Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q12857

- NFIA_HUMAN

UniProt

Q12857 - NFIA_HUMAN

Protein

Nuclear factor 1 A-type

Gene

NFIA

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 138 (01 Oct 2014)
      Sequence version 2 (01 Jun 2001)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Recognizes and binds the palindromic sequence 5'-TTGGCNNNNNGCCAA-3' present in viral and cellular promoters and in the origin of replication of adenovirus type 2. These proteins are individually capable of activating transcription and replication.

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    DNA bindingi1 – 194194CTF/NF-IPROSITE-ProRule annotationAdd
    BLAST

    GO - Molecular functioni

    1. RNA polymerase II core promoter proximal region sequence-specific DNA binding Source: NTNU_SB
    2. RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription Source: NTNU_SB
    3. sequence-specific DNA binding transcription factor activity Source: UniProtKB
    4. transcription factor binding Source: UniProtKB

    GO - Biological processi

    1. DNA replication Source: UniProtKB-KW
    2. positive regulation of transcription from RNA polymerase II promoter Source: NTNU_SB
    3. regulation of transcription, DNA-templated Source: UniProtKB
    4. response to organic cyclic compound Source: Ensembl
    5. viral genome replication Source: UniProtKB

    Keywords - Molecular functioni

    Activator

    Keywords - Biological processi

    DNA replication, Transcription, Transcription regulation

    Keywords - Ligandi

    DNA-binding

    Enzyme and pathway databases

    ReactomeiREACT_22339. RNA Polymerase III Abortive And Retractive Initiation.
    REACT_63. RNA Polymerase III Transcription Termination.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Nuclear factor 1 A-type
    Short name:
    NF1-A
    Short name:
    Nuclear factor 1/A
    Alternative name(s):
    CCAAT-box-binding transcription factor
    Short name:
    CTF
    Nuclear factor I/A
    Short name:
    NF-I/A
    Short name:
    NFI-A
    TGGCA-binding protein
    Gene namesi
    Name:NFIA
    Synonyms:KIAA1439
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 1

    Organism-specific databases

    HGNCiHGNC:7784. NFIA.

    Subcellular locationi

    GO - Cellular componenti

    1. nucleus Source: UniProtKB

    Keywords - Cellular componenti

    Nucleus

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA31590.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 509509Nuclear factor 1 A-typePRO_0000100191Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei258 – 2581Phosphoserine1 Publication
    Modified residuei265 – 2651Phosphoserine2 Publications
    Modified residuei280 – 2801Phosphoserine3 Publications
    Modified residuei287 – 2871Phosphoserine4 Publications
    Modified residuei300 – 3001Phosphoserine2 Publications
    Modified residuei319 – 3191Phosphoserine1 Publication
    Modified residuei360 – 3601Phosphoserine1 Publication

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    MaxQBiQ12857.
    PaxDbiQ12857.
    PRIDEiQ12857.

    PTM databases

    PhosphoSiteiQ12857.

    Expressioni

    Gene expression databases

    ArrayExpressiQ12857.
    BgeeiQ12857.
    CleanExiHS_NFIA.
    GenevestigatoriQ12857.

    Organism-specific databases

    HPAiHPA006111.
    HPA008884.

    Interactioni

    Subunit structurei

    Binds DNA as a homodimer.

    Protein-protein interaction databases

    BioGridi110847. 34 interactions.
    IntActiQ12857. 1 interaction.
    MINTiMINT-6612489.
    STRINGi9606.ENSP00000384523.

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the CTF/NF-I family.PROSITE-ProRule annotation
    Contains 1 CTF/NF-I DNA-binding domain.PROSITE-ProRule annotation

    Phylogenomic databases

    eggNOGiNOG252172.
    HOGENOMiHOG000013028.
    HOVERGENiHBG006561.
    KOiK09168.
    OMAiKEQPENG.
    OrthoDBiEOG7WDN2K.
    PhylomeDBiQ12857.
    TreeFamiTF313889.

