Q12872 (SFSWA_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 114.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Splicing factor, suppressor of white-apricot homolog Alternative name(s): Splicing factor, arginine/serine-rich 8 Suppressor of white apricot protein homolog | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 951 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Plays a role as an alternative splicing regulator. Regulate its own expression at the level of RNA processing. Also regulates the splicing of fibronectin and CD45 genes. May act, at least in part, by interaction with other R/S-containing splicing factors. Represses the splicing of MAPT/Tau exon 10. Ref.5 |
| Subcellular location | Nucleus Potential. |
| Sequence similarities | Contains 2 SURP motif repeats. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Transcription Transcription regulation mRNA processing mRNA splicing |
| Cellular component | Nucleus |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Repeat |
| Ligand | RNA-binding |
| Molecular function | Repressor |
| PTM | Acetylation Phosphoprotein |
| Technical term | 3D-structure Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | mRNA splice site selection Traceable author statement Ref.5. Source: ProtInc negative regulation of mRNA splicing, via spliceosomeInferred from sequence or structural similarity. Source: UniProtKB regulation of transcription, DNA-dependentInferred from electronic annotation. Source: UniProtKB-KW transcription, DNA-dependentInferred from electronic annotation. Source: UniProtKB-KW |
| Cellular_component | nucleus Inferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular_function | RNA binding Inferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q12872-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q12872-2) The sequence of this isoform differs from the canonical sequence as follows: 801-801: R → RSRVTASPGTLRAEPCQSSASVTAAAEPGSYQAASTTTRFDSASSFEGKPGKT | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 951 | 951 | Splicing factor, suppressor of white-apricot homolog | PRO_0000081934 | ||||||||||||||||||||||||||||
Regions | ||||||||||||||||||||||||||||||||
| Repeat | 211 – 253 | 43 | SURP motif 1 | |||||||||||||||||||||||||||||
| Repeat | 459 – 499 | 41 | SURP motif 2 | |||||||||||||||||||||||||||||
| Compositional bias | 165 – 168 | 4 | Poly-Glu | |||||||||||||||||||||||||||||
| Compositional bias | 287 – 290 | 4 | Poly-Asp | |||||||||||||||||||||||||||||
| Compositional bias | 382 – 385 | 4 | Poly-Pro | |||||||||||||||||||||||||||||
| Compositional bias | 413 – 416 | 4 | Poly-Pro | |||||||||||||||||||||||||||||
| Compositional bias | 420 – 424 | 5 | Poly-Pro | |||||||||||||||||||||||||||||
| Compositional bias | 434 – 440 | 7 | Poly-Thr | |||||||||||||||||||||||||||||
| Compositional bias | 451 – 454 | 4 | Poly-Pro | |||||||||||||||||||||||||||||
| Compositional bias | 616 – 619 | 4 | Poly-Ser | |||||||||||||||||||||||||||||
| Compositional bias | 660 – 663 | 4 | Poly-Ala | |||||||||||||||||||||||||||||
| Compositional bias | 754 – 763 | 10 | Poly-Lys | |||||||||||||||||||||||||||||
| Compositional bias | 789 – 951 | 163 | Arg/Ser-rich (RS domain) | |||||||||||||||||||||||||||||
| Compositional bias | 850 – 853 | 4 | Poly-Lys | |||||||||||||||||||||||||||||
Amino acid modifications | ||||||||||||||||||||||||||||||||
| Modified residue | 283 | 1 | Phosphoserine Ref.8 Ref.9 | |||||||||||||||||||||||||||||
| Modified residue | 315 | 1 | N6-acetyllysine Ref.10 | |||||||||||||||||||||||||||||
| Modified residue | 604 | 1 | Phosphoserine Ref.8 Ref.11 Ref.12 | |||||||||||||||||||||||||||||
| Modified residue | 642 | 1 | Phosphothreonine Ref.7 | |||||||||||||||||||||||||||||
| Modified residue | 909 | 1 | Phosphoserine Ref.8 Ref.9 | |||||||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||||||
| Alternative sequence | 801 | 1 | R → RSRVTASPGTLRAEPCQSSA SVTAAAEPGSYQAASTTTRF DSASSFEGKPGKT in isoform 2. | VSP_044786 | ||||||||||||||||||||||||||||
| Natural variant | 52 | 1 | L → Q. Ref.1 Corresponds to variant rs1051207 [ dbSNP | Ensembl ]. | VAR_046442 | ||||||||||||||||||||||||||||
