Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Splicing factor, suppressor of white-apricot homolog

Gene

SFSWAP

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

Plays a role as an alternative splicing regulator. Regulate its own expression at the level of RNA processing. Also regulates the splicing of fibronectin and CD45 genes. May act, at least in part, by interaction with other R/S-containing splicing factors. Represses the splicing of MAPT/Tau exon 10.1 Publication

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Repressor

Keywords - Biological processi

mRNA processing, mRNA splicing, Transcription, Transcription regulation

Keywords - Ligandi

RNA-binding

Enzyme and pathway databases

BioCyciZFISH:ENSG00000061936-MONOMER.

Names & Taxonomyi

Protein namesi
Recommended name:
Splicing factor, suppressor of white-apricot homolog
Alternative name(s):
Splicing factor, arginine/serine-rich 8
Suppressor of white apricot protein homolog
Gene namesi
Name:SFSWAP
Synonyms:SFRS8, SWAP
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 12

Organism-specific databases

HGNCiHGNC:10790. SFSWAP.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi6433.
OpenTargetsiENSG00000061936.
PharmGKBiPA35706.

Polymorphism and mutation databases

BioMutaiSFSWAP.
DMDMi292495067.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000819341 – 951Splicing factor, suppressor of white-apricot homologAdd BLAST951

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei283PhosphoserineCombined sources1
Modified residuei315N6-acetyllysineCombined sources1
Modified residuei604PhosphoserineCombined sources1
Modified residuei642PhosphothreonineCombined sources1
Modified residuei832PhosphoserineCombined sources1
Modified residuei834PhosphoserineCombined sources1
Modified residuei905PhosphoserineBy similarity1
Modified residuei909PhosphoserineCombined sources1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

EPDiQ12872.
MaxQBiQ12872.
PaxDbiQ12872.
PeptideAtlasiQ12872.
PRIDEiQ12872.

PTM databases

iPTMnetiQ12872.
PhosphoSitePlusiQ12872.

Expressioni

Gene expression databases

BgeeiENSG00000061936.
CleanExiHS_SFRS8.
ExpressionAtlasiQ12872. baseline and differential.
GenevisibleiQ12872. HS.

Organism-specific databases

HPAiHPA039362.
HPA040063.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
SF1Q156372EBI-1055938,EBI-744603

Protein-protein interaction databases

BioGridi112331. 13 interactors.
IntActiQ12872. 7 interactors.
STRINGi9606.ENSP00000261674.

Structurei

Secondary structure

1951
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi192 – 194Combined sources3
Beta strandi198 – 200Combined sources3
Helixi206 – 221Combined sources16
Helixi224 – 233Combined sources10
Helixi241 – 243Combined sources3
Helixi249 – 262Combined sources14
Turni454 – 456Combined sources3
Helixi457 – 469Combined sources13
Helixi472 – 481Combined sources10
Helixi484 – 486Combined sources3
Beta strandi490 – 492Combined sources3
Helixi496 – 509Combined sources14

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2E5ZNMR-A440-522[»]
2E60NMR-A189-282[»]
ProteinModelPortaliQ12872.
SMRiQ12872.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ12872.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati211 – 253SURP motif 1Add BLAST43
Repeati459 – 499SURP motif 2Add BLAST41

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi165 – 168Poly-Glu4
Compositional biasi287 – 290Poly-Asp4
Compositional biasi382 – 385Poly-Pro4
Compositional biasi413 – 416Poly-Pro4
Compositional biasi420 – 424Poly-Pro5
Compositional biasi434 – 440Poly-Thr7
Compositional biasi451 – 454Poly-Pro4
Compositional biasi616 – 619Poly-Ser4
Compositional biasi660 – 663Poly-Ala4
Compositional biasi754 – 763Poly-Lys10
Compositional biasi789 – 951Arg/Ser-rich (RS domain)Add BLAST163
Compositional biasi850 – 853Poly-Lys4

Sequence similaritiesi

Contains 2 SURP motif repeats.PROSITE-ProRule annotation

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiKOG1847. Eukaryota.
ENOG410ZQGI. LUCA.
GeneTreeiENSGT00730000111096.
HOVERGENiHBG079184.
InParanoidiQ12872.
OMAiPPCVVVE.
OrthoDBiEOG091G09RJ.
PhylomeDBiQ12872.
TreeFamiTF106264.

