Reviewed,
UniProtKB/Swiss-Prot Q12933 (TRAF2_HUMAN)
Last modified
November 3, 2009.
Version 122.
History...
Clusters with 100%,
90%,
50% identity |
Documents (5) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: TNF receptor-associated factor 2 Alternative name(s): Tumor necrosis factor type 2 receptor-associated protein 3 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Complete proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 501 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Adapter protein and signal transducer that links members of the tumor necrosis factor receptor family to different signaling pathways by association with the receptor cytoplasmic domain and kinases. Association to the receptor is also mediated by the interaction with TRADD. Mediates activation of NF-kappa-B and JNK and is involved in apoptosis. The TRAF1/TRAF2 complex recruits the apoptotic suppressors BIRC2 and BIRC3 to TNFRSF1B/TNFR2. Seems to be involved in IL-15 signaling. |
| Subunit structure | Homotrimer Probable. Heteromer with TRAF1. Binds to TNFRSF1B/TNFR2, TNFRSF4 and TNFRSF5/CD40. Associates with CD27, TNFRSF8/CD30, TNFRSF9/CD137, TNFRSF11A/RANK, TNFRSF13B/TACI. TNFRSF14, TNFRSF16/NGFR, TNFRSF17/BCMA, TNFRSF18/AITR, TNFRSF19/TROY, TNFRSF19L/RELT, XEDAR, EDAR, Epstein-Barr virus BNFL1/LMP-1, IL15RA, TANK/ITRAF, RIPK2, TNIK, MAP3K14, MAP3K5, MAP3K1, MAP4K2, CDK9, CSK, and TRAF-interacting protein TRAIP and TRAF and TNF receptor associated protein TTRAP. Interacts with TNFAIP3 and TRPC4AP. Interacts with PEG3 By similarity. Binds to TRADD. Interacts with BIRC2 and BIRC3 N-terminus. Interacts with CYLD and TBK1. Interacts with MAVS/IPS1. Interacts with CASP8AP2 and USP48. Interacts with DAB2IP. Interacts wtih NFATC2IP and with HIVEP3 By similarity. |
| Subcellular location | |
| Domain | The coiled coil domain mediates homo- and hetero-oligomerization. The MATH/TRAF domain binds to receptor cytoplasmic domains. |
| Post-translational modification | Ubiquitinated; mediated by SIAH2 and leading to its subsequent proteasomal degradation. Not ubiquitinated by SIAH1. Ref.32 |
| Sequence similarities | Contains 1 MATH domain. Contains 1 RING-type zinc finger. Contains 2 TRAF-type zinc fingers. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| ATXN1 | P54253 | 1 | EBI-355744,EBI-930964 | |
| BIRC2 | Q13490 | 3 | EBI-355744,EBI-514538 | |
| BIRC3 | Q13489 | 2 | EBI-355744,EBI-517709 | |
| CD27 | P26842 | 2 | EBI-355744,EBI-520729 | |
| GSTP1 | P09211 | 3 | EBI-355744,EBI-353467 | |
| MAP3K1 | Q13233 | 1 | EBI-355744,EBI-49776 | |
| MAP3K5 | Q99683 | 1 | EBI-355744,EBI-476263 | |
| RHEB | Q15382 | 1 | EBI-355744,EBI-1055287 | |
| RHEBL1 | Q8TAI7 | 1 | EBI-355744,EBI-746555 | |
| TNFRSF11A | Q9Y6Q6 | 1 | EBI-355744,EBI-525675 | |
| TNFRSF14 | Q92956 | 4 | EBI-355760,EBI-1056653 | |
| TNFRSF19 | Q9NS68 | 1 | EBI-355744,EBI-530381 | |
| TNFRSF1B | P20333 | 2 | EBI-355744,EBI-358983 | |
| Tnfrsf4 | P47741 | 1 | EBI-355744,EBI-520001 | From a different organism. |
| Tnfrsf9 | P20334 | 1 | EBI-355744,EBI-520693 | From a different organism. |
| TRADD | Q15628 | 1 | EBI-355744,EBI-359215 |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q12933-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q12933-2) The sequence of this isoform differs from the canonical sequence as follows: 122-122: E → EVKMPACGMVTEAPAVGSRPRSPSSYDLVLHVPLTGAEACLMSVEEETELLLR | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 501 | 501 | TNF receptor-associated factor 2 | PRO_0000056399 | |||||||||||||||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||||||||||||||
| Domain | 351 – 496 | 146 | MATH | ||||||||||||||||||||||||||||||||||||||
