Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q12857

- NFIA_HUMAN

UniProt

Q12857 - NFIA_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Nuclear factor 1 A-type

Gene

NFIA

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Recognizes and binds the palindromic sequence 5'-TTGGCNNNNNGCCAA-3' present in viral and cellular promoters and in the origin of replication of adenovirus type 2. These proteins are individually capable of activating transcription and replication.

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
DNA bindingi1 – 194194CTF/NF-IPROSITE-ProRule annotationAdd
BLAST

GO - Molecular functioni

  1. RNA polymerase II core promoter proximal region sequence-specific DNA binding Source: NTNU_SB
  2. RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription Source: NTNU_SB
  3. sequence-specific DNA binding transcription factor activity Source: UniProtKB
  4. transcription factor binding Source: UniProtKB

GO - Biological processi

  1. DNA replication Source: UniProtKB-KW
  2. positive regulation of transcription from RNA polymerase II promoter Source: NTNU_SB
  3. regulation of transcription, DNA-templated Source: UniProtKB
  4. response to organic cyclic compound Source: Ensembl
  5. viral genome replication Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Activator

Keywords - Biological processi

DNA replication, Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding

Enzyme and pathway databases

ReactomeiREACT_22339. RNA Polymerase III Abortive And Retractive Initiation.
REACT_63. RNA Polymerase III Transcription Termination.

Names & Taxonomyi

Protein namesi
Recommended name:
Nuclear factor 1 A-type
Short name:
NF1-A
Short name:
Nuclear factor 1/A
Alternative name(s):
CCAAT-box-binding transcription factor
Short name:
CTF
Nuclear factor I/A
Short name:
NF-I/A
Short name:
NFI-A
TGGCA-binding protein
Gene namesi
Name:NFIA
Synonyms:KIAA1439
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 1

Organism-specific databases

HGNCiHGNC:7784. NFIA.

Subcellular locationi

GO - Cellular componenti

  1. nucleus Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA31590.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 509509Nuclear factor 1 A-typePRO_0000100191Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei258 – 2581Phosphoserine1 Publication
Modified residuei265 – 2651Phosphoserine2 Publications
Modified residuei280 – 2801Phosphoserine3 Publications
Modified residuei287 – 2871Phosphoserine4 Publications
Modified residuei300 – 3001Phosphoserine2 Publications
Modified residuei319 – 3191Phosphoserine1 Publication
Modified residuei360 – 3601Phosphoserine1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ12857.
PaxDbiQ12857.
PRIDEiQ12857.

PTM databases

PhosphoSiteiQ12857.

Expressioni

Gene expression databases

BgeeiQ12857.
CleanExiHS_NFIA.
ExpressionAtlasiQ12857. baseline and differential.
GenevestigatoriQ12857.

Organism-specific databases

HPAiHPA006111.
HPA008884.

Interactioni

Subunit structurei

Binds DNA as a homodimer.

Protein-protein interaction databases

BioGridi110847. 34 interactions.
IntActiQ12857. 1 interaction.
MINTiMINT-6612489.
STRINGi9606.ENSP00000384523.

Family & Domainsi

Sequence similaritiesi

Belongs to the CTF/NF-I family.PROSITE-ProRule annotation
Contains 1 CTF/NF-I DNA-binding domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiNOG252172.
GeneTreeiENSGT00390000009905.
HOGENOMiHOG000013028.
HOVERGENiHBG006561.
InParanoidiQ12857.
KOiK09168.
OMAiKEQPENG.
OrthoDBiEOG7WDN2K.
PhylomeDBiQ12857.
TreeFamiTF313889.

