Q12857 (NFIA_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 124.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Nuclear factor 1 A-type Short name=NF1-A Short name=Nuclear factor 1/A Alternative name(s): CCAAT-box-binding transcription factor Short name=CTF Nuclear factor I/A Short name=NF-I/A Short name=NFI-A TGGCA-binding protein | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 509 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Recognizes and binds the palindromic sequence 5'-TTGGCNNNNNGCCAA-3' present in viral and cellular promoters and in the origin of replication of adenovirus type 2. These proteins are individually capable of activating transcription and replication. |
| Subunit structure | Binds DNA as a homodimer. |
| Subcellular location | |
| Sequence similarities | Belongs to the CTF/NF-I family. Contains 1 CTF/NF-I DNA-binding domain. |
| Sequence caution | The sequence BAA92677.1 differs from that shown. Reason: Erroneous initiation. |
Ontologies
| Keywords | |
|---|---|
| Biological process | DNA replication Transcription Transcription regulation |
| Cellular component | Nucleus |
| Coding sequence diversity | Alternative splicing |
| Ligand | DNA-binding |
| Molecular function | Activator |
| PTM | Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | DNA replication Inferred from electronic annotation. Source: UniProtKB-KW transcription, DNA-dependentInferred from electronic annotation. Source: UniProtKB-KW viral genome replicationNon-traceable author statement Ref.5. Source: UniProtKB |
| Cellular_component | cell junction Inferred from direct assay. Source: HPA nucleusInferred from direct assay PubMed 15684392. Source: UniProtKB |
| Molecular_function | DNA binding Inferred from electronic annotation. Source: UniProtKB-KW sequence-specific DNA binding transcription factor activityNon-traceable author statement Ref.5. Source: UniProtKB |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q12857-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q12857-2) The sequence of this isoform differs from the canonical sequence as follows: 474-509: TYSTPSTSPANRFVSVGPRDPSFVNIPQQTQSWYLG → ILVPGIKVAASHHPPDRPPDPFSTL |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 509 | 509 | Nuclear factor 1 A-type | PRO_0000100191 | |||||
Regions | |||||||||
| DNA binding | 1 – 194 | 194 | CTF/NF-I | ||||||
Amino acid modifications | |||||||||
| Modified residue | 258 | 1 | Phosphoserine Ref.8 | ||||||
| Modified residue | 265 | 1 | Phosphoserine Ref.8 Ref.10 | ||||||
| Modified residue | 280 | 1 | Phosphoserine Ref.8 Ref.9 Ref.10 | ||||||
| Modified residue | 287 | 1 | Phosphoserine Ref.7 Ref.8 Ref.9 Ref.10 | ||||||
| Modified residue | 300 | 1 | Phosphoserine Ref.8 Ref.10 | ||||||
| Modified residue | 319 | 1 | Phosphoserine Ref.8 | ||||||
| Modified residue | 360 | 1 | Phosphoserine Ref.10 | ||||||
Natural variations | |||||||||
| Alternative sequence | 474 – 509 | 36 | TYSTP…SWYLG → ILVPGIKVAASHHPPDRPPD PFSTL in isoform 2. | VSP_036620 | |||||
Experimental info | |||||||||
| Sequence conflict | 186 | 1 | A → G in AAA93124. Ref.5 | ||||||
| Sequence conflict | 240 – 243 | 4 | TGPN → PAPT in AAA93124. Ref.5 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Prediction of the coding sequences of unidentified human genes. XVI. The complete sequences of 150 new cDNA clones from brain which code for large proteins in vitro." Nagase T., Kikuno R., Ishikawa K., Hirosawa M., Ohara O. DNA Res. 7:65-73(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Brain. |
| [2] | "The DNA sequence and biological annotation of human chromosome 1." Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. Bentley D.R.Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [3] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Skeletal muscle. |