| Zinc finger | 34 – 73 | 40 | RING-type | ||||||||||||||||||||||||||||||||||||||
| Zinc finger | 124 – 180 | 57 | TRAF-type 1 | ||||||||||||||||||||||||||||||||||||||
| Zinc finger | 177 – 233 | 57 | TRAF-type 2 | ||||||||||||||||||||||||||||||||||||||
| Coiled coil | 299 – 348 | 50 | Potential | ||||||||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 122 | 1 | E → EVKMPACGMVTEAPAVGSRP RSPSSYDLVLHVPLTGAEAC LMSVEEETELLLR in isoform 2. | VSP_007401 | |||||||||||||||||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 205 – 310 | 106 | Missing Ref.2 | ||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 343 – 365 | 23 | LEMEA…FARKR → RPFQAQCGHRYCSFCLASIL RKL in AAA87706. Ref.1 | ||||||||||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||||||||
| Helix | 315 – 318 | 4 | |||||||||||||||||||||||||||||||||||||||
| Helix | 335 – 347 | 13 | |||||||||||||||||||||||||||||||||||||||
| Beta strand | 350 – 360 | 11 | |||||||||||||||||||||||||||||||||||||||
| Helix | 361 – 369 | 9 | |||||||||||||||||||||||||||||||||||||||
| Beta strand | 381 – 384 | 4 | |||||||||||||||||||||||||||||||||||||||
| Beta strand | 389 – 395 | 7 | |||||||||||||||||||||||||||||||||||||||
| Helix | 400 – 402 | 3 | |||||||||||||||||||||||||||||||||||||||
| Turn | 403 – 405 | 3 | |||||||||||||||||||||||||||||||||||||||
| Beta strand | 406 – 414 | 9 | |||||||||||||||||||||||||||||||||||||||
| Helix | 419 – 421 | 3 | |||||||||||||||||||||||||||||||||||||||
| Beta strand | 430 – 434 | 5 | |||||||||||||||||||||||||||||||||||||||
| Beta strand | 443 – 447 | 5 | |||||||||||||||||||||||||||||||||||||||
| Helix | 454 – 456 | 3 | |||||||||||||||||||||||||||||||||||||||
| Beta strand | 460 – 463 | 4 | |||||||||||||||||||||||||||||||||||||||
| Beta strand | 467 – 474 | 8 | |||||||||||||||||||||||||||||||||||||||
| Turn | 475 – 480 | 6 | |||||||||||||||||||||||||||||||||||||||
| Turn | 482 – 484 | 3 | |||||||||||||||||||||||||||||||||||||||
| Beta strand | 489 – 496 | 8 | |||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Association of a RING finger protein with the cytoplasmic domain of the human type-2 tumour necrosis factor receptor." Song H.Y., Donner D.B. Biochem. J. 309:825-829(1995) [PubMed: 7639698] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA]. |
| [2] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA]. Tissue: Cerebellum. |
| [3] | SeattleSNPs variation discovery resource Submitted (MAY-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA]. Tissue: Colon, Fetal brain, Kidney, Leukocyte, Stomach and Uterus. |
| [5] | "A novel family of putative signal transducers associated with the cytoplasmic domain of the 75 kDa tumor necrosis factor receptor." Rothe M., Wong S.C., Henzel W.J., Goeddel D.V. Cell 78:681-692(1994) [PubMed: 8069916] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 201-501, INTERACTION WITH TRAF1 AND TNFRSF1B. |
| [6] | "NF-kB activation by a signaling complex containing TRAF2, TANK, and TBK1, a novel IKK-related kinase." Pomerantz J.L., Baltimore D. EMBO J. 18:6694-6704(1999) [PubMed: 10581243] [Abstract] Cited for: INTERACTION WITH TBK1. Tissue: Spleen. |
| [7] | "The TNF-receptor-associated factor family: scaffold molecules for cytokine receptors, kinases and their regulators." Wajant H., Henkler F., Scheurich P. Cell. Signal. 13:389-400(2001) [PubMed: 11384837] [Abstract] Cited for: REVIEW. |
| [8] | "Tumor necrosis factor receptor-associated factors (TRAFs)." Bradley J.R., Pober J.S. Oncogene 20:6482-6491(2001) [PubMed: 11607847] [Abstract] Cited for: REVIEW. |