Family and domain databases

InterProiIPR000647. CTF/NFI.
IPR020604. CTF/NFI_DNA-bd-dom.
IPR019739. CTF/NFI_DNA-bd_CS.
IPR019548. CTF/NFI_DNA-bd_N.
IPR003619. MAD_homology1_Dwarfin-type.
[Graphical view]
PANTHERiPTHR11492. PTHR11492. 1 hit.
PfamiPF00859. CTF_NFI. 1 hit.
PF03165. MH1. 1 hit.
PF10524. NfI_DNAbd_pre-N. 1 hit.
[Graphical view]
SMARTiSM00523. DWA. 1 hit.
[Graphical view]
PROSITEiPS00349. CTF_NFI_1. 1 hit.
PS51080. CTF_NFI_2. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q12857-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MYSPLCLTQD EFHPFIEALL PHVRAFAYTW FNLQARKRKY FKKHEKRMSK
60 70 80 90 100
EEERAVKDEL LSEKPEVKQK WASRLLAKLR KDIRPEYRED FVLTVTGKKP
110 120 130 140 150
PCCVLSNPDQ KGKMRRIDCL RQADKVWRLD LVMVILFKGI PLESTDGERL
160 170 180 190 200
VKSPQCSNPG LCVQPHHIGV SVKELDLYLA YFVHAADSSQ SESPSQPSDA
210 220 230 240 250
DIKDQPENGH LGFQDSFVTS GVFSVTELVR VSQTPIAAGT GPNFSLSDLE
260 270 280 290 300
SSSYYSMSPG AMRRSLPSTS STSSTKRLKS VEDEMDSPGE EPFYTGQGRS
310 320 330 340 350
PGSGSQSSGW HEVEPGMPSP TTLKKSEKSG FSSPSPSQTS SLGTAFTQHH
360 370 380 390 400
RPVITGPRAS PHATPSTLHF PTSPIIQQPG PYFSHPAIRY HPQETLKEFV
410 420 430 440 450
QLVCPDAGQQ AGQVGFLNPN GSSQGKVHNP FLPTPMLPPP PPPPMARPVP
460 470 480 490 500
LPVPDTKPPT TSTEGGAASP TSPTYSTPST SPANRFVSVG PRDPSFVNIP

QQTQSWYLG
Length:509
Mass (Da):55,944
Last modified:June 1, 2001 - v2
Checksum:i42090C6B8B229F87
GO
Isoform 2 (identifier: Q12857-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     474-509: TYSTPSTSPANRFVSVGPRDPSFVNIPQQTQSWYLG → ILVPGIKVAASHHPPDRPPDPFSTL

Show »
Length:498
Mass (Da):54,620
Checksum:i0C47EA46EC78030C
GO
Isoform 3 (identifier: Q12857-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-9: MYSPLCLTQ → M

Show »
Length:501
Mass (Da):55,038
Checksum:i871DB7C2ACA49A5B
GO
Isoform 4 (identifier: Q12857-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MQMCRPASSSVLYVPTRWPGGCGATWQSCPSPPPRRTRIPQRPAVM