    Family and domain databases

    InterProiIPR000647. CTF/NFI.
    IPR020604. CTF/NFI_DNA-bd-dom.
    IPR019739. CTF/NFI_DNA-bd_CS.
    IPR019548. CTF/NFI_DNA-bd_N.
    IPR003619. MAD_homology1_Dwarfin-type.
    [Graphical view]
    PANTHERiPTHR11492. PTHR11492. 1 hit.
    PfamiPF00859. CTF_NFI. 1 hit.
    PF03165. MH1. 1 hit.
    PF10524. NfI_DNAbd_pre-N. 1 hit.
    [Graphical view]
    SMARTiSM00523. DWA. 1 hit.
    [Graphical view]
    PROSITEiPS00349. CTF_NFI_1. 1 hit.
    PS51080. CTF_NFI_2. 1 hit.
    [Graphical view]

    Sequences (4)i

    Sequence statusi: Complete.

    This entry describes 4 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q12857-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MYSPLCLTQD EFHPFIEALL PHVRAFAYTW FNLQARKRKY FKKHEKRMSK    50
    EEERAVKDEL LSEKPEVKQK WASRLLAKLR KDIRPEYRED FVLTVTGKKP 100
    PCCVLSNPDQ KGKMRRIDCL RQADKVWRLD LVMVILFKGI PLESTDGERL 150
    VKSPQCSNPG LCVQPHHIGV SVKELDLYLA YFVHAADSSQ SESPSQPSDA 200
    DIKDQPENGH LGFQDSFVTS GVFSVTELVR VSQTPIAAGT GPNFSLSDLE 250
    SSSYYSMSPG AMRRSLPSTS STSSTKRLKS VEDEMDSPGE EPFYTGQGRS 300
    PGSGSQSSGW HEVEPGMPSP TTLKKSEKSG FSSPSPSQTS SLGTAFTQHH 350
    RPVITGPRAS PHATPSTLHF PTSPIIQQPG PYFSHPAIRY HPQETLKEFV 400
    QLVCPDAGQQ AGQVGFLNPN GSSQGKVHNP FLPTPMLPPP PPPPMARPVP 450
    LPVPDTKPPT TSTEGGAASP TSPTYSTPST SPANRFVSVG PRDPSFVNIP 500
    QQTQSWYLG 509
    Length:509
    Mass (Da):55,944
    Last modified:June 1, 2001 - v2
    Checksum:i42090C6B8B229F87
    GO
    Isoform 2 (identifier: Q12857-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         474-509: TYSTPSTSPANRFVSVGPRDPSFVNIPQQTQSWYLG → ILVPGIKVAASHHPPDRPPDPFSTL

    Show »
    Length:498
    Mass (Da):54,620
    Checksum:i0C47EA46EC78030C
    GO
    Isoform 3 (identifier: Q12857-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-9: MYSPLCLTQ → M

    Show »
    Length:501
    Mass (Da):55,038
    Checksum:i871DB7C2ACA49A5B
    GO
    Isoform 4 (identifier: Q12857-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MQMCRPASSSVLYVPTRWPGGCGATWQSCPSPPPRRTRIPQRPAVM