Family and domain databases

InterProiIPR000061. Surp.
IPR019147. SWAP_N_domain.
[Graphical view]
PfamiPF09750. DRY_EERY. 1 hit.
PF01805. Surp. 2 hits.
[Graphical view]
SMARTiSM01141. DRY_EERY. 1 hit.
SM00648. SWAP. 2 hits.
[Graphical view]
SUPFAMiSSF109905. SSF109905. 2 hits.
PROSITEiPS50128. SURP. 2 hits.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q12872-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MYGASGGRAK PERKSGAKEE AGPGGAGGGG SRVELLVFGY ACKLFRDDER
60 70 80 90 100
ALAQEQGQHL IPWMGDHKIL IDRYDGRGHL HDLSEYDAEY STWNRDYQLS
110 120 130 140 150
EEEARIEALC DEERYLALHT DLLEEEARQE EEYKRLSEAL AEDGSYNAVG
160 170 180 190 200
FTYGSDYYDP SEPTEEEEPS KQREKNEAEN LEENEEPFVA PLGLSVPSDV
210 220 230 240 250
ELPPTAKMHA IIERTASFVC RQGAQFEIML KAKQARNSQF DFLRFDHYLN
260 270 280 290 300
PYYKFIQKAM KEGRYTVLAE NKSDEKKKSG VSSDNEDDDD EEDGNYLHPS
310 320 330 340 350
LFASKKCNRL EELMKPLKVV DPDHPLAALV RKAQADSSTP TPHNADGAPV
360 370 380 390 400
QPSQVEYTAD STVAAMYYSY YMLPDGTYCL APPPPGIDVT TYYSTLPAGV
410 420 430 440 450
TVSNSPGVTT TAPPPPGTTP LPPPTTAETS SGATSTTTTT SALAPVAAII
460 470 480 490 500
PPPPDVQPVI DKLAEYVARN GLKFETSVRA KNDQRFEFLQ PWHQYNAYYE
510 520 530 540 550
FKKQFFLQKE GGDSMQAVSA PEEAPTDSAP EKPSDAGEDG APEDAAEVGA
560 570 580 590 600
RAGSGGKKEA SSSKTVPDGK LVKASFAPIS FAIKAKENDL LPLEKNRVKL
610 620 630 640 650
DDDSDDDEES KEGQESSSSA ANTNPAVAPP CVVVEEKKPQ LTQEELEAKQ
660 670 680 690 700
AKQKLEDRLA AAAREKLAQA SKESKEKQLQ AERKRKAALF LQTLKNPLPE
710 720 730 740 750
AEAGKIEESP FSVEESSTTP CPLLTGGRPL PTLEVKPPDR PSSKSKDPPR
760 770 780 790 800
EEEKEKKKKK HKKRSRTRSR SPKYHSSSKS RSRSHSKAKH SLPSAYRTVR
810 820 830 840 850
RSRSRSRSPR RRAHSPERRR EERSVPTAYR VSRSPGASRK RTRSRSPHEK
860 870 880 890 900
KKKRRSRSRT KSKARSQSVS PSKQAAPRPA APAAHSAHSA SVSPVESRGS
910 920 930 940 950
SQERSRGVSQ EKEAQISSAI VSSVQSKITQ DLMAKVRAML AASKNLQTSA

S
Length:951
Mass (Da):104,822
Last modified:March 23, 2010 - v3
Checksum:iA942D589F4B6BF47
GO
Isoform 2 (identifier: Q12872-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     801-801: R → RSRVTASPGTLRAEPCQSSASVTAAAEPGSYQAASTTTRFDSASSFEGKPGKT

Note: No experimental confirmation available.
Show »
Length:1,003
Mass (Da):110,012
Checksum:iC67AFFE577FF7CA4
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti236R → P in AAA19604 (PubMed:8206918).Curated1
Sequence conflicti493H → Y in AAA19604 (PubMed:8206918).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_04644252L → Q.1 PublicationCorresponds to variant rs1051207dbSNPEnsembl.1
Natural variantiVAR_046443122L → F.Corresponds to variant rs1051314dbSNPEnsembl.1
Natural variantiVAR_046444136L → F.1 PublicationCorresponds to variant rs1131564dbSNPEnsembl.1
Natural variantiVAR_021789421L → P.3 PublicationsCorresponds to variant rs1982528dbSNPEnsembl.1
Natural variantiVAR_057248512G → S.Corresponds to variant rs34541796dbSNPEnsembl.1
Natural variantiVAR_057249538E → G.Corresponds to variant rs34744641dbSNPEnsembl.1
Natural variantiVAR_057250887A → E.Corresponds to variant rs34729193dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_044786801R → RSRVTASPGTLRAEPCQSSA SVTAAAEPGSYQAASTTTRF DSASSFEGKPGKT in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U08377 mRNA. Translation: AAA19604.1.
AC117500 Genomic DNA. No translation available.
AC131009 Genomic DNA. No translation available.
CH471054 Genomic DNA. Translation: EAW98526.1.
BC008707 mRNA. Translation: AAH08707.1.
BC015953 mRNA. Translation: AAH15953.1.
BC136678 mRNA. Translation: AAI36679.1.
BC144364 mRNA. Translation: AAI44365.1.
CCDSiCCDS58290.1. [Q12872-2]
CCDS9273.1. [Q12872-1]
PIRiA54037.
B54037.
C54037.
RefSeqiNP_001248340.1. NM_001261411.1. [Q12872-2]
NP_004583.2. NM_004592.3. [Q12872-1]
UniGeneiHs.308171.

