Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Nuclear factor 1 A-type

Gene

NFIA

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Recognizes and binds the palindromic sequence 5'-TTGGCNNNNNGCCAA-3' present in viral and cellular promoters and in the origin of replication of adenovirus type 2. These proteins are individually capable of activating transcription and replication.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
DNA bindingi1 – 194CTF/NF-IPROSITE-ProRule annotationAdd BLAST194

GO - Molecular functioni

  • chromatin binding Source: Ensembl
  • RNA polymerase II core promoter proximal region sequence-specific DNA binding Source: NTNU_SB
  • transcriptional activator activity, RNA polymerase II core promoter proximal region sequence-specific binding Source: NTNU_SB
  • transcription factor activity, sequence-specific DNA binding Source: UniProtKB
  • transcription factor binding Source: UniProtKB

GO - Biological processi

  • DNA replication Source: UniProtKB-KW
  • negative regulation of transcription from RNA polymerase II promoter Source: GO_Central
  • positive regulation of transcription from RNA polymerase II promoter Source: NTNU_SB
  • regulation of transcription, DNA-templated Source: UniProtKB
  • synapse maturation Source: Ensembl
  • viral genome replication Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Activator

Keywords - Biological processi

DNA replication, Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding

Enzyme and pathway databases

BioCyciZFISH:ENSG00000162599-MONOMER.
ReactomeiR-HSA-73980. RNA Polymerase III Transcription Termination.
R-HSA-749476. RNA Polymerase III Abortive And Retractive Initiation.
SIGNORiQ12857.

Names & Taxonomyi

Protein namesi
Recommended name:
Nuclear factor 1 A-type
Short name:
NF1-A
Short name:
Nuclear factor 1/A
Alternative name(s):
CCAAT-box-binding transcription factor
Short name:
CTF
Nuclear factor I/A
Short name:
NF-I/A
Short name:
NFI-A
TGGCA-binding protein
Gene namesi
Name:NFIA
Synonyms:KIAA1439
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

HGNCiHGNC:7784. NFIA.

Subcellular locationi

GO - Cellular componenti

  • cell junction Source: HPA
  • nucleoplasm Source: HPA
  • nucleus Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi4774.
MalaCardsiNFIA.
OpenTargetsiENSG00000162599.
Orphaneti401986. 1p31p32 microdeletion syndrome.
PharmGKBiPA31590.

Polymorphism and mutation databases

BioMutaiNFIA.
DMDMi14194959.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001001911 – 509Nuclear factor 1 A-typeAdd BLAST509

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei258PhosphoserineCombined sources1
Modified residuei265PhosphoserineCombined sources1
Modified residuei280PhosphoserineCombined sources1
Modified residuei287PhosphoserineCombined sources1
Modified residuei300PhosphoserineCombined sources1
Modified residuei305PhosphoserineBy similarity1
Modified residuei319PhosphoserineCombined sources1
Modified residuei360PhosphoserineCombined sources1
Modified residuei389Asymmetric dimethylarginineBy similarity1
Modified residuei469PhosphoserineCombined sources1
Modified residuei471PhosphothreonineCombined sources1
Isoform 2 (identifier: Q12857-2)
Modified residuei469PhosphoserineCombined sources1

Keywords - PTMi

Methylation, Phosphoprotein

Proteomic databases

EPDiQ12857.
MaxQBiQ12857.
PaxDbiQ12857.
PeptideAtlasiQ12857.
PRIDEiQ12857.

PTM databases

iPTMnetiQ12857.
PhosphoSitePlusiQ12857.

Expressioni

Gene expression databases

BgeeiENSG00000162599.
CleanExiHS_NFIA.
ExpressionAtlasiQ12857. baseline and differential.
GenevisibleiQ12857. HS.

Organism-specific databases

HPAiHPA006111.
HPA008884.

Interactioni

Subunit structurei

Binds DNA as a homodimer.