Show »
Length:554
Mass (Da):60,894
Checksum:iE05E93FF6701A134
GO

Sequence cautioni

The sequence BAA92677.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti143 – 1431E → G in BAG61305. (PubMed:14702039)Curated
Sequence conflicti186 – 1861A → G in AAA93124. (PubMed:7590749)Curated
Sequence conflicti240 – 2434TGPN → PAPT in AAA93124. (PubMed:7590749)Curated
Sequence conflicti274 – 2741S → P in BAG61515. (PubMed:14702039)Curated
Sequence conflicti331 – 3311F → L in BAG61305. (PubMed:14702039)Curated
Sequence conflicti358 – 3581R → G in BAG61305. (PubMed:14702039)Curated
Sequence conflicti426 – 4261K → R in BAG61305. (PubMed:14702039)Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 99MYSPLCLTQ → M in isoform 3. 1 PublicationVSP_046884
Alternative sequencei1 – 11M → MQMCRPASSSVLYVPTRWPG GCGATWQSCPSPPPRRTRIP QRPAVM in isoform 4. 1 PublicationVSP_046883
Alternative sequencei474 – 50936TYSTP…SWYLG → ILVPGIKVAASHHPPDRPPD PFSTL in isoform 2. 1 PublicationVSP_036620Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AB037860 mRNA. Translation: BAA92677.1. Different initiation.
AK299289 mRNA. Translation: BAG61305.1.
AK299579 mRNA. Translation: BAG61515.1.
AC092784 Genomic DNA. No translation available.
AC096534 Genomic DNA. No translation available.
AC096947 Genomic DNA. No translation available.
AC099792 Genomic DNA. No translation available.
AL096888 Genomic DNA. No translation available.
AL355795 Genomic DNA. No translation available.
AL445198 Genomic DNA. No translation available.
AL445432 Genomic DNA. No translation available.
CH471059 Genomic DNA. Translation: EAX06601.1.
BC022264 mRNA. Translation: AAH22264.1.
U07809 mRNA. Translation: AAA93124.1.
CCDSiCCDS44156.1. [Q12857-1]
CCDS53321.1. [Q12857-3]
CCDS53322.1. [Q12857-4]
CCDS615.1. [Q12857-2]
RefSeqiNP_001128145.1. NM_001134673.3. [Q12857-1]
NP_001138983.1. NM_001145511.1. [Q12857-3]
NP_001138984.1. NM_001145512.1. [Q12857-4]
NP_005586.1. NM_005595.4. [Q12857-2]
UniGeneiHs.740757.
Hs.744898.

Genome annotation databases

EnsembliENST00000371187; ENSP00000360229; ENSG00000162599. [Q12857-2]
ENST00000371189; ENSP00000360231; ENSG00000162599. [Q12857-4]
ENST00000403491; ENSP00000384523; ENSG00000162599. [Q12857-1]
ENST00000407417; ENSP00000384680; ENSG00000162599. [Q12857-3]
GeneIDi4774.
KEGGihsa:4774.
UCSCiuc001czv.3. human. [Q12857-2]
uc001czw.3. human. [Q12857-1]

Polymorphism databases

DMDMi14194959.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AB037860 mRNA. Translation: BAA92677.1 . Different initiation.
AK299289 mRNA. Translation: BAG61305.1 .
AK299579 mRNA. Translation: BAG61515.1 .
AC092784 Genomic DNA. No translation available.
AC096534 Genomic DNA. No translation available.
AC096947 Genomic DNA. No translation available.
AC099792 Genomic DNA. No translation available.
AL096888 Genomic DNA. No translation available.
AL355795 Genomic DNA. No translation available.
AL445198 Genomic DNA. No translation available.
AL445432 Genomic DNA. No translation available.
CH471059 Genomic DNA. Translation: EAX06601.1 .
BC022264 mRNA. Translation: AAH22264.1 .
U07809 mRNA. Translation: AAA93124.1 .
CCDSi CCDS44156.1. [Q12857-1 ]
CCDS53321.1. [Q12857-3 ]
CCDS53322.1. [Q12857-4 ]
CCDS615.1. [Q12857-2 ]
RefSeqi NP_001128145.1. NM_001134673.3. [Q12857-1 ]
NP_001138983.1. NM_001145511.1. [Q12857-3 ]
NP_001138984.1. NM_001145512.1. [Q12857-4 ]
NP_005586.1. NM_005595.4. [Q12857-2 ]
UniGenei Hs.740757.
Hs.744898.

3D structure databases

ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 110847. 34 interactions.
IntActi Q12857. 1 interaction.
MINTi MINT-6612489.
STRINGi 9606.ENSP00000384523.

PTM databases

PhosphoSitei Q12857.

Polymorphism databases

DMDMi 14194959.

Proteomic databases

MaxQBi Q12857.
PaxDbi Q12857.
PRIDEi Q12857.

