Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q12815

- TROAP_HUMAN

UniProt

Q12815 - TROAP_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Tastin

Gene

TROAP

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Could be involved with bystin and trophinin in a cell adhesion molecule complex that mediates an initial attachment of the blastocyst to uterine epithelial cells at the time of the embryo implantation.

GO - Biological processi

  1. cell adhesion Source: ProtInc
Complete GO annotation...

Keywords - Biological processi

Cell adhesion

Names & Taxonomyi

Protein namesi
Recommended name:
Tastin
Alternative name(s):
Trophinin-assisting protein
Trophinin-associated protein
Gene namesi
Name:TROAP
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 12

Organism-specific databases

HGNCiHGNC:12327. TROAP.

Subcellular locationi

GO - Cellular componenti

  1. cytoplasm Source: ProtInc
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA37003.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 778778TastinPRO_0000065636Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei16 – 161Phosphoserine1 Publication
Modified residuei98 – 981Phosphoserine1 Publication
Modified residuei324 – 3241Phosphoserine1 Publication
Modified residuei334 – 3341Phosphoserine5 Publications
Modified residuei344 – 3441Phosphoserine1 Publication
Modified residuei362 – 3621Phosphoserine1 Publication
Modified residuei363 – 3631Phosphothreonine1 Publication
Modified residuei376 – 3761Phosphoserine1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ12815.
PaxDbiQ12815.
PRIDEiQ12815.

Expressioni

Tissue specificityi

Strong expression at implantation sites. Was exclusively localized to the apical side of the syncytiotrophoblast. Also found in macrophages.

Gene expression databases

BgeeiQ12815.
CleanExiHS_TROAP.
ExpressionAtlasiQ12815. baseline and differential.
GenevestigatoriQ12815.

Organism-specific databases

HPAiHPA044102.

Interactioni

Subunit structurei

Directly binds bystin, and indirectly trophinin.

Binary interactionsi

WithEntry#Exp.IntActNotes
BYSLQ138959EBI-2349743,EBI-358049
DYRK1AQ136273EBI-2349743,EBI-1053596
DYRK1BQ9Y4633EBI-2349743,EBI-634187

Protein-protein interaction databases

BioGridi115341. 13 interactions.
DIPiDIP-52951N.
IntActiQ12815. 9 interactions.
STRINGi9606.ENSP00000257909.

Structurei

3D structure databases

ProteinModelPortaliQ12815.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Repeati516 – 548331Add
BLAST
Repeati549 – 581332Add
BLAST
Repeati582 – 614333Add
BLAST
Repeati615 – 647334Add
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni516 – 6471324 X 33 AA approximate tandem repeatsAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi504 – 687184Cys-richAdd
BLAST

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiNOG47246.
GeneTreeiENSGT00390000012132.
HOGENOMiHOG000082520.
HOVERGENiHBG069140.
InParanoidiQ12815.
OMAiGNECANS.
PhylomeDBiQ12815.
TreeFamiTF338049.

Family and domain databases

InterProiIPR026133. Tastin.
[Graphical view]
PANTHERiPTHR15289. PTHR15289. 1 hit.

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q12815-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MTTRQATKDP LLRGVSPTPS KIPVRSQKRT PFPTVTSCAV DQENQDPRRW
60 70 80 90 100
VQKPPLNIQR PLVDSAGPRP KARHQAETSQ RLVGISQPRN PLEELRPSPR
110 120 130 140 150
GQNVGPGPPA QTEAPGTIEF VADPAALATI LSGEGVKSCH LGRQPSLAKR
160 170 180 190 200
VLVRGSQGGT TQRVQGVRAS AYLAPRTPTH RLDPARASCF SRLEGPGPRG
210 220 230 240 250
RTLCPQRLQA LISPSGPSFH PSTRPSFQEL RRETAGSSRT SVSQASGLLL
260 270 280 290 300
ETPVQPAFSL PKGEREVVTH SDEGGVASLG LAQRVPLREN REMSHTRDSH
310 320 330 340 350
DSHLMPSPAP VAQPLPGHVV PCPSPFGRAQ RVPSPGPPTL TSYSVLRRLT
360 370 380 390 400
VQPKTRFTPM PSTPRVQQAQ WLRGVSPQSC SEDPALPWEQ VAVRLFDQES
410 420 430 440 450
CIRSLEGSGK PPVATPSGPH SNRTPSLQEV KIQRIGILQQ LLRQEVEGLV
460 470 480 490 500
GGQCVPLNGG SSLDMVELQP LLTEISRTLN ATEHNSGTSH LPGLLKHSGL
510 520 530 540 550
PKPCLPEECG EPQPCPPAEP GPPEAFCRSE PEIPEPSLQE QLEVPEPYPP
560 570 580 590 600
AEPRPLESCC RSEPEIPESS RQEQLEVPEP CPPAEPRPLE SYCRIEPEIP
610 620 630 640 650
ESSRQEQLEV PEPCPPAEPG PLQPSTQGQS GPPGPCPRVE LGASEPCTLE
660 670 680 690 700
HRSLESSLPP CCSQWAPATT SLIFSSQHPL CASPPICSLQ SLRPPAGQAG
710 720 730 740 750
LSNLAPRTLA LRERLKSCLT AIHCFHEARL DDECAFYTSR APPSGPTRVC
760 770
TNPVATLLEW QDALCFIPVG SAAPQGSP
Length:778
Mass (Da):83,857
Last modified:February 10, 2009 - v3
Checksum:i530B0481EC8D7E02
GO
Isoform 2 (identifier: Q12815-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     113-144: EAPGTIEFVADPAALATILSGEGVKSCHLGRQ → VLVPAPGKLFALRRSPFPPAKCHLARCHGLYL
     145-778: Missing.