| [5] | "Chromosomal localization of the four genes (NFIA, B, C, and X) for the human transcription factor nuclear factor I by FISH." Qian F., Kruse U., Lichter P., Sippel A.E. Genomics 28:66-73(1995) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 19-243. |
| [6] | "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks." Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M. Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. Tissue: Cervix carcinoma. |
| [7] | "Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis." Cantin G.T., Yi W., Lu B., Park S.K., Xu T., Lee J.-D., Yates J.R. III J. Proteome Res. 7:1346-1351(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-287, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [8] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-258; SER-265; SER-280; SER-287; SER-300 AND SER-319, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [9] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-280 AND SER-287, MASS SPECTROMETRY. Tissue: Leukemic T-cell. |
| [10] | "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis." Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M. Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-265; SER-280; SER-287; SER-300 AND SER-360, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AB037860 mRNA. Translation: BAA92677.1. Different initiation. AL445198, AC096534, AL096888 Genomic DNA. Translation: CAI13080.1. AL445198, AC096534, AL096888 Genomic DNA. Translation: CAI13081.1. AL096888, AC096534, AL445198 Genomic DNA. Translation: CAI23240.1. AL096888, AC096534, AL445198 Genomic DNA. Translation: CAI23241.1. CH471059 Genomic DNA. Translation: EAX06601.1. BC022264 mRNA. Translation: AAH22264.1. U07809 mRNA. Translation: AAA93124.1. |
| IPI | IPI00029745. IPI00923394. |
| RefSeq | NP_001128145.1. NM_001134673.3. NP_001138983.1. NM_001145511.1. NP_001138984.1. NM_001145512.1. NP_005586.1. NM_005595.4. |
| UniGene | Hs.710546. Hs.740757. |
3D structure databases | |
| ProteinModelPortal | Q12857. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 9606.ENSP00000384523. |
PTM databases | |
| PhosphoSite | Q12857. |
Polymorphism databases | |
| DMDM | 14194959. |
Proteomic databases | |
| PaxDb | Q12857. |
| PRIDE | Q12857. |
Protocols and materials databases | |
| DNASU | 4774. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000403491; ENSP00000384523; ENSG00000162599. ENST00000485903; ENSP00000419785; ENSG00000162599. |
| GeneID | 4774. |
| KEGG | hsa:4774. |
| UCSC | uc001czv.3. human. uc001czw.3. human. |
Organism-specific databases | |
| CTD | 4774. |
| GeneCards | GC01P061260. |
| HGNC | HGNC:7784. NFIA. |
| HPA | HPA006111. HPA008884. |
| MIM | 600727. gene. |
| neXtProt | NX_Q12857. |
| PharmGKB | PA31590. |
| HUGE | Search... |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG252172. |
| HOGENOM | HOG000013028. |
| HOVERGEN | HBG006561. |
| KO | K09168. |
| OrthoDB | EOG4ZKJM9. |
Enzyme and pathway databases | |
| Pathway_Interaction_DB | hnf3apathway. FOXA1 transcription factor network. |
Gene expression databases | |
| ArrayExpress | Q12857. |
| Bgee | Q12857. |
| CleanEx | HS_NFIA. |
| Genevestigator | Q12857. |
Family and domain databases | |
| InterPro | IPR000647. CTF/NFI. IPR020604. CTF/NFI_DNA-bd-dom. IPR019739. CTF/NFI_DNA-bd_CS. IPR019548. CTF/NFI_DNA-bd_N. IPR003619. MAD_homology1_Dwarfin-type. [Graphical view] |
| PANTHER | PTHR11492. PTHR11492. 1 hit. |
| Pfam | PF00859. CTF_NFI. 1 hit. PF03165. MH1. 1 hit. PF10524. NfI_DNAbd_pre-N. 1 hit. [Graphical view] |
| SMART | SM00523. DWA. 1 hit. [Graphical view] |
| PROSITE | PS00349. CTF_NFI_1. 1 hit. PS51080. CTF_NFI_2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | NFIA. human. |
| GenomeRNAi | 4774. |
| NextBio | 18406. |
| SOURCE | Search... |
Entry information
| Entry name | NFIA_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q12857 Secondary accession number(s): Q8TA97, Q9H3X9, Q9P2A9 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 1 Human chromosome 1: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