Genome annotation databases

EnsembliENST00000261674; ENSP00000261674; ENSG00000061936. [Q12872-1]
ENST00000541286; ENSP00000437738; ENSG00000061936. [Q12872-2]
GeneIDi6433.
KEGGihsa:6433.
UCSCiuc001uja.3. human. [Q12872-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U08377 mRNA. Translation: AAA19604.1.
AC117500 Genomic DNA. No translation available.
AC131009 Genomic DNA. No translation available.
CH471054 Genomic DNA. Translation: EAW98526.1.
BC008707 mRNA. Translation: AAH08707.1.
BC015953 mRNA. Translation: AAH15953.1.
BC136678 mRNA. Translation: AAI36679.1.
BC144364 mRNA. Translation: AAI44365.1.
CCDSiCCDS58290.1. [Q12872-2]
CCDS9273.1. [Q12872-1]
PIRiA54037.
B54037.
C54037.
RefSeqiNP_001248340.1. NM_001261411.1. [Q12872-2]
NP_004583.2. NM_004592.3. [Q12872-1]
UniGeneiHs.308171.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2E5ZNMR-A440-522[»]
2E60NMR-A189-282[»]
ProteinModelPortaliQ12872.
SMRiQ12872.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi112331. 13 interactors.
IntActiQ12872. 7 interactors.
STRINGi9606.ENSP00000261674.

PTM databases

iPTMnetiQ12872.
PhosphoSitePlusiQ12872.

Polymorphism and mutation databases

BioMutaiSFSWAP.
DMDMi292495067.

Proteomic databases

EPDiQ12872.
MaxQBiQ12872.
PaxDbiQ12872.
PeptideAtlasiQ12872.
PRIDEiQ12872.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000261674; ENSP00000261674; ENSG00000061936. [Q12872-1]
ENST00000541286; ENSP00000437738; ENSG00000061936. [Q12872-2]
GeneIDi6433.
KEGGihsa:6433.
UCSCiuc001uja.3. human. [Q12872-1]

Organism-specific databases

CTDi6433.
DisGeNETi6433.
GeneCardsiSFSWAP.
H-InvDBHIX0036782.
HGNCiHGNC:10790. SFSWAP.
HPAiHPA039362.
HPA040063.
MIMi601945. gene.
neXtProtiNX_Q12872.
OpenTargetsiENSG00000061936.
PharmGKBiPA35706.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1847. Eukaryota.
ENOG410ZQGI. LUCA.
GeneTreeiENSGT00730000111096.
HOVERGENiHBG079184.
InParanoidiQ12872.
OMAiPPCVVVE.
OrthoDBiEOG091G09RJ.
PhylomeDBiQ12872.
TreeFamiTF106264.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000061936-MONOMER.

Miscellaneous databases

ChiTaRSiSFSWAP. human.
EvolutionaryTraceiQ12872.
GenomeRNAii6433.
PROiQ12872.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000061936.
CleanExiHS_SFRS8.
ExpressionAtlasiQ12872. baseline and differential.
GenevisibleiQ12872. HS.

Family and domain databases

InterProiIPR000061. Surp.
IPR019147. SWAP_N_domain.
[Graphical view]
PfamiPF09750. DRY_EERY. 1 hit.
PF01805. Surp. 2 hits.
[Graphical view]
SMARTiSM01141. DRY_EERY. 1 hit.
SM00648. SWAP. 2 hits.
[Graphical view]
SUPFAMiSSF109905. SSF109905. 2 hits.
PROSITEiPS50128. SURP. 2 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiSFSWA_HUMAN
AccessioniPrimary (citable) accession number: Q12872
Secondary accession number(s): B2RN45
, B7ZM97, F5H6B8, Q6PJF7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 15, 1998
Last sequence update: March 23, 2010
Last modified: November 2, 2016
This is version 147 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.