Note: No experimental confirmation available.

Show »
Length:144
Mass (Da):15,893
Checksum:i59A5062A4CF71DD2
GO
Isoform 3 (identifier: Q12815-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     113-778: EAPGTIEFVA...VGSAAPQGSP → GAMACTCNHSYSGG

Note: No experimental confirmation available.

Show »
Length:126
Mass (Da):13,723
Checksum:i644F8AB35FBBD459
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti224 – 2241R → H in AAA79333. (PubMed:7758945)Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei113 – 778666EAPGT…PQGSP → GAMACTCNHSYSGG in isoform 3. 1 PublicationVSP_055063Add
BLAST
Alternative sequencei113 – 14432EAPGT…HLGRQ → VLVPAPGKLFALRRSPFPPA KCHLARCHGLYL in isoform 2. 1 PublicationVSP_042820Add
BLAST
Alternative sequencei145 – 778634Missing in isoform 2. 1 PublicationVSP_042821Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U04810 mRNA. Translation: AAA79333.2.
AC125611 Genomic DNA. No translation available.
CH471111 Genomic DNA. Translation: EAW58064.1.
BC011597 mRNA. Translation: AAH11597.1.
BC018627 mRNA. No translation available.
BC032583 mRNA. Translation: AAH32583.1.
CCDSiCCDS41779.1. [Q12815-2]
CCDS61117.1. [Q12815-3]
CCDS8784.1. [Q12815-1]
PIRiI38487.
RefSeqiNP_001094090.1. NM_001100620.1. [Q12815-2]
NP_001265253.1. NM_001278324.1. [Q12815-3]
NP_005471.3. NM_005480.3. [Q12815-1]
UniGeneiHs.524399.

Genome annotation databases

EnsembliENST00000257909; ENSP00000257909; ENSG00000135451. [Q12815-1]
ENST00000380327; ENSP00000369684; ENSG00000135451. [Q12815-2]
ENST00000548311; ENSP00000448313; ENSG00000135451. [Q12815-3]
GeneIDi10024.
KEGGihsa:10024.
UCSCiuc001rtw.4. human. [Q12815-2]
uc001rtx.4. human. [Q12815-1]

Polymorphism databases

DMDMi223634724.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U04810 mRNA. Translation: AAA79333.2 .
AC125611 Genomic DNA. No translation available.
CH471111 Genomic DNA. Translation: EAW58064.1 .
BC011597 mRNA. Translation: AAH11597.1 .
BC018627 mRNA. No translation available.
BC032583 mRNA. Translation: AAH32583.1 .
CCDSi CCDS41779.1. [Q12815-2 ]
CCDS61117.1. [Q12815-3 ]
CCDS8784.1. [Q12815-1 ]
PIRi I38487.
RefSeqi NP_001094090.1. NM_001100620.1. [Q12815-2 ]
NP_001265253.1. NM_001278324.1. [Q12815-3 ]
NP_005471.3. NM_005480.3. [Q12815-1 ]
UniGenei Hs.524399.

3D structure databases

ProteinModelPortali Q12815.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 115341. 13 interactions.
DIPi DIP-52951N.
IntActi Q12815. 9 interactions.
STRINGi 9606.ENSP00000257909.

Polymorphism databases

DMDMi 223634724.

Proteomic databases

MaxQBi Q12815.
PaxDbi Q12815.
PRIDEi Q12815.

Protocols and materials databases

DNASUi 10024.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000257909 ; ENSP00000257909 ; ENSG00000135451 . [Q12815-1 ]
ENST00000380327 ; ENSP00000369684 ; ENSG00000135451 . [Q12815-2 ]
ENST00000548311 ; ENSP00000448313 ; ENSG00000135451 . [Q12815-3 ]
GeneIDi 10024.
KEGGi hsa:10024.
UCSCi uc001rtw.4. human. [Q12815-2 ]
uc001rtx.4. human. [Q12815-1 ]

Organism-specific databases

CTDi 10024.
GeneCardsi GC12P049716.
H-InvDB HIX0010602.
HGNCi HGNC:12327. TROAP.
HPAi HPA044102.
MIMi 603872. gene.
neXtProti NX_Q12815.
PharmGKBi PA37003.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG47246.
GeneTreei ENSGT00390000012132.
HOGENOMi HOG000082520.
HOVERGENi HBG069140.
InParanoidi Q12815.
OMAi GNECANS.
PhylomeDBi Q12815.
TreeFami TF338049.