GO - Molecular functioni

  • transcription factor binding Source: UniProtKB

Protein-protein interaction databases

BioGridi110847. 42 interactors.
IntActiQ12857. 8 interactors.
MINTiMINT-6612489.
STRINGi9606.ENSP00000360231.

Structurei

3D structure databases

ProteinModelPortaliQ12857.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the CTF/NF-I family.PROSITE-ProRule annotation
Contains 1 CTF/NF-I DNA-binding domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiKOG3663. Eukaryota.
ENOG410Y16G. LUCA.
GeneTreeiENSGT00390000009905.
HOGENOMiHOG000013028.
HOVERGENiHBG006561.
InParanoidiQ12857.
KOiK09168.
OMAiAFTHHHR.
OrthoDBiEOG091G0HVY.
PhylomeDBiQ12857.
TreeFamiTF313889.

Family and domain databases

InterProiIPR000647. CTF/NFI.
IPR020604. CTF/NFI_DNA-bd-dom.
IPR019739. CTF/NFI_DNA-bd_CS.
IPR019548. CTF/NFI_DNA-bd_N.
IPR003619. MAD_homology1_Dwarfin-type.
[Graphical view]
PANTHERiPTHR11492. PTHR11492. 1 hit.
PfamiPF00859. CTF_NFI. 1 hit.
PF03165. MH1. 1 hit.
PF10524. NfI_DNAbd_pre-N. 1 hit.
[Graphical view]
SMARTiSM00523. DWA. 1 hit.
[Graphical view]
PROSITEiPS00349. CTF_NFI_1. 1 hit.
PS51080. CTF_NFI_2. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q12857-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MYSPLCLTQD EFHPFIEALL PHVRAFAYTW FNLQARKRKY FKKHEKRMSK
60 70 80 90 100
EEERAVKDEL LSEKPEVKQK WASRLLAKLR KDIRPEYRED FVLTVTGKKP
110 120 130 140 150
PCCVLSNPDQ KGKMRRIDCL RQADKVWRLD LVMVILFKGI PLESTDGERL
160 170 180 190 200
VKSPQCSNPG LCVQPHHIGV SVKELDLYLA YFVHAADSSQ SESPSQPSDA
210 220 230 240 250
DIKDQPENGH LGFQDSFVTS GVFSVTELVR VSQTPIAAGT GPNFSLSDLE
260 270 280 290 300
SSSYYSMSPG AMRRSLPSTS STSSTKRLKS VEDEMDSPGE EPFYTGQGRS
310 320 330 340 350
PGSGSQSSGW HEVEPGMPSP TTLKKSEKSG FSSPSPSQTS SLGTAFTQHH
360 370 380 390 400
RPVITGPRAS PHATPSTLHF PTSPIIQQPG PYFSHPAIRY HPQETLKEFV
410 420 430 440 450
QLVCPDAGQQ AGQVGFLNPN GSSQGKVHNP FLPTPMLPPP PPPPMARPVP
460 470 480 490 500
LPVPDTKPPT TSTEGGAASP TSPTYSTPST SPANRFVSVG PRDPSFVNIP

QQTQSWYLG
Length:509
Mass (Da):55,944
Last modified:June 1, 2001 - v2
Checksum:i42090C6B8B229F87
GO
Isoform 2 (identifier: Q12857-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     474-509: TYSTPSTSPANRFVSVGPRDPSFVNIPQQTQSWYLG → ILVPGIKVAASHHPPDRPPDPFSTL

Show »
Length:498
Mass (Da):54,620
Checksum:i0C47EA46EC78030C
GO
Isoform 3 (identifier: Q12857-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-9: MYSPLCLTQ → M

Show »
Length:501
Mass (Da):55,038
Checksum:i871DB7C2ACA49A5B
GO
Isoform 4 (identifier: Q12857-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MQMCRPASSSVLYVPTRWPGGCGATWQSCPSPPPRRTRIPQRPAVM