| [9] | "T cell receptor-dependent cell death of T cell hybridomas mediated by the CD30 cytoplasmic domain in association with tumor necrosis factor receptor-associated factors." Lee S.Y., Park C.G., Choi Y. J. Exp. Med. 183:669-674(1996) [PubMed: 8627180] [Abstract] Cited for: INTERACTION WITH TNFRSF8. |
| [10] | "I-TRAF is a novel TRAF-interacting protein that regulates TRAF-mediated signal transduction." Rothe M., Xiong J., Shu H.-B., Williamson K., Goddard A., Goeddel D.V. Proc. Natl. Acad. Sci. U.S.A. 93:8241-8246(1996) [PubMed: 8710854] [Abstract] Cited for: INTERACTION WITH TANK. |
| [11] | "ATAR, a novel tumor necrosis factor receptor family member, signals through TRAF2 and TRAF5." Hsu H., Solovyev I., Colombero A., Elliott R., Kelley M., Boyle W.J. J. Biol. Chem. 272:13471-13474(1997) [PubMed: 9153189] [Abstract] Cited for: INTERACTION WITH TNFRSF14. |
| [12] | "TRAF-interacting protein (TRIP): a novel component of the tumor necrosis factor receptor (TNFR)- and CD30-TRAF signaling complexes that inhibits TRAF2-mediated NF-kappaB activation." Lee S.Y., Lee S.Y., Choi Y. J. Exp. Med. 185:1275-1285(1997) [PubMed: 9104814] [Abstract] Cited for: INTERACTION WITH TRIP. |
| [13] | "MAP3K-related kinase involved in NF-kappaB induction by TNF, CD95 and IL-1." Malinin N.L., Boldin M.P., Kovalenko A.V., Wallach D. Nature 385:540-544(1997) [PubMed: 9020361] [Abstract] Cited for: INTERACTION WITH MAP3K14. |
| [14] | "CD40-tumor necrosis factor receptor-associated factor (TRAF) interactions: regulation of CD40 signaling through multiple TRAF binding sites and TRAF hetero-oligomerization." Pullen S.S., Miller H.G., Everdeen D.S., Dang T.T., Crute J.J., Kehry M.R. Biochemistry 37:11836-11845(1998) [PubMed: 9718306] [Abstract] Cited for: INTERACTION WITH TNFRSF5. |
| [15] | "Identification of CARDIAK, a RIP-like kinase that associates with caspase-1." Thome M., Hofmann K., Burns K., Martinon F., Bodmer J.-L., Mattmann C., Tschopp J. Curr. Biol. 8:885-888(1998) [PubMed: 9705938] [Abstract] Cited for: INTERACTION WITH RIPK2. |
| [16] | "The TNF receptor family member CD27 signals to Jun N-terminal kinase via Traf-2." Gravestein L.A., Amsen D., Boes M., Calvo C.R., Kruisbeek A.M., Borst J. Eur. J. Immunol. 28:2208-2216(1998) [PubMed: 9692890] [Abstract] Cited for: INTERACTION WITH CD27. |
| [17] | "4-1BB and Ox40 are members of a tumor necrosis factor (TNF)-nerve growth factor receptor subfamily that bind TNF receptor-associated factors and activate nuclear factor kappaB." Arch R.H., Thompson C.B. Mol. Cell. Biol. 18:558-565(1998) [PubMed: 9418902] [Abstract] Cited for: INTERACTION WITH TNFRSF4 AND TNFRSF9. |
| [18] | "Activation of OX40 signal transduction pathways leads to tumor necrosis factor receptor-associated factor (TRAF) 2- and TRAF5-mediated NF-kappaB activation." Kawamata S., Hori T., Imura A., Takaori-Kondo A., Uchiyama T. J. Biol. Chem. 273:5808-5814(1998) [PubMed: 9488716] [Abstract] Cited for: INTERACTION WITH TNFRSF4. |
| [19] | "The TRAF family of signal transducers mediates NF-kappaB activation by the TRANCE receptor." Wong B.R., Josien R., Lee S.Y., Vologodskaia M., Steinman R.M., Choi Y. J. Biol. Chem. 273:28355-28359(1998) [PubMed: 9774460] [Abstract] Cited for: INTERACTION WITH TNFRSF11A. |
| [20] | "CD28-independent, TRAF2-dependent costimulation of resting T cells by 4-1BB ligand." Saoulli K., Lee S.Y., Cannons J.L., Yeh W.C., Santana A., Goldstein M.D., Bangia N., DeBenedette M.A., Mak T.W., Choi Y., Watts T.H. J. Exp. Med. 187:1849-1862(1998) [PubMed: 9607925] [Abstract] Cited for: INTERACTION WITH TNFRSF9. |
| [21] | "ASK1 is essential for JNK/SAPK activation by TRAF2." Nishitoh H., Saitoh M., Mochida Y., Takeda K., Nakano H., Rothe M., Miyazono K., Ichijo H. Mol. Cell 2:389-395(1998) [PubMed: 9774977] [Abstract] Cited for: INTERACTION WITH MAP3K5. |