    Show »
    Length:554
    Mass (Da):60,894
    Checksum:iE05E93FF6701A134
    GO

    Sequence cautioni

    The sequence BAA92677.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti143 – 1431E → G in BAG61305. (PubMed:14702039)Curated
    Sequence conflicti186 – 1861A → G in AAA93124. (PubMed:7590749)Curated
    Sequence conflicti240 – 2434TGPN → PAPT in AAA93124. (PubMed:7590749)Curated
    Sequence conflicti274 – 2741S → P in BAG61515. (PubMed:14702039)Curated
    Sequence conflicti331 – 3311F → L in BAG61305. (PubMed:14702039)Curated
    Sequence conflicti358 – 3581R → G in BAG61305. (PubMed:14702039)Curated
    Sequence conflicti426 – 4261K → R in BAG61305. (PubMed:14702039)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 99MYSPLCLTQ → M in isoform 3. 1 PublicationVSP_046884
    Alternative sequencei1 – 11M → MQMCRPASSSVLYVPTRWPG GCGATWQSCPSPPPRRTRIP QRPAVM in isoform 4. 1 PublicationVSP_046883
    Alternative sequencei474 – 50936TYSTP…SWYLG → ILVPGIKVAASHHPPDRPPD PFSTL in isoform 2. 1 PublicationVSP_036620Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB037860 mRNA. Translation: BAA92677.1. Different initiation.
    AK299289 mRNA. Translation: BAG61305.1.
    AK299579 mRNA. Translation: BAG61515.1.
    AC092784 Genomic DNA. No translation available.
    AC096534 Genomic DNA. No translation available.
    AC096947 Genomic DNA. No translation available.
    AC099792 Genomic DNA. No translation available.
    AL096888 Genomic DNA. No translation available.
    AL355795 Genomic DNA. No translation available.
    AL445198 Genomic DNA. No translation available.
    AL445432 Genomic DNA. No translation available.
    CH471059 Genomic DNA. Translation: EAX06601.1.
    BC022264 mRNA. Translation: AAH22264.1.
    U07809 mRNA. Translation: AAA93124.1.
    CCDSiCCDS44156.1. [Q12857-1]
    CCDS53321.1. [Q12857-3]
    CCDS53322.1. [Q12857-4]
    CCDS615.1. [Q12857-2]
    RefSeqiNP_001128145.1. NM_001134673.3. [Q12857-1]
    NP_001138983.1. NM_001145511.1. [Q12857-3]
    NP_001138984.1. NM_001145512.1. [Q12857-4]
    NP_005586.1. NM_005595.4. [Q12857-2]
    UniGeneiHs.740757.
    Hs.744898.

    Genome annotation databases

    EnsembliENST00000371187; ENSP00000360229; ENSG00000162599. [Q12857-2]
    ENST00000371189; ENSP00000360231; ENSG00000162599. [Q12857-4]
    ENST00000403491; ENSP00000384523; ENSG00000162599. [Q12857-1]
    ENST00000407417; ENSP00000384680; ENSG00000162599. [Q12857-3]
    GeneIDi4774.
    KEGGihsa:4774.
    UCSCiuc001czv.3. human. [Q12857-2]
    uc001czw.3. human. [Q12857-1]

    Polymorphism databases

    DMDMi14194959.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB037860 mRNA. Translation: BAA92677.1 . Different initiation.
    AK299289 mRNA. Translation: BAG61305.1 .
    AK299579 mRNA. Translation: BAG61515.1 .
    AC092784 Genomic DNA. No translation available.
    AC096534 Genomic DNA. No translation available.
    AC096947 Genomic DNA. No translation available.
    AC099792 Genomic DNA. No translation available.
    AL096888 Genomic DNA. No translation available.
    AL355795 Genomic DNA. No translation available.
    AL445198 Genomic DNA. No translation available.
    AL445432 Genomic DNA. No translation available.
    CH471059 Genomic DNA. Translation: EAX06601.1 .
    BC022264 mRNA. Translation: AAH22264.1 .
    U07809 mRNA. Translation: AAA93124.1 .
    CCDSi CCDS44156.1. [Q12857-1 ]
    CCDS53321.1. [Q12857-3 ]
    CCDS53322.1. [Q12857-4 ]
    CCDS615.1. [Q12857-2 ]
    RefSeqi NP_001128145.1. NM_001134673.3. [Q12857-1 ]
    NP_001138983.1. NM_001145511.1. [Q12857-3 ]
    NP_001138984.1. NM_001145512.1. [Q12857-4 ]
    NP_005586.1. NM_005595.4. [Q12857-2 ]
    UniGenei Hs.740757.
    Hs.744898.

    3D structure databases

    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 110847. 34 interactions.
    IntActi Q12857. 1 interaction.
    MINTi MINT-6612489.
    STRINGi 9606.ENSP00000384523.

    PTM databases

    PhosphoSitei Q12857.

    Polymorphism databases

    DMDMi 14194959.

    Proteomic databases

    MaxQBi Q12857.
    PaxDbi Q12857.
    PRIDEi Q12857.

