Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Tastin

Gene

TROAP

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Could be involved with bystin and trophinin in a cell adhesion molecule complex that mediates an initial attachment of the blastocyst to uterine epithelial cells at the time of the embryo implantation.

GO - Biological processi

  • cell adhesion Source: ProtInc
Complete GO annotation...

Keywords - Biological processi

Cell adhesion

Enzyme and pathway databases

BioCyciZFISH:ENSG00000135451-MONOMER.

Names & Taxonomyi

Protein namesi
Recommended name:
Tastin
Alternative name(s):
Trophinin-assisting protein
Trophinin-associated protein
Gene namesi
Name:TROAP
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 12

Organism-specific databases

HGNCiHGNC:12327. TROAP.

Subcellular locationi

GO - Cellular componenti

  • cytoplasm Source: ProtInc
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000135451.
PharmGKBiPA37003.

Polymorphism and mutation databases

BioMutaiTROAP.
DMDMi223634724.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000656361 – 778TastinAdd BLAST778

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei16PhosphoserineCombined sources1
Modified residuei98PhosphoserineCombined sources1
Modified residuei170PhosphoserineCombined sources1
Modified residuei324PhosphoserineCombined sources1
Modified residuei334PhosphoserineCombined sources1
Modified residuei344PhosphoserineCombined sources1
Modified residuei362PhosphoserineCombined sources1
Modified residuei363PhosphothreonineCombined sources1
Modified residuei376PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ12815.
MaxQBiQ12815.
PaxDbiQ12815.
PeptideAtlasiQ12815.
PRIDEiQ12815.

PTM databases

iPTMnetiQ12815.
PhosphoSitePlusiQ12815.

Expressioni

Tissue specificityi

Strong expression at implantation sites. Was exclusively localized to the apical side of the syncytiotrophoblast. Also found in macrophages.

Gene expression databases

BgeeiENSG00000135451.
CleanExiHS_TROAP.
ExpressionAtlasiQ12815. baseline and differential.
GenevisibleiQ12815. HS.

Organism-specific databases

HPAiHPA044102.

Interactioni

Subunit structurei

Directly binds bystin, and indirectly trophinin.

Binary interactionsi

WithEntry#Exp.IntActNotes
BANPQ8N9N53EBI-2349743,EBI-744695
BYSLQ138959EBI-2349743,EBI-358049
DYRK1AQ136273EBI-2349743,EBI-1053596
DYRK1BQ9Y4635EBI-2349743,EBI-634187
KRT31Q153233EBI-2349743,EBI-948001
KRT40Q6A1623EBI-2349743,EBI-10171697
MAPRE1Q156917EBI-2349743,EBI-1004115
MAPRE3Q9UPY86EBI-2349743,EBI-726739
TRAF2Q129333EBI-2349743,EBI-355744
TRIM23P364065EBI-2349743,EBI-740098

Protein-protein interaction databases

BioGridi115341. 32 interactors.
DIPiDIP-52951N.
IntActiQ12815. 23 interactors.
STRINGi9606.ENSP00000257909.

Structurei

3D structure databases

ProteinModelPortaliQ12815.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati516 – 5481Add BLAST33
Repeati549 – 5812Add BLAST33
Repeati582 – 6143Add BLAST33
Repeati615 – 6474Add BLAST33

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni516 – 6474 X 33 AA approximate tandem repeatsAdd BLAST132

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi504 – 687Cys-richAdd BLAST184

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiENOG410IVG9. Eukaryota.
ENOG41118NJ. LUCA.
GeneTreeiENSGT00390000012132.
HOGENOMiHOG000082520.
HOVERGENiHBG069140.
InParanoidiQ12815.
PhylomeDBiQ12815.
TreeFamiTF338049.

Family and domain databases

InterProiIPR026133. Tastin.
[Graphical view]
PANTHERiPTHR15289. PTHR15289. 1 hit.