Show »
Length:554
Mass (Da):60,894
Checksum:iE05E93FF6701A134
GO

Sequence cautioni

The sequence BAA92677 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti143E → G in BAG61305 (PubMed:14702039).Curated1
Sequence conflicti186A → G in AAA93124 (PubMed:7590749).Curated1
Sequence conflicti240 – 243TGPN → PAPT in AAA93124 (PubMed:7590749).Curated4
Sequence conflicti274S → P in BAG61515 (PubMed:14702039).Curated1
Sequence conflicti331F → L in BAG61305 (PubMed:14702039).Curated1
Sequence conflicti358R → G in BAG61305 (PubMed:14702039).Curated1
Sequence conflicti426K → R in BAG61305 (PubMed:14702039).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0468841 – 9MYSPLCLTQ → M in isoform 3. 1 Publication9
Alternative sequenceiVSP_0468831M → MQMCRPASSSVLYVPTRWPG GCGATWQSCPSPPPRRTRIP QRPAVM in isoform 4. 1 Publication1
Alternative sequenceiVSP_036620474 – 509TYSTP…SWYLG → ILVPGIKVAASHHPPDRPPD PFSTL in isoform 2. 1 PublicationAdd BLAST36

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB037860 mRNA. Translation: BAA92677.1. Different initiation.
AK299289 mRNA. Translation: BAG61305.1.
AK299579 mRNA. Translation: BAG61515.1.
AC092784 Genomic DNA. No translation available.
AC096534 Genomic DNA. No translation available.
AC096947 Genomic DNA. No translation available.
AC099792 Genomic DNA. No translation available.
AL096888 Genomic DNA. No translation available.
AL355795 Genomic DNA. No translation available.
AL445198 Genomic DNA. No translation available.
AL445432 Genomic DNA. No translation available.
CH471059 Genomic DNA. Translation: EAX06601.1.
BC022264 mRNA. Translation: AAH22264.1.
U07809 mRNA. Translation: AAA93124.1.
CCDSiCCDS44156.1. [Q12857-1]
CCDS53321.1. [Q12857-3]
CCDS53322.1. [Q12857-4]
CCDS615.1. [Q12857-2]
RefSeqiNP_001128145.1. NM_001134673.3. [Q12857-1]
NP_001138983.1. NM_001145511.1. [Q12857-3]
NP_001138984.1. NM_001145512.1. [Q12857-4]
NP_005586.1. NM_005595.4. [Q12857-2]
UniGeneiHs.740757.
Hs.744898.

Genome annotation databases

EnsembliENST00000371187; ENSP00000360229; ENSG00000162599. [Q12857-2]
ENST00000371189; ENSP00000360231; ENSG00000162599. [Q12857-4]
ENST00000403491; ENSP00000384523; ENSG00000162599. [Q12857-1]
ENST00000407417; ENSP00000384680; ENSG00000162599. [Q12857-3]
GeneIDi4774.
KEGGihsa:4774.
UCSCiuc001czv.4. human. [Q12857-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB037860 mRNA. Translation: BAA92677.1. Different initiation.
AK299289 mRNA. Translation: BAG61305.1.
AK299579 mRNA. Translation: BAG61515.1.
AC092784 Genomic DNA. No translation available.
AC096534 Genomic DNA. No translation available.
AC096947 Genomic DNA. No translation available.
AC099792 Genomic DNA. No translation available.
AL096888 Genomic DNA. No translation available.
AL355795 Genomic DNA. No translation available.
AL445198 Genomic DNA. No translation available.
AL445432 Genomic DNA. No translation available.
CH471059 Genomic DNA. Translation: EAX06601.1.
BC022264 mRNA. Translation: AAH22264.1.
U07809 mRNA. Translation: AAA93124.1.
CCDSiCCDS44156.1. [Q12857-1]
CCDS53321.1. [Q12857-3]
CCDS53322.1. [Q12857-4]
CCDS615.1. [Q12857-2]
RefSeqiNP_001128145.1. NM_001134673.3. [Q12857-1]
NP_001138983.1. NM_001145511.1. [Q12857-3]
NP_001138984.1. NM_001145512.1. [Q12857-4]
NP_005586.1. NM_005595.4. [Q12857-2]
UniGeneiHs.740757.
Hs.744898.

