Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q12815

- TROAP_HUMAN

UniProt

Q12815 - TROAP_HUMAN

Protein

Tastin

Gene

TROAP

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 105 (01 Oct 2014)
      Sequence version 3 (10 Feb 2009)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Could be involved with bystin and trophinin in a cell adhesion molecule complex that mediates an initial attachment of the blastocyst to uterine epithelial cells at the time of the embryo implantation.

    GO - Molecular functioni

    1. protein binding Source: IntAct

    GO - Biological processi

    1. cell adhesion Source: ProtInc

    Keywords - Biological processi

    Cell adhesion

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Tastin
    Alternative name(s):
    Trophinin-assisting protein
    Trophinin-associated protein
    Gene namesi
    Name:TROAP
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 12

    Organism-specific databases

    HGNCiHGNC:12327. TROAP.

    Subcellular locationi

    GO - Cellular componenti

    1. cytoplasm Source: ProtInc

    Keywords - Cellular componenti

    Cytoplasm

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA37003.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 778778TastinPRO_0000065636Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei16 – 161Phosphoserine1 Publication
    Modified residuei98 – 981Phosphoserine1 Publication
    Modified residuei324 – 3241Phosphoserine1 Publication
    Modified residuei334 – 3341Phosphoserine5 Publications
    Modified residuei344 – 3441Phosphoserine1 Publication
    Modified residuei362 – 3621Phosphoserine1 Publication
    Modified residuei363 – 3631Phosphothreonine1 Publication
    Modified residuei376 – 3761Phosphoserine1 Publication

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    MaxQBiQ12815.
    PaxDbiQ12815.
    PRIDEiQ12815.

    Expressioni

    Tissue specificityi

    Strong expression at implantation sites. Was exclusively localized to the apical side of the syncytiotrophoblast. Also found in macrophages.

    Gene expression databases

    ArrayExpressiQ12815.
    BgeeiQ12815.
    CleanExiHS_TROAP.
    GenevestigatoriQ12815.

    Organism-specific databases

    HPAiHPA044102.

    Interactioni

    Subunit structurei

    Directly binds bystin, and indirectly trophinin.

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    BYSLQ138959EBI-2349743,EBI-358049
    DYRK1AQ136273EBI-2349743,EBI-1053596
    DYRK1BQ9Y4633EBI-2349743,EBI-634187

    Protein-protein interaction databases

    BioGridi115341. 11 interactions.
    DIPiDIP-52951N.
    IntActiQ12815. 9 interactions.
    STRINGi9606.ENSP00000257909.

    Structurei

    3D structure databases

    ProteinModelPortaliQ12815.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Repeati516 – 548331Add
    BLAST
    Repeati549 – 581332Add
    BLAST
    Repeati582 – 614333Add
    BLAST
    Repeati615 – 647334Add
    BLAST

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni516 – 6471324 X 33 AA approximate tandem repeatsAdd
    BLAST

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi504 – 687184Cys-richAdd
    BLAST

    Keywords - Domaini

    Repeat

    Phylogenomic databases

    eggNOGiNOG47246.
    HOGENOMiHOG000082520.
    HOVERGENiHBG069140.
    InParanoidiQ12815.
    OMAiGNECANS.
    PhylomeDBiQ12815.
    TreeFamiTF338049.

    Family and domain databases

    InterProiIPR026133. Tastin.
    [Graphical view]
    PANTHERiPTHR15289. PTHR15289. 1 hit.