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q12815-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MTTRQATKDP LLRGVSPTPS KIPVRSQKRT PFPTVTSCAV DQENQDPRRW
60 70 80 90 100
VQKPPLNIQR PLVDSAGPRP KARHQAETSQ RLVGISQPRN PLEELRPSPR
110 120 130 140 150
GQNVGPGPPA QTEAPGTIEF VADPAALATI LSGEGVKSCH LGRQPSLAKR
160 170 180 190 200
VLVRGSQGGT TQRVQGVRAS AYLAPRTPTH RLDPARASCF SRLEGPGPRG
210 220 230 240 250
RTLCPQRLQA LISPSGPSFH PSTRPSFQEL RRETAGSSRT SVSQASGLLL
260 270 280 290 300
ETPVQPAFSL PKGEREVVTH SDEGGVASLG LAQRVPLREN REMSHTRDSH
310 320 330 340 350
DSHLMPSPAP VAQPLPGHVV PCPSPFGRAQ RVPSPGPPTL TSYSVLRRLT
360 370 380 390 400
VQPKTRFTPM PSTPRVQQAQ WLRGVSPQSC SEDPALPWEQ VAVRLFDQES
410 420 430 440 450
CIRSLEGSGK PPVATPSGPH SNRTPSLQEV KIQRIGILQQ LLRQEVEGLV
460 470 480 490 500
GGQCVPLNGG SSLDMVELQP LLTEISRTLN ATEHNSGTSH LPGLLKHSGL
510 520 530 540 550
PKPCLPEECG EPQPCPPAEP GPPEAFCRSE PEIPEPSLQE QLEVPEPYPP
560 570 580 590 600
AEPRPLESCC RSEPEIPESS RQEQLEVPEP CPPAEPRPLE SYCRIEPEIP
610 620 630 640 650
ESSRQEQLEV PEPCPPAEPG PLQPSTQGQS GPPGPCPRVE LGASEPCTLE
660 670 680 690 700
HRSLESSLPP CCSQWAPATT SLIFSSQHPL CASPPICSLQ SLRPPAGQAG
710 720 730 740 750
LSNLAPRTLA LRERLKSCLT AIHCFHEARL DDECAFYTSR APPSGPTRVC
760 770
TNPVATLLEW QDALCFIPVG SAAPQGSP
Length:778
Mass (Da):83,857
Last modified:February 10, 2009 - v3
Checksum:i530B0481EC8D7E02
GO
Isoform 2 (identifier: Q12815-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     113-144: EAPGTIEFVADPAALATILSGEGVKSCHLGRQ → VLVPAPGKLFALRRSPFPPAKCHLARCHGLYL
     145-778: Missing.

Note: No experimental confirmation available.
Show »
Length:144
Mass (Da):15,893
Checksum:i59A5062A4CF71DD2
GO
Isoform 3 (identifier: Q12815-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     113-778: EAPGTIEFVA...VGSAAPQGSP → GAMACTCNHSYSGG

Note: No experimental confirmation available.
Show »
Length:126
Mass (Da):13,723
Checksum:i644F8AB35FBBD459
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti224R → H in AAA79333 (PubMed:7758945).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_055063113 – 778EAPGT…PQGSP → GAMACTCNHSYSGG in isoform 3. 1 PublicationAdd BLAST666
Alternative sequenceiVSP_042820113 – 144EAPGT…HLGRQ → VLVPAPGKLFALRRSPFPPA KCHLARCHGLYL in isoform 2. 1 PublicationAdd BLAST32
Alternative sequenceiVSP_042821145 – 778Missing in isoform 2. 1 PublicationAdd BLAST634

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U04810 mRNA. Translation: AAA79333.2.
AC125611 Genomic DNA. No translation available.
CH471111 Genomic DNA. Translation: EAW58064.1.
BC011597 mRNA. Translation: AAH11597.1.
BC018627 mRNA. No translation available.
BC032583 mRNA. Translation: AAH32583.1.
CCDSiCCDS41779.1. [Q12815-2]
CCDS61117.1. [Q12815-3]
CCDS8784.1. [Q12815-1]
PIRiI38487.
RefSeqiNP_001094090.1. NM_001100620.1. [Q12815-2]
NP_001265253.1. NM_001278324.1. [Q12815-3]
NP_005471.3. NM_005480.3. [Q12815-1]
XP_011536027.1. XM_011537725.2. [Q12815-3]
UniGeneiHs.524399.