Miscellaneous databases

GeneWikii TROAP.
GenomeRNAii 10024.
NextBioi 35511563.
PROi Q12815.
SOURCEi Search...

Gene expression databases

Bgeei Q12815.
CleanExi HS_TROAP.
ExpressionAtlasi Q12815. baseline and differential.
Genevestigatori Q12815.

Family and domain databases

InterProi IPR026133. Tastin.
[Graphical view ]
PANTHERi PTHR15289. PTHR15289. 1 hit.
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Trophinin and tastin, a novel cell adhesion molecule complex with potential involvement in embryo implantation."
    Fukuda M.N., Sato T., Nakayama J., Klier G., Mikami M., Aoki D., Nozawa S.
    Genes Dev. 9:1199-1210(1995) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  2. Fukuda M., Sato T.
    Submitted (JUL-2003) to the EMBL/GenBank/DDBJ databases
    Cited for: SEQUENCE REVISION TO 714 AND 742.
  3. "The finished DNA sequence of human chromosome 12."
    Scherer S.E., Muzny D.M., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R.
    , Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Montgomery K.T., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Lovering R.C., Wheeler D.A., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clerc-Blankenburg K.P., Davis C., Delgado O., Dinh H.H., Draper H., Gonzalez-Garay M.L., Havlak P., Jackson L.R., Jacob L.S., Kelly S.H., Li L., Li Z., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Pasternak S., Perez L.M., Plopper F.J.H., Santibanez J., Shen H., Tabor P.E., Verduzco D., Waldron L., Wang Q., Williams G.A., Zhang J., Zhou J., Allen C.C., Amin A.G., Anyalebechi V., Bailey M., Barbaria J.A., Bimage K.E., Bryant N.P., Burch P.E., Burkett C.E., Burrell K.L., Calderon E., Cardenas V., Carter K., Casias K., Cavazos I., Cavazos S.R., Ceasar H., Chacko J., Chan S.N., Chavez D., Christopoulos C., Chu J., Cockrell R., Cox C.D., Dang M., Dathorne S.R., David R., Davis C.M., Davy-Carroll L., Deshazo D.R., Donlin J.E., D'Souza L., Eaves K.A., Egan A., Emery-Cohen A.J., Escotto M., Flagg N., Forbes L.D., Gabisi A.M., Garza M., Hamilton C., Henderson N., Hernandez O., Hines S., Hogues M.E., Huang M., Idlebird D.G., Johnson R., Jolivet A., Jones S., Kagan R., King L.M., Leal B., Lebow H., Lee S., LeVan J.M., Lewis L.C., London P., Lorensuhewa L.M., Loulseged H., Lovett D.A., Lucier A., Lucier R.L., Ma J., Madu R.C., Mapua P., Martindale A.D., Martinez E., Massey E., Mawhiney S., Meador M.G., Mendez S., Mercado C., Mercado I.C., Merritt C.E., Miner Z.L., Minja E., Mitchell T., Mohabbat F., Mohabbat K., Montgomery B., Moore N., Morris S., Munidasa M., Ngo R.N., Nguyen N.B., Nickerson E., Nwaokelemeh O.O., Nwokenkwo S., Obregon M., Oguh M., Oragunye N., Oviedo R.J., Parish B.J., Parker D.N., Parrish J., Parks K.L., Paul H.A., Payton B.A., Perez A., Perrin W., Pickens A., Primus E.L., Pu L.-L., Puazo M., Quiles M.M., Quiroz J.B., Rabata D., Reeves K., Ruiz S.J., Shao H., Sisson I., Sonaike T., Sorelle R.P., Sutton A.E., Svatek A.F., Svetz L.A., Tamerisa K.S., Taylor T.R., Teague B., Thomas N., Thorn R.D., Trejos Z.Y., Trevino B.K., Ukegbu O.N., Urban J.B., Vasquez L.I., Vera V.A., Villasana D.M., Wang L., Ward-Moore S., Warren J.T., Wei X., White F., Williamson A.L., Wleczyk R., Wooden H.S., Wooden S.H., Yen J., Yoon L., Yoon V., Zorrilla S.E., Nelson D., Kucherlapati R., Weinstock G., Gibbs R.A.
    Nature 440:346-351(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2 AND 3).
    Tissue: Lymph.
  6. "A probability-based approach for high-throughput protein phosphorylation analysis and site localization."
    Beausoleil S.A., Villen J., Gerber S.A., Rush J., Gygi S.P.
    Nat. Biotechnol. 24:1285-1292(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-334 AND SER-344, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  7. "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle."
    Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M.
    Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-98; SER-334 AND SER-376, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  8. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-16; SER-324; SER-334; SER-362 AND THR-363, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  9. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
    Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
    Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-334, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Leukemic T-cell.
  10. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
    Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
    Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-334, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.

Entry informationi

Entry nameiTROAP_HUMAN
AccessioniPrimary (citable) accession number: Q12815
Secondary accession number(s): F8VSF9, Q6PJU7, Q8N5B2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: February 10, 2009
Last modified: October 29, 2014
This is version 106 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

External Data

Dasty 3