| [22] | "Death deflected: IL-15 inhibits TNF-alpha-mediated apoptosis in fibroblasts by TRAF2 recruitment to the IL-15Ralpha chain." Bulfone-Paus S., Bulanova E., Pohl T., Budagian V., Duerkop H., Rueckert R., Kunzendorf U., Paus R., Krause H. FASEB J. 13:1575-1585(1999) [PubMed: 10463949] [Abstract] Cited for: INTERACTION WITH IL15RA. |
| [23] | "Identification of a novel activation-inducible protein of the tumor necrosis factor receptor superfamily and its ligand." Kwon B., Yu K.-Y., Ni J., Yu G.-L., Jang I.-K., Kim Y.-J., Xing L., Liu D., Wang S.-X., Kwon B.S. J. Biol. Chem. 274:6056-6061(1999) [PubMed: 10037686] [Abstract] Cited for: INTERACTION WITH TNFRSF18. Tissue: T-cell. |
| [24] | "TRAF family proteins interact with the common neurotrophin receptor and modulate apoptosis induction." Ye X., Mehlen P., Rabizadeh S., VanArsdale T., Zhang H., Shin H., Wang J.J.L., Leo E., Zapata J.M., Hauser C.A., Reed J.C., Bredesen D.E. J. Biol. Chem. 274:30202-30208(1999) [PubMed: 10514511] [Abstract] Cited for: INTERACTION WITH TNFRSF16. |
| [25] | "TNIK, a novel member of the germinal center kinase family that activates the c-Jun N-terminal kinase pathway and regulates the cytoskeleton." Fu C.A., Shen M., Huang B.C., Lasaga J., Payan D.G., Luo Y. J. Biol. Chem. 274:30729-30737(1999) [PubMed: 10521462] [Abstract] Cited for: INTERACTION WITH TNIK. |
| [26] | "Binding of CDK9 to TRAF2." MacLachlan T.K., Sang N., De Luca A., Puri P.L., Levrero M., Giordano A. J. Cell. Biochem. 71:467-478(1998) [PubMed: 9827693] [Abstract] Cited for: INTERACTION WITH CDK9. |
| [27] | "TAJ, a novel member of the tumor necrosis factor receptor family, activates the c-Jun N-terminal kinase pathway and mediates caspase-independent cell death." Eby M.T., Jasmin A., Kumar A., Sharma K., Chaudhary P.M. J. Biol. Chem. 275:15336-15342(2000) [PubMed: 10809768] [Abstract] Cited for: INTERACTION WITH TNFRSF19. |
| [28] | "TACI is a TRAF-interacting receptor for TALL-1, a tumor necrosis factor family member involved in B cell regulation." Xia X.-Z., Treanor J., Senaldi G., Khare S.D., Boone T., Kelley M., Theill L.E., Colombero A., Solovyev I., Lee F., McCabe S., Elliott R., Miner K., Hawkins N., Guo J., Stolina M., Yu G., Wang J. Hsu H.J. Exp. Med. 192:137-143(2000) [PubMed: 10880535] [Abstract] Cited for: INTERACTION WITH TNFRSF13B. |
| [29] | "Direct activation of mitogen-activated protein kinase kinase kinase MEKK1 by the Ste20p homologue GCK and the adapter protein TRAF2." Chadee D.N., Yuasa T., Kyriakis J.M. Mol. Cell. Biol. 22:737-749(2002) [PubMed: 11784851] [Abstract] Cited for: INTERACTION WITH MAP4K2. |
| [30] | "Signaling by proinflammatory cytokines: oligomerization of TRAF2 and TRAF6 is sufficient for JNK and IKK activation and target gene induction via an amino-terminal effector domain." Baud V., Liu Z.-G., Bennett B., Suzuki N., Xia Y., Karin M. Genes Dev. 13:1297-1308(1999) [PubMed: 10346818] [Abstract] Cited for: INTERACTION WITH MAP3K1. |
| [31] | "TTRAP, a novel protein that associates with CD40, tumor necrosis factor (TNF) receptor-75 and TNF receptor-associated factors (TRAFs), and that inhibits nuclear factor-kappa B activation." Pype S., Declercq W., Ibrahimi A., Michiels C., Van Rietschoten J.G.I., Dewulf N., de Boer M., Vandenabeele P., Huylebroeck D., Remacle J.E. J. Biol. Chem. 275:18586-18593(2000) [PubMed: 10764746] [Abstract] Cited for: INTERACTION WITH TTRAP. |