Genome annotation databases

EnsembliENST00000257909; ENSP00000257909; ENSG00000135451. [Q12815-1]
ENST00000380327; ENSP00000369684; ENSG00000135451. [Q12815-2]
ENST00000548311; ENSP00000448313; ENSG00000135451. [Q12815-3]
GeneIDi10024.
KEGGihsa:10024.
UCSCiuc001rtv.5. human. [Q12815-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U04810 mRNA. Translation: AAA79333.2.
AC125611 Genomic DNA. No translation available.
CH471111 Genomic DNA. Translation: EAW58064.1.
BC011597 mRNA. Translation: AAH11597.1.
BC018627 mRNA. No translation available.
BC032583 mRNA. Translation: AAH32583.1.
CCDSiCCDS41779.1. [Q12815-2]
CCDS61117.1. [Q12815-3]
CCDS8784.1. [Q12815-1]
PIRiI38487.
RefSeqiNP_001094090.1. NM_001100620.1. [Q12815-2]
NP_001265253.1. NM_001278324.1. [Q12815-3]
NP_005471.3. NM_005480.3. [Q12815-1]
XP_011536027.1. XM_011537725.2. [Q12815-3]
UniGeneiHs.524399.

3D structure databases

ProteinModelPortaliQ12815.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi115341. 32 interactors.
DIPiDIP-52951N.
IntActiQ12815. 23 interactors.
STRINGi9606.ENSP00000257909.

PTM databases

iPTMnetiQ12815.
PhosphoSitePlusiQ12815.

Polymorphism and mutation databases

BioMutaiTROAP.
DMDMi223634724.

Proteomic databases

EPDiQ12815.
MaxQBiQ12815.
PaxDbiQ12815.
PeptideAtlasiQ12815.
PRIDEiQ12815.

Protocols and materials databases

DNASUi10024.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000257909; ENSP00000257909; ENSG00000135451. [Q12815-1]
ENST00000380327; ENSP00000369684; ENSG00000135451. [Q12815-2]
ENST00000548311; ENSP00000448313; ENSG00000135451. [Q12815-3]
GeneIDi10024.
KEGGihsa:10024.
UCSCiuc001rtv.5. human. [Q12815-1]

Organism-specific databases

CTDi10024.
GeneCardsiTROAP.
H-InvDBHIX0010602.
HGNCiHGNC:12327. TROAP.
HPAiHPA044102.
MIMi603872. gene.
neXtProtiNX_Q12815.
OpenTargetsiENSG00000135451.
PharmGKBiPA37003.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IVG9. Eukaryota.
ENOG41118NJ. LUCA.
GeneTreeiENSGT00390000012132.
HOGENOMiHOG000082520.
HOVERGENiHBG069140.
InParanoidiQ12815.
PhylomeDBiQ12815.
TreeFamiTF338049.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000135451-MONOMER.

Miscellaneous databases

ChiTaRSiTROAP. human.
GeneWikiiTROAP.
GenomeRNAii10024.
PROiQ12815.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000135451.
CleanExiHS_TROAP.
ExpressionAtlasiQ12815. baseline and differential.
GenevisibleiQ12815. HS.

Family and domain databases

InterProiIPR026133. Tastin.
[Graphical view]
PANTHERiPTHR15289. PTHR15289. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiTROAP_HUMAN
AccessioniPrimary (citable) accession number: Q12815
Secondary accession number(s): F8VSF9, Q6PJU7, Q8N5B2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: February 10, 2009
Last modified: November 30, 2016
This is version 125 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.