Q12815 (TROAP_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 29, 2013.
Version 92.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Tastin Alternative name(s): Trophinin-assisting protein Trophinin-associated protein | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 778 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Could be involved with bystin and trophinin in a cell adhesion molecule complex that mediates an initial attachment of the blastocyst to uterine epithelial cells at the time of the embryo implantation. |
| Subunit structure | Directly binds bystin, and indirectly trophinin. |
| Subcellular location | |
| Tissue specificity | Strong expression at implantation sites. Was exclusively localized to the apical side of the syncytiotrophoblast. Also found in macrophages. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Cell adhesion |
| Cellular component | Cytoplasm |
| Coding sequence diversity | Alternative splicing |
| Domain | Repeat |
| PTM | Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | cell adhesion Traceable author statement Ref.1. Source: ProtInc |
| Cellular_component | cytoplasm Traceable author statement Ref.1. Source: ProtInc |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| BYSL | Q13895 | 9 | EBI-2349743,EBI-358049 |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q12815-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q12815-2) The sequence of this isoform differs from the canonical sequence as follows: 113-144: EAPGTIEFVADPAALATILSGEGVKSCHLGRQ → VLVPAPGKLFALRRSPFPPAKCHLARCHGLYL 145-778: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 778 | 778 | Tastin | PRO_0000065636 | |||||
Regions | |||||||||
| Repeat | 516 – 548 | 33 | 1 | ||||||
| Repeat | 549 – 581 | 33 | 2 | ||||||
| Repeat | 582 – 614 | 33 | 3 | ||||||
| Repeat | 615 – 647 | 33 | 4 | ||||||
| Region | 516 – 647 | 132 | 4 X 33 AA approximate tandem repeats | ||||||
| Compositional bias | 504 – 687 | 184 | Cys-rich | ||||||
Amino acid modifications | |||||||||
| Modified residue | 16 | 1 | Phosphoserine Ref.8 | ||||||
| Modified residue | 98 | 1 | Phosphoserine Ref.7 | ||||||
| Modified residue | 324 | 1 | Phosphoserine Ref.8 | ||||||
| Modified residue | 334 | 1 | Phosphoserine Ref.6 Ref.7 Ref.8 Ref.9 Ref.10 | ||||||
| Modified residue | 344 | 1 | Phosphoserine Ref.6 | ||||||
| Modified residue | 362 | 1 | Phosphoserine Ref.8 | ||||||
| Modified residue | 363 | 1 | Phosphothreonine Ref.8 | ||||||
| Modified residue | 376 | 1 | Phosphoserine Ref.7 | ||||||
Natural variations | |||||||||
| Alternative sequence | 113 – 144 | 32 | EAPGT…HLGRQ → VLVPAPGKLFALRRSPFPPA KCHLARCHGLYL in isoform 2. | VSP_042820 | |||||
| Alternative sequence | 145 – 778 | 634 | Missing in isoform 2. | VSP_042821 | |||||
Experimental info | |||||||||
| Sequence conflict | 224 | 1 | R → H in AAA79333. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Trophinin and tastin, a novel cell adhesion molecule complex with potential involvement in embryo implantation." Fukuda M.N., Sato T., Nakayama J., Klier G., Mikami M., Aoki D., Nozawa S. Genes Dev. 9:1199-1210(1995) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [2] | Fukuda M., Sato T. Submitted (JUL-2003) to the EMBL/GenBank/DDBJ databases Cited for: SEQUENCE REVISION TO 714 AND 742. |
| [3] | "The finished DNA sequence of human chromosome 12." Scherer S.E., Muzny D.M., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R. Gibbs R.A.Nature 440:346-351(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). Tissue: Lymph. |
| [6] | "A probability-based approach for high-throughput protein phosphorylation analysis and site localization." Beausoleil S.A., Villen J., Gerber S.A., Rush J., Gygi S.P. Nat. Biotechnol. 24:1285-1292(2006) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-334 AND SER-344, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [7] | "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle." Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M. Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-98; SER-334 AND SER-376, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [8] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-16; SER-324; SER-334; SER-362 AND THR-363, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [9] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-334, MASS SPECTROMETRY. Tissue: Leukemic T-cell. |
| [10] | "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis." Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M. Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-334, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | U04810 mRNA. Translation: AAA79333.2. AC125611 Genomic DNA. No translation available. CH471111 Genomic DNA. Translation: EAW58064.1. BC011597 mRNA. Translation: AAH11597.1. BC032583 mRNA. Translation: AAH32583.1. |
| IPI | IPI00029680. IPI00449144. |
| PIR | I38487. |
| RefSeq | NP_001094090.1. NM_001100620.1. NP_005471.3. NM_005480.3. |
| UniGene | Hs.524399. |
3D structure databases | |
| ProteinModelPortal | Q12815. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q12815. 6 interactions. |
| STRING | 9606.ENSP00000257909. |
Polymorphism databases | |
| DMDM | 223634724. |
Proteomic databases | |
| PaxDb | Q12815. |
| PRIDE | Q12815. |
Protocols and materials databases | |
| DNASU | 10024. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000257909; ENSP00000257909; ENSG00000135451. ENST00000380327; ENSP00000369684; ENSG00000135451. |
| GeneID | 10024. |
| KEGG | hsa:10024. |
| UCSC | uc001rtw.4. human. uc001rtx.4. human. |
Organism-specific databases | |
| CTD | 10024. |
| GeneCards | GC12P049716. |
| H-InvDB | HIX0010602. |
| HGNC | HGNC:12327. TROAP. |
| HPA | HPA044102. |
| MIM | 603872. gene. |
| neXtProt | NX_Q12815. |
| PharmGKB | PA37003. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG47246. |
| HOGENOM | HOG000082520. |
| HOVERGEN | HBG069140. |
| InParanoid | Q12815. |
| OrthoDB | EOG42NHZT. |
| PhylomeDB | Q12815. |
Gene expression databases | |
| ArrayExpress | Q12815. |
| Bgee | Q12815. |
| CleanEx | HS_TROAP. |
| Genevestigator | Q12815. |
| GermOnline | ENSG00000135451. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR026133. Tastin. [Graphical view] |
| PANTHER | PTHR15289. PTHR15289. 1 hit. |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 10024. |
| NextBio | 37877. |
| SOURCE | Search... |
Entry information
| Entry name | TROAP_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q12815 Secondary accession number(s): Q6PJU7, Q8N5B2 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 12 Human chromosome 12: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |

Clusters with