| [32] | "Stress-induced decrease in TRAF2 stability is mediated by Siah2." Habelhah H., Frew I.J., Laine A., Janes P.W., Relaix F., Sassoon D., Bowtell D.D.L., Ronai Z. EMBO J. 21:5756-5765(2002) [PubMed: 12411493] [Abstract] Cited for: INTERACTION WITH SIAH2, DEGRADATION. |
| [33] | "The tumour suppressor CYLD negatively regulates NF-kappaB signalling by deubiquitination." Kovalenko A., Chable-Bessia C., Cantarella G., Israeel A., Wallach D., Courtois G. Nature 424:801-805(2003) [PubMed: 12917691] [Abstract] Cited for: INTERACTION WITH CYLD. |
| [34] | "AIP1/DAB2IP, a novel member of the Ras-GAP family, transduces TRAF2-induced ASK1-JNK activation." Zhang H., Zhang R., Luo Y., D'Alessio A., Pober J.S., Min W. J. Biol. Chem. 279:44955-44965(2004) [PubMed: 15310755] [Abstract] Cited for: INTERACTION WITH DAB2IP. |
| [35] | "VISA is an adapter protein required for virus-triggered IFN-beta Signaling." Xu L.-G., Wang Y.-Y., Han K.-J., Li L.-Y., Zhai Z., Shu H.-B. Mol. Cell 19:727-740(2005) [PubMed: 16153868] [Abstract] Cited for: INTERACTION WITH MAVS. |
| [36] | "Human ubiquitin specific protease 31 is a deubiquitinating enzyme implicated in activation of nuclear factor-kappaB." Tzimas C., Michailidou G., Arsenakis M., Kieff E., Mosialos G., Hatzivassiliou E.G. Cell. Signal. 18:83-92(2006) [PubMed: 16214042] [Abstract] Cited for: INTERACTION WITH USP48. |
| [37] | Colinge J., Superti-Furga G., Bennett K.L. Submitted (OCT-2008) to UniProtKB Cited for: IDENTIFICATION [LARGE SCALE ANALYSIS], MASS SPECTROMETRY. |
| [38] | "Structural basis for self-association and receptor recognition of human TRAF2." Park Y.C., Burkitt V., Villa A.R., Tong L., Wu H. Nature 398:533-538(1999) [PubMed: 10206649] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.2 ANGSTROMS) OF 310-501 IN COMPLEX WITH TNFRSF1B. |
| [39] | "Crystallographic analysis of CD40 recognition and signaling by human TRAF2." McWhirter S.M., Pullen S.S., Holton J.M., Crute J.J., Kehry M.R., Alber T. Proc. Natl. Acad. Sci. U.S.A. 96:8408-8413(1999) [PubMed: 10411888] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.0 ANGSTROMS) OF 334-501 IN COMPLEX WITH EBV BNFL1, X-RAY CRYSTALLOGRAPHY (2.7 ANGSTROMS) OF 315-501 IN COMPLEX WITH TNFRSF5, X-RAY CRYSTALLOGRAPHY (2.0 ANGSTROMS) OF 334-501 IN COMPLEX WITH TNFRSF4, X-RAY CRYSTALLOGRAPHY (2.5 ANGSTROMS) OF 334-501 IN COMPLEX WITH TNFRSF9. |
| [40] | "A novel mechanism of TRAF signaling revealed by structural and functional analyses of the TRADD-TRAF2 interaction." Park Y.C., Ye H., Hsia C., Segal D., Rich R.L., Liou H.C., Myszka D.G., Wu H. Cell 101:777-787(2000) [PubMed: 10892748] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.0 ANGSTROMS) OF 331-501 IN COMPLEX WITH TRADD. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| U12597 mRNA. Translation: AAA87706.1. AK054686 mRNA. Translation: BAB70792.1. AY623660 Genomic DNA. Translation: AAT27320.1. BC032410 mRNA. Translation: AAH32410.1. BC033810 mRNA. Translation: AAH33810.1. BC043492 mRNA. Translation: AAH43492.1. BC064662 mRNA. Translation: AAH64662.1. | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| IPI | IPI00030278. IPI00292635. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PIR | S56163. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| RefSeq | NP_066961.2. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| UniGene | Hs.522506 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| DIP | DIP:6223N. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| IntAct | Q12933. 127 interactions. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| STRING | Q12933. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PhosphoSite | Q12933. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PRIDE | Q12933. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Ensembl | ENST00000247668; ENSP00000247668; ENSG00000127191; Homo sapiens. [Genome view] ENST00000359662; ENSP00000352685; ENSG00000127191; Homo sapiens. [Genome view] ENST00000371645; ENSP00000360708; ENSG00000127191; Homo sapiens. [Genome view] ENST00000414589; ENSP00000397653; ENSG00000127191; Homo sapiens. [Genome view] ENST00000419057; ENSP00000405860; ENSG00000127191; Homo sapiens. [Genome view] ENST00000429509; ENSP00000406524; ENSG00000127191; Homo sapiens. [Genome view] ENST00000432785; ENSP00000400061; ENSG00000127191; Homo sapiens. [Genome view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GeneID | 7186. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| KEGG | hsa:7186. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| UCSC | uc004cjv.1. human. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| CTD | 7186. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GeneCards | GC09P138900. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| H-InvDB | HIX0008562. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HGNC | HGNC:12032. TRAF2. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HPA | CAB004603. HPA009972. HPA010634. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| MIM | 601895. gene. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PharmGKB | PA36709. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HOVERGEN | Q12933. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| OMA | METRVAT. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Pathway_Interaction_DB | caspase_pathway. Caspase cascade in apoptosis. ceramidepathway. Ceramide signaling pathway. hivnefpathway. HIV-1 Nef: Negative effector of Fas and TNF-alpha. p38_mkk3_6pathway. p38 MAPK signaling pathway. tnfpathway. TNF receptor signaling pathway. trail_pathway. TRAIL signaling pathway. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Reactome | REACT_578. Apoptosis. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ArrayExpress | Q12933. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Bgee | Q12933. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| CleanEx | HS_TRAF2. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Genevestigator | Q12933. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GermOnline | ENSG00000127191. Homo sapiens. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| InterPro | IPR002083. MATH. IPR012227. TNF_recpt_TRAF. IPR013322. TRAF-type. IPR018957. Znf_C3HC4_RING-type. IPR001841. Znf_RING. IPR017907. Znf_RING_CS. IPR001293. Znf_TRAF. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene3D | G3DSA:2.60.210.10. TRAF-type. 1 hit. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Pfam | PF00917. MATH. 1 hit. PF00097. zf-C3HC4. 1 hit. PF02176. zf-TRAF. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PIRSF | PIRSF015614. TRAF. 1 hit. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SMART | SM00061. MATH. 1 hit. SM00184. RING. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PROSITE | PS50144. MATH. 1 hit. PS00518. ZF_RING_1. 1 hit. PS50089. ZF_RING_2. 1 hit. PS50145. ZF_TRAF. 2 hits. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Other Resources | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| NextBio | 28172. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entry information
| Entry name | TRAF2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q12933 Secondary accession number(s): Q96NT2 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 9 Human chromosome 9: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |
| Recent format changes Overview of recent format changes |

Clusters with