3D structure databases

ProteinModelPortaliQ12857.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi110847. 42 interactors.
IntActiQ12857. 8 interactors.
MINTiMINT-6612489.
STRINGi9606.ENSP00000360231.

PTM databases

iPTMnetiQ12857.
PhosphoSitePlusiQ12857.

Polymorphism and mutation databases

BioMutaiNFIA.
DMDMi14194959.

Proteomic databases

EPDiQ12857.
MaxQBiQ12857.
PaxDbiQ12857.
PeptideAtlasiQ12857.
PRIDEiQ12857.

Protocols and materials databases

DNASUi4774.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000371187; ENSP00000360229; ENSG00000162599. [Q12857-2]
ENST00000371189; ENSP00000360231; ENSG00000162599. [Q12857-4]
ENST00000403491; ENSP00000384523; ENSG00000162599. [Q12857-1]
ENST00000407417; ENSP00000384680; ENSG00000162599. [Q12857-3]
GeneIDi4774.
KEGGihsa:4774.
UCSCiuc001czv.4. human. [Q12857-1]

Organism-specific databases

CTDi4774.
DisGeNETi4774.
GeneCardsiNFIA.
HGNCiHGNC:7784. NFIA.
HPAiHPA006111.
HPA008884.
MalaCardsiNFIA.
MIMi600727. gene.
neXtProtiNX_Q12857.
OpenTargetsiENSG00000162599.
Orphaneti401986. 1p31p32 microdeletion syndrome.
PharmGKBiPA31590.
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3663. Eukaryota.
ENOG410Y16G. LUCA.
GeneTreeiENSGT00390000009905.
HOGENOMiHOG000013028.
HOVERGENiHBG006561.
InParanoidiQ12857.
KOiK09168.
OMAiAFTHHHR.
OrthoDBiEOG091G0HVY.
PhylomeDBiQ12857.
TreeFamiTF313889.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000162599-MONOMER.
ReactomeiR-HSA-73980. RNA Polymerase III Transcription Termination.
R-HSA-749476. RNA Polymerase III Abortive And Retractive Initiation.
SIGNORiQ12857.

Miscellaneous databases

ChiTaRSiNFIA. human.
GeneWikiiNFIA.
GenomeRNAii4774.
PROiQ12857.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000162599.
CleanExiHS_NFIA.
ExpressionAtlasiQ12857. baseline and differential.
GenevisibleiQ12857. HS.

Family and domain databases

InterProiIPR000647. CTF/NFI.
IPR020604. CTF/NFI_DNA-bd-dom.
IPR019739. CTF/NFI_DNA-bd_CS.
IPR019548. CTF/NFI_DNA-bd_N.
IPR003619. MAD_homology1_Dwarfin-type.
[Graphical view]
PANTHERiPTHR11492. PTHR11492. 1 hit.
PfamiPF00859. CTF_NFI. 1 hit.
PF03165. MH1. 1 hit.
PF10524. NfI_DNAbd_pre-N. 1 hit.
[Graphical view]
SMARTiSM00523. DWA. 1 hit.
[Graphical view]
PROSITEiPS00349. CTF_NFI_1. 1 hit.
PS51080. CTF_NFI_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiNFIA_HUMAN
AccessioniPrimary (citable) accession number: Q12857
Secondary accession number(s): B4DRJ3
, B4DS53, F5H0R0, F8W8W3, Q8TA97, Q9H3X9, Q9P2A9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 1, 2001
Last sequence update: June 1, 2001
Last modified: November 30, 2016
This is version 159 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.