    Sequences (3)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q12815-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MTTRQATKDP LLRGVSPTPS KIPVRSQKRT PFPTVTSCAV DQENQDPRRW    50
    VQKPPLNIQR PLVDSAGPRP KARHQAETSQ RLVGISQPRN PLEELRPSPR 100
    GQNVGPGPPA QTEAPGTIEF VADPAALATI LSGEGVKSCH LGRQPSLAKR 150
    VLVRGSQGGT TQRVQGVRAS AYLAPRTPTH RLDPARASCF SRLEGPGPRG 200
    RTLCPQRLQA LISPSGPSFH PSTRPSFQEL RRETAGSSRT SVSQASGLLL 250
    ETPVQPAFSL PKGEREVVTH SDEGGVASLG LAQRVPLREN REMSHTRDSH 300
    DSHLMPSPAP VAQPLPGHVV PCPSPFGRAQ RVPSPGPPTL TSYSVLRRLT 350
    VQPKTRFTPM PSTPRVQQAQ WLRGVSPQSC SEDPALPWEQ VAVRLFDQES 400
    CIRSLEGSGK PPVATPSGPH SNRTPSLQEV KIQRIGILQQ LLRQEVEGLV 450
    GGQCVPLNGG SSLDMVELQP LLTEISRTLN ATEHNSGTSH LPGLLKHSGL 500
    PKPCLPEECG EPQPCPPAEP GPPEAFCRSE PEIPEPSLQE QLEVPEPYPP 550
    AEPRPLESCC RSEPEIPESS RQEQLEVPEP CPPAEPRPLE SYCRIEPEIP 600
    ESSRQEQLEV PEPCPPAEPG PLQPSTQGQS GPPGPCPRVE LGASEPCTLE 650
    HRSLESSLPP CCSQWAPATT SLIFSSQHPL CASPPICSLQ SLRPPAGQAG 700
    LSNLAPRTLA LRERLKSCLT AIHCFHEARL DDECAFYTSR APPSGPTRVC 750
    TNPVATLLEW QDALCFIPVG SAAPQGSP 778
    Length:778
    Mass (Da):83,857
    Last modified:February 10, 2009 - v3
    Checksum:i530B0481EC8D7E02
    GO
    Isoform 2 (identifier: Q12815-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         113-144: EAPGTIEFVADPAALATILSGEGVKSCHLGRQ → VLVPAPGKLFALRRSPFPPAKCHLARCHGLYL
         145-778: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:144
    Mass (Da):15,893
    Checksum:i59A5062A4CF71DD2
    GO
    Isoform 3 (identifier: Q12815-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         113-778: EAPGTIEFVA...VGSAAPQGSP → GAMACTCNHSYSGG

    Note: No experimental confirmation available.

    Show »
    Length:126
    Mass (Da):13,723
    Checksum:i644F8AB35FBBD459
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti224 – 2241R → H in AAA79333. (PubMed:7758945)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei113 – 778666EAPGT…PQGSP → GAMACTCNHSYSGG in isoform 3. 1 PublicationVSP_055063Add
    BLAST
    Alternative sequencei113 – 14432EAPGT…HLGRQ → VLVPAPGKLFALRRSPFPPA KCHLARCHGLYL in isoform 2. 1 PublicationVSP_042820Add
    BLAST
    Alternative sequencei145 – 778634Missing in isoform 2. 1 PublicationVSP_042821Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U04810 mRNA. Translation: AAA79333.2.
    AC125611 Genomic DNA. No translation available.
    CH471111 Genomic DNA. Translation: EAW58064.1.
    BC011597 mRNA. Translation: AAH11597.1.
    BC018627 mRNA. No translation available.
    BC032583 mRNA. Translation: AAH32583.1.
    CCDSiCCDS41779.1. [Q12815-2]
    CCDS61117.1. [Q12815-3]
    CCDS8784.1. [Q12815-1]
    PIRiI38487.
    RefSeqiNP_001094090.1. NM_001100620.1. [Q12815-2]
    NP_001265253.1. NM_001278324.1.
    NP_005471.3. NM_005480.3. [Q12815-1]
    UniGeneiHs.524399.