| Natural variant | 122 | 1 | L → F. Corresponds to variant rs1051314 [ dbSNP | Ensembl ]. | VAR_046443 | ||||||||||||||||||||||||||||
| Natural variant | 136 | 1 | L → F. Ref.1 Corresponds to variant rs1131564 [ dbSNP | Ensembl ]. | VAR_046444 | ||||||||||||||||||||||||||||
| Natural variant | 421 | 1 | L → P. Ref.1 Ref.3 Ref.4 Corresponds to variant rs1982528 [ dbSNP | Ensembl ]. | VAR_021789 | ||||||||||||||||||||||||||||
| Natural variant | 512 | 1 | G → S. Corresponds to variant rs34541796 [ dbSNP | Ensembl ]. | VAR_057248 | ||||||||||||||||||||||||||||
| Natural variant | 538 | 1 | E → G. Corresponds to variant rs34744641 [ dbSNP | Ensembl ]. | VAR_057249 | ||||||||||||||||||||||||||||
| Natural variant | 887 | 1 | A → E. Corresponds to variant rs34729193 [ dbSNP | Ensembl ]. | VAR_057250 | ||||||||||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||||||||||
| Sequence conflict | 236 | 1 | R → P in AAA19604. Ref.1 | |||||||||||||||||||||||||||||
| Sequence conflict | 493 | 1 | H → Y in AAA19604. Ref.1 | |||||||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||||||
| Beta strand | 192 – 194 | 3 | ||||||||||||||||||||||||||||||
| Beta strand | 198 – 200 | 3 | ||||||||||||||||||||||||||||||
| Helix | 206 – 221 | 16 | ||||||||||||||||||||||||||||||
| Helix | 224 – 233 | 10 | ||||||||||||||||||||||||||||||
| Helix | 241 – 243 | 3 | ||||||||||||||||||||||||||||||
| Helix | 249 – 262 | 14 | ||||||||||||||||||||||||||||||
| Turn | 454 – 456 | 3 | ||||||||||||||||||||||||||||||
| Helix | 457 – 469 | 13 | ||||||||||||||||||||||||||||||
| Helix | 472 – 481 | 10 | ||||||||||||||||||||||||||||||
| Helix | 484 – 486 | 3 | ||||||||||||||||||||||||||||||
| Beta strand | 490 – 492 | 3 | ||||||||||||||||||||||||||||||
| Helix | 496 – 509 | 14 | ||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Conservation of regulated alternative splicing and identification of functional domains in vertebrate homologs to the Drosophila splicing regulator, suppressor-of-white-apricot." Denhez F., Lafyatis R. J. Biol. Chem. 269:16170-16179(1994) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANTS GLN-52; PHE-136 AND PRO-421. Tissue: Placenta. |
| [2] | "The finished DNA sequence of human chromosome 12." Scherer S.E., Muzny D.M., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R. Gibbs R.A.Nature 440:346-351(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [3] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT PRO-421. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2), VARIANT PRO-421. Tissue: Brain and Skin. |
| [5] | "The mammalian homolog of suppressor-of-white-apricot regulates alternative mRNA splicing of CD45 exon 4 and fibronectin IIICS." Sarkissian M., Winne A., Lafyatis R. J. Biol. Chem. 271:31106-31114(1996) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [6] | "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks." Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M. Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. Tissue: Cervix carcinoma. |
| [7] | "ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage." Matsuoka S., Ballif B.A., Smogorzewska A., McDonald E.R. III, Hurov K.E., Luo J., Bakalarski C.E., Zhao Z., Solimini N., Lerenthal Y., Shiloh Y., Gygi S.P., Elledge S.J. Science 316:1160-1166(2007) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-642, MASS SPECTROMETRY. Tissue: Embryonic kidney. |
| [8] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-283; SER-604 AND SER-909, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [9] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-283 AND SER-909, MASS SPECTROMETRY. Tissue: Leukemic T-cell. |
| [10] | "Lysine acetylation targets protein complexes and co-regulates major cellular functions." Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.C., Olsen J.V., Mann M. Science 325:834-840(2009) [PubMed] [Europe PMC] [Abstract] Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-315, MASS SPECTROMETRY. |
