PS00658. FORK_HEAD_2. 1 hit. PS50039. FORK_HEAD_3. 1 hit. [Graphical view] |
| ProtoNet; Automatic hierarchical classification of proteins<br/><a href='/database/85'>More..</a>ProtoNeti | Search... |
<p>Provides general information on the entry.</p><p><a href='../manual/entry_information_section' target='_top'>More...</a></p>Entry informationi
| <p>Provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.</p><p><a href='../manual/entry_name' target='_top'>More...</a></p>Entry namei | FOXF1_HUMAN | ||||||||
| <p>Provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.</p><p><a href='../manual/accession_numbers' target='_top'>More...</a></p>Accessioni | Q12946Primary (citable) accession number: Q12946 Secondary accession number(s): B2RAF4, Q5FWE5 | ||||||||
| <p>Shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="help/canonical_and_isoforms">canonical sequence</a> are also displayed.</p><p><a href='../manual/entry_history' target='_top'>More...</a></p>Entry historyi |
| ||||||||
| <p>Indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).</p><p><a href='../manual/entry_status' target='_top'>More...</a></p>Entry statusi | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
<p>Contains any relevant information that doesn’t fit in any other defined sections</p><p><a href='../manual/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi
Caution
<p>UniProtKB Keywords constitute a <a target="_top" href="/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Technical termi
Complete proteome, Reference proteomeDocuments
- Human chromosome 16Human chromosome 16: entries, gene names and cross-references to MIM
- Human entries with polymorphisms or disease mutationsList of human entries with polymorphisms or disease mutations
- Human polymorphisms and disease mutationsIndex of human polymorphisms and disease mutations
- MIM cross-referencesOnline Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
- SIMILARITY commentsIndex of protein domains and families
<p>Provides links to the UniProt Reference Clusters (<a href="/help/uniref">UniRef</a>). UniRef consists of clusters for UniProtKB sequences (including isoforms) and selected UniParc sequences, in order to obtain complete coverage of the sequence space at resolutions of 100%, 90% and 50% identity.</p><p><a href='../manual/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi
Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:| 100% | UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry. |
| 90% | UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence). |
| 50% | UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster. |