    Genome annotation databases

    EnsembliENST00000257909; ENSP00000257909; ENSG00000135451. [Q12815-1]
    ENST00000380327; ENSP00000369684; ENSG00000135451. [Q12815-2]
    ENST00000548311; ENSP00000448313; ENSG00000135451. [Q12815-3]
    GeneIDi10024.
    KEGGihsa:10024.
    UCSCiuc001rtw.4. human. [Q12815-2]
    uc001rtx.4. human. [Q12815-1]

    Polymorphism databases

    DMDMi223634724.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U04810 mRNA. Translation: AAA79333.2 .
    AC125611 Genomic DNA. No translation available.
    CH471111 Genomic DNA. Translation: EAW58064.1 .
    BC011597 mRNA. Translation: AAH11597.1 .
    BC018627 mRNA. No translation available.
    BC032583 mRNA. Translation: AAH32583.1 .
    CCDSi CCDS41779.1. [Q12815-2 ]
    CCDS61117.1. [Q12815-3 ]
    CCDS8784.1. [Q12815-1 ]
    PIRi I38487.
    RefSeqi NP_001094090.1. NM_001100620.1. [Q12815-2 ]
    NP_001265253.1. NM_001278324.1.
    NP_005471.3. NM_005480.3. [Q12815-1 ]
    UniGenei Hs.524399.

    3D structure databases

    ProteinModelPortali Q12815.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 115341. 11 interactions.
    DIPi DIP-52951N.
    IntActi Q12815. 9 interactions.
    STRINGi 9606.ENSP00000257909.

    Polymorphism databases

    DMDMi 223634724.

    Proteomic databases

    MaxQBi Q12815.
    PaxDbi Q12815.
    PRIDEi Q12815.

    Protocols and materials databases

    DNASUi 10024.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000257909 ; ENSP00000257909 ; ENSG00000135451 . [Q12815-1 ]
    ENST00000380327 ; ENSP00000369684 ; ENSG00000135451 . [Q12815-2 ]
    ENST00000548311 ; ENSP00000448313 ; ENSG00000135451 . [Q12815-3 ]
    GeneIDi 10024.
    KEGGi hsa:10024.
    UCSCi uc001rtw.4. human. [Q12815-2 ]
    uc001rtx.4. human. [Q12815-1 ]

    Organism-specific databases

    CTDi 10024.
    GeneCardsi GC12P049716.
    H-InvDB HIX0010602.
    HGNCi HGNC:12327. TROAP.
    HPAi HPA044102.
    MIMi 603872. gene.
    neXtProti NX_Q12815.
    PharmGKBi PA37003.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG47246.
    HOGENOMi HOG000082520.
    HOVERGENi HBG069140.
    InParanoidi Q12815.
    OMAi GNECANS.
    PhylomeDBi Q12815.
    TreeFami TF338049.

    Miscellaneous databases

    GeneWikii TROAP.
    GenomeRNAii 10024.
    NextBioi 35511563.
    PROi Q12815.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q12815.
    Bgeei Q12815.
    CleanExi HS_TROAP.
    Genevestigatori Q12815.

    Family and domain databases

    InterProi IPR026133. Tastin.
    [Graphical view ]
    PANTHERi PTHR15289. PTHR15289. 1 hit.
    ProtoNeti Search...