    Protocols and materials databases

    DNASUi 4774.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000371187 ; ENSP00000360229 ; ENSG00000162599 . [Q12857-2 ]
    ENST00000371189 ; ENSP00000360231 ; ENSG00000162599 . [Q12857-4 ]
    ENST00000403491 ; ENSP00000384523 ; ENSG00000162599 . [Q12857-1 ]
    ENST00000407417 ; ENSP00000384680 ; ENSG00000162599 . [Q12857-3 ]
    GeneIDi 4774.
    KEGGi hsa:4774.
    UCSCi uc001czv.3. human. [Q12857-2 ]
    uc001czw.3. human. [Q12857-1 ]

    Organism-specific databases

    CTDi 4774.
    GeneCardsi GC01P061260.
    HGNCi HGNC:7784. NFIA.
    HPAi HPA006111.
    HPA008884.
    MIMi 600727. gene.
    neXtProti NX_Q12857.
    PharmGKBi PA31590.
    HUGEi Search...
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG252172.
    HOGENOMi HOG000013028.
    HOVERGENi HBG006561.
    KOi K09168.
    OMAi KEQPENG.
    OrthoDBi EOG7WDN2K.
    PhylomeDBi Q12857.
    TreeFami TF313889.

    Enzyme and pathway databases

    Reactomei REACT_22339. RNA Polymerase III Abortive And Retractive Initiation.
    REACT_63. RNA Polymerase III Transcription Termination.

    Miscellaneous databases

    ChiTaRSi NFIA. human.
    GeneWikii NFIA.
    GenomeRNAii 4774.
    NextBioi 18406.
    PROi Q12857.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q12857.
    Bgeei Q12857.
    CleanExi HS_NFIA.
    Genevestigatori Q12857.

    Family and domain databases

    InterProi IPR000647. CTF/NFI.
    IPR020604. CTF/NFI_DNA-bd-dom.
    IPR019739. CTF/NFI_DNA-bd_CS.
    IPR019548. CTF/NFI_DNA-bd_N.
    IPR003619. MAD_homology1_Dwarfin-type.
    [Graphical view ]
    PANTHERi PTHR11492. PTHR11492. 1 hit.
    Pfami PF00859. CTF_NFI. 1 hit.
    PF03165. MH1. 1 hit.
    PF10524. NfI_DNAbd_pre-N. 1 hit.
    [Graphical view ]
    SMARTi SM00523. DWA. 1 hit.
    [Graphical view ]
    PROSITEi PS00349. CTF_NFI_1. 1 hit.
    PS51080. CTF_NFI_2. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Prediction of the coding sequences of unidentified human genes. XVI. The complete sequences of 150 new cDNA clones from brain which code for large proteins in vitro."
      Nagase T., Kikuno R., Ishikawa K., Hirosawa M., Ohara O.
      DNA Res. 7:65-73(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Brain.
    2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3 AND 4).
      Tissue: Brain.
    3. "The DNA sequence and biological annotation of human chromosome 1."
      Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
      , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
      Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: Skeletal muscle.
    6. "Chromosomal localization of the four genes (NFIA, B, C, and X) for the human transcription factor nuclear factor I by FISH."
      Qian F., Kruse U., Lichter P., Sippel A.E.
      Genomics 28:66-73(1995) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 19-243.
    7. "Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis."
      Cantin G.T., Yi W., Lu B., Park S.K., Xu T., Lee J.-D., Yates J.R. III
      J. Proteome Res. 7:1346-1351(2008) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-287, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    8. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-258; SER-265; SER-280; SER-287; SER-300 AND SER-319, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    9. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
      Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
      Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-280 AND SER-287, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Leukemic T-cell.
    10. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
      Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
      Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-265; SER-280; SER-287; SER-300 AND SER-360, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.

    Entry informationi

    Entry nameiNFIA_HUMAN
    AccessioniPrimary (citable) accession number: Q12857
    Secondary accession number(s): B4DRJ3
    , B4DS53, F5H0R0, F8W8W3, Q8TA97, Q9H3X9, Q9P2A9
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: June 1, 2001
    Last sequence update: June 1, 2001
    Last modified: October 1, 2014
    This is version 138 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 1
      Human chromosome 1: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3