| [11] | "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis." Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M. Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-604, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [12] | "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation." Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B. Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-604, MASS SPECTROMETRY. |
| [13] | "Solution structure of the SURP1 and SURP2 domain in splicing factor, arginine/serine-rich 8." RIKEN structural genomics initiative (RSGI) Submitted (JUN-2007) to the PDB data bank Cited for: STRUCTURE BY NMR OF 189-282 AND 434-522. |
Cross-references
Sequence databases | |||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | U08377 mRNA. Translation: AAA19604.1. AC117500 Genomic DNA. No translation available. AC131009 Genomic DNA. No translation available. CH471054 Genomic DNA. Translation: EAW98526.1. BC008707 mRNA. Translation: AAH08707.1. BC015953 mRNA. Translation: AAH15953.1. BC136678 mRNA. Translation: AAI36679.1. BC144364 mRNA. Translation: AAI44365.1. | ||||||||||||||||||
| IPI | IPI00290094. IPI00790550. | ||||||||||||||||||
| PIR | A54037. B54037. C54037. | ||||||||||||||||||
| RefSeq | NP_001248340.1. NM_001261411.1. NP_004583.2. NM_004592.3. | ||||||||||||||||||
| UniGene | Hs.308171. | ||||||||||||||||||
3D structure databases | |||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||
| ProteinModelPortal | Q12872. | ||||||||||||||||||
| SMR | Q12872. Positions 189-282, 455-522. | ||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||
| IntAct | Q12872. 2 interactions. | ||||||||||||||||||
| STRING | 9606.ENSP00000261674. | ||||||||||||||||||
PTM databases | |||||||||||||||||||
| PhosphoSite | Q12872. | ||||||||||||||||||
Polymorphism databases | |||||||||||||||||||
| DMDM | 292495067. | ||||||||||||||||||
Proteomic databases | |||||||||||||||||||
| PaxDb | Q12872. | ||||||||||||||||||
| PRIDE | Q12872. | ||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||
Genome annotation databases | |||||||||||||||||||
| Ensembl | ENST00000261674; ENSP00000261674; ENSG00000061936. ENST00000541286; ENSP00000437738; ENSG00000061936. | ||||||||||||||||||
| GeneID | 6433. | ||||||||||||||||||
| KEGG | hsa:6433. | ||||||||||||||||||
| UCSC | uc001uja.1. human. | ||||||||||||||||||
Organism-specific databases | |||||||||||||||||||
| CTD | 6433. | ||||||||||||||||||
| GeneCards | GC12P132196. | ||||||||||||||||||
| H-InvDB | HIX0036782. | ||||||||||||||||||
| HGNC | HGNC:10790. SFSWAP. | ||||||||||||||||||
| HPA | HPA039362. HPA040063. | ||||||||||||||||||
| MIM | 601945. gene. | ||||||||||||||||||
| neXtProt | NX_Q12872. | ||||||||||||||||||
| PharmGKB | PA35706. | ||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||
| eggNOG | NOG289028. | ||||||||||||||||||
| HOVERGEN | HBG079184. | ||||||||||||||||||
| InParanoid | Q12872. | ||||||||||||||||||
| OMA | MYYSYYM. | ||||||||||||||||||
| OrthoDB | EOG4ZW59T. | ||||||||||||||||||
| PhylomeDB | Q12872. | ||||||||||||||||||
Gene expression databases | |||||||||||||||||||
| ArrayExpress | Q12872. | ||||||||||||||||||
| Bgee | Q12872. | ||||||||||||||||||
| CleanEx | HS_SFRS8. | ||||||||||||||||||
| Genevestigator | Q12872. | ||||||||||||||||||
| GermOnline | ENSG00000061936. Homo sapiens. | ||||||||||||||||||
Family and domain databases | |||||||||||||||||||
| InterPro | IPR000061. Surp. IPR019147. SWAP_N_domain. [Graphical view] | ||||||||||||||||||
| Pfam | PF09750. DRY_EERY. 1 hit. PF01805. Surp. 2 hits. [Graphical view] | ||||||||||||||||||
| SMART | SM00648. SWAP. 2 hits. [Graphical view] | ||||||||||||||||||
| SUPFAM | SSF109905. SSF109905. 2 hits. | ||||||||||||||||||
| PROSITE | PS50128. SURP. 2 hits. [Graphical view] | ||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||
Other | |||||||||||||||||||
| ChiTaRS | SFSWAP. human. | ||||||||||||||||||
| EvolutionaryTrace | Q12872. | ||||||||||||||||||
| GenomeRNAi | 6433. | ||||||||||||||||||
| NextBio | 24987. | ||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||
Entry information
| Entry name | SFSWA_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q12872 Secondary accession number(s): B2RN45 Q6PJF7 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 12 Human chromosome 12: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