    Publicationsi

    1. "Trophinin and tastin, a novel cell adhesion molecule complex with potential involvement in embryo implantation."
      Fukuda M.N., Sato T., Nakayama J., Klier G., Mikami M., Aoki D., Nozawa S.
      Genes Dev. 9:1199-1210(1995) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    2. Fukuda M., Sato T.
      Submitted (JUL-2003) to the EMBL/GenBank/DDBJ databases
      Cited for: SEQUENCE REVISION TO 714 AND 742.
    3. "The finished DNA sequence of human chromosome 12."
      Scherer S.E., Muzny D.M., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R.
      , Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Montgomery K.T., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Lovering R.C., Wheeler D.A., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clerc-Blankenburg K.P., Davis C., Delgado O., Dinh H.H., Draper H., Gonzalez-Garay M.L., Havlak P., Jackson L.R., Jacob L.S., Kelly S.H., Li L., Li Z., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Pasternak S., Perez L.M., Plopper F.J.H., Santibanez J., Shen H., Tabor P.E., Verduzco D., Waldron L., Wang Q., Williams G.A., Zhang J., Zhou J., Allen C.C., Amin A.G., Anyalebechi V., Bailey M., Barbaria J.A., Bimage K.E., Bryant N.P., Burch P.E., Burkett C.E., Burrell K.L., Calderon E., Cardenas V., Carter K., Casias K., Cavazos I., Cavazos S.R., Ceasar H., Chacko J., Chan S.N., Chavez D., Christopoulos C., Chu J., Cockrell R., Cox C.D., Dang M., Dathorne S.R., David R., Davis C.M., Davy-Carroll L., Deshazo D.R., Donlin J.E., D'Souza L., Eaves K.A., Egan A., Emery-Cohen A.J., Escotto M., Flagg N., Forbes L.D., Gabisi A.M., Garza M., Hamilton C., Henderson N., Hernandez O., Hines S., Hogues M.E., Huang M., Idlebird D.G., Johnson R., Jolivet A., Jones S., Kagan R., King L.M., Leal B., Lebow H., Lee S., LeVan J.M., Lewis L.C., London P., Lorensuhewa L.M., Loulseged H., Lovett D.A., Lucier A., Lucier R.L., Ma J., Madu R.C., Mapua P., Martindale A.D., Martinez E., Massey E., Mawhiney S., Meador M.G., Mendez S., Mercado C., Mercado I.C., Merritt C.E., Miner Z.L., Minja E., Mitchell T., Mohabbat F., Mohabbat K., Montgomery B., Moore N., Morris S., Munidasa M., Ngo R.N., Nguyen N.B., Nickerson E., Nwaokelemeh O.O., Nwokenkwo S., Obregon M., Oguh M., Oragunye N., Oviedo R.J., Parish B.J., Parker D.N., Parrish J., Parks K.L., Paul H.A., Payton B.A., Perez A., Perrin W., Pickens A., Primus E.L., Pu L.-L., Puazo M., Quiles M.M., Quiroz J.B., Rabata D., Reeves K., Ruiz S.J., Shao H., Sisson I., Sonaike T., Sorelle R.P., Sutton A.E., Svatek A.F., Svetz L.A., Tamerisa K.S., Taylor T.R., Teague B., Thomas N., Thorn R.D., Trejos Z.Y., Trevino B.K., Ukegbu O.N., Urban J.B., Vasquez L.I., Vera V.A., Villasana D.M., Wang L., Ward-Moore S., Warren J.T., Wei X., White F., Williamson A.L., Wleczyk R., Wooden H.S., Wooden S.H., Yen J., Yoon L., Yoon V., Zorrilla S.E., Nelson D., Kucherlapati R., Weinstock G., Gibbs R.A.
      Nature 440:346-351(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2 AND 3).
      Tissue: Lymph.
    6. "A probability-based approach for high-throughput protein phosphorylation analysis and site localization."
      Beausoleil S.A., Villen J., Gerber S.A., Rush J., Gygi S.P.
      Nat. Biotechnol. 24:1285-1292(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-334 AND SER-344, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    7. "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle."
      Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M.
      Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-98; SER-334 AND SER-376, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    8. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-16; SER-324; SER-334; SER-362 AND THR-363, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    9. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
      Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
      Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-334, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Leukemic T-cell.
    10. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
      Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
      Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-334, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.

    Entry informationi

    Entry nameiTROAP_HUMAN
    AccessioniPrimary (citable) accession number: Q12815
    Secondary accession number(s): F8VSF9, Q6PJU7, Q8N5B2
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: May 30, 2000
    Last sequence update: February 10, 2009
    Last modified: October 1, 2014
    This is version 105 of the entry and version 3 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 12
      Human chromosome 12: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

    External Data

    Dasty 3