Protocols and materials databases

DNASUi 4774.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000371187 ; ENSP00000360229 ; ENSG00000162599 . [Q12857-2 ]
ENST00000371189 ; ENSP00000360231 ; ENSG00000162599 . [Q12857-4 ]
ENST00000403491 ; ENSP00000384523 ; ENSG00000162599 . [Q12857-1 ]
ENST00000407417 ; ENSP00000384680 ; ENSG00000162599 . [Q12857-3 ]
GeneIDi 4774.
KEGGi hsa:4774.
UCSCi uc001czv.3. human. [Q12857-2 ]
uc001czw.3. human. [Q12857-1 ]

Organism-specific databases

CTDi 4774.
GeneCardsi GC01P061260.
HGNCi HGNC:7784. NFIA.
HPAi HPA006111.
HPA008884.
MIMi 600727. gene.
neXtProti NX_Q12857.
PharmGKBi PA31590.
HUGEi Search...
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG252172.
GeneTreei ENSGT00390000009905.
HOGENOMi HOG000013028.
HOVERGENi HBG006561.
InParanoidi Q12857.
KOi K09168.
OMAi KEQPENG.
OrthoDBi EOG7WDN2K.
PhylomeDBi Q12857.
TreeFami TF313889.

Enzyme and pathway databases

Reactomei REACT_22339. RNA Polymerase III Abortive And Retractive Initiation.
REACT_63. RNA Polymerase III Transcription Termination.

Miscellaneous databases

ChiTaRSi NFIA. human.
GeneWikii NFIA.
GenomeRNAii 4774.
NextBioi 18406.
PROi Q12857.
SOURCEi Search...

Gene expression databases

Bgeei Q12857.
CleanExi HS_NFIA.
ExpressionAtlasi Q12857. baseline and differential.
Genevestigatori Q12857.

Family and domain databases

InterProi IPR000647. CTF/NFI.
IPR020604. CTF/NFI_DNA-bd-dom.
IPR019739. CTF/NFI_DNA-bd_CS.
IPR019548. CTF/NFI_DNA-bd_N.
IPR003619. MAD_homology1_Dwarfin-type.
[Graphical view ]
PANTHERi PTHR11492. PTHR11492. 1 hit.
Pfami PF00859. CTF_NFI. 1 hit.
PF03165. MH1. 1 hit.
PF10524. NfI_DNAbd_pre-N. 1 hit.
[Graphical view ]
SMARTi SM00523. DWA. 1 hit.
[Graphical view ]
PROSITEi PS00349. CTF_NFI_1. 1 hit.
PS51080. CTF_NFI_2. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Prediction of the coding sequences of unidentified human genes. XVI. The complete sequences of 150 new cDNA clones from brain which code for large proteins in vitro."
    Nagase T., Kikuno R., Ishikawa K., Hirosawa M., Ohara O.
    DNA Res. 7:65-73(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Brain.
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3 AND 4).
    Tissue: Brain.
  3. "The DNA sequence and biological annotation of human chromosome 1."
    Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
    , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
    Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Skeletal muscle.
  6. "Chromosomal localization of the four genes (NFIA, B, C, and X) for the human transcription factor nuclear factor I by FISH."
    Qian F., Kruse U., Lichter P., Sippel A.E.
    Genomics 28:66-73(1995) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 19-243.
  7. "Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis."
    Cantin G.T., Yi W., Lu B., Park S.K., Xu T., Lee J.-D., Yates J.R. III
    J. Proteome Res. 7:1346-1351(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-287, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  8. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-258; SER-265; SER-280; SER-287; SER-300 AND SER-319, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  9. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
    Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
    Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-280 AND SER-287, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Leukemic T-cell.
  10. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
    Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
    Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-265; SER-280; SER-287; SER-300 AND SER-360, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.

Entry informationi

Entry nameiNFIA_HUMAN
AccessioniPrimary (citable) accession number: Q12857
Secondary accession number(s): B4DRJ3
, B4DS53, F5H0R0, F8W8W3, Q8TA97, Q9H3X9, Q9P2A9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 1, 2001
Last sequence update: June 1, 2001
Last modified: October 29, 2014
This is version 139 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3