Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q12815 (TROAP_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 103. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (2) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Tastin
Alternative name(s):
Trophinin-assisting protein
Trophinin-associated protein
Gene names
Name:TROAP
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length778 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Could be involved with bystin and trophinin in a cell adhesion molecule complex that mediates an initial attachment of the blastocyst to uterine epithelial cells at the time of the embryo implantation.

Subunit structure

Directly binds bystin, and indirectly trophinin.

Subcellular location

Cytoplasm.

Tissue specificity

Strong expression at implantation sites. Was exclusively localized to the apical side of the syncytiotrophoblast. Also found in macrophages.

Ontologies

Keywords
   Biological processCell adhesion
   Cellular componentCytoplasm
   Coding sequence diversityAlternative splicing
   DomainRepeat
   PTMPhosphoprotein
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processcell adhesion

Traceable author statement Ref.1. Source: ProtInc

   Cellular_componentcytoplasm

Traceable author statement Ref.1. Source: ProtInc

   Molecular_functionprotein binding

Inferred from physical interaction PubMed 23602568PubMed 9560222. Source: IntAct

Complete GO annotation...

Binary interactions

Alternative products

This entry describes 3 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q12815-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q12815-2)

The sequence of this isoform differs from the canonical sequence as follows:
     113-144: EAPGTIEFVADPAALATILSGEGVKSCHLGRQ → VLVPAPGKLFALRRSPFPPAKCHLARCHGLYL
     145-778: Missing.
Note: No experimental confirmation available.
Isoform 3 (identifier: Q12815-3)

The sequence of this isoform differs from the canonical sequence as follows:
     113-778: EAPGTIEFVA...VGSAAPQGSP → GAMACTCNHSYSGG
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 778778Tastin
PRO_0000065636

Regions

Repeat516 – 548331
Repeat549 – 581332
Repeat582 – 614333
Repeat615 – 647334
Region516 – 6471324 X 33 AA approximate tandem repeats
Compositional bias504 – 687184Cys-rich

Amino acid modifications

Modified residue161Phosphoserine Ref.8
Modified residue981Phosphoserine Ref.7
Modified residue3241Phosphoserine Ref.8
Modified residue3341Phosphoserine Ref.6 Ref.7 Ref.8 Ref.9 Ref.10
Modified residue3441Phosphoserine Ref.6
Modified residue3621Phosphoserine Ref.8
Modified residue3631Phosphothreonine Ref.8
Modified residue3761Phosphoserine Ref.7

Natural variations

Alternative sequence113 – 778666EAPGT…PQGSP → GAMACTCNHSYSGG in isoform 3.
VSP_055063
Alternative sequence113 – 14432EAPGT…HLGRQ → VLVPAPGKLFALRRSPFPPA KCHLARCHGLYL in isoform 2.
VSP_042820
Alternative sequence145 – 778634Missing in isoform 2.
VSP_042821

Experimental info

Sequence conflict2241R → H in AAA79333. Ref.1

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified February 10, 2009. Version 3.
Checksum: 530B0481EC8D7E02

FASTA77883,857
        10         20         30         40         50         60 
MTTRQATKDP LLRGVSPTPS KIPVRSQKRT PFPTVTSCAV DQENQDPRRW VQKPPLNIQR 

        70         80         90        100        110        120 
PLVDSAGPRP KARHQAETSQ RLVGISQPRN PLEELRPSPR GQNVGPGPPA QTEAPGTIEF 

       130        140        150        160        170        180 
VADPAALATI LSGEGVKSCH LGRQPSLAKR VLVRGSQGGT TQRVQGVRAS AYLAPRTPTH 

       190        200        210        220        230        240 
RLDPARASCF SRLEGPGPRG RTLCPQRLQA LISPSGPSFH PSTRPSFQEL RRETAGSSRT 

       250        260        270        280        290        300 
SVSQASGLLL ETPVQPAFSL PKGEREVVTH SDEGGVASLG LAQRVPLREN REMSHTRDSH 

       310        320        330        340        350        360 
DSHLMPSPAP VAQPLPGHVV PCPSPFGRAQ RVPSPGPPTL TSYSVLRRLT VQPKTRFTPM 

       370        380        390        400        410        420 
PSTPRVQQAQ WLRGVSPQSC SEDPALPWEQ VAVRLFDQES CIRSLEGSGK PPVATPSGPH 

       430        440        450        460        470        480 
SNRTPSLQEV KIQRIGILQQ LLRQEVEGLV GGQCVPLNGG SSLDMVELQP LLTEISRTLN 

       490        500        510        520        530        540 
ATEHNSGTSH LPGLLKHSGL PKPCLPEECG EPQPCPPAEP GPPEAFCRSE PEIPEPSLQE 

       550        560        570        580        590        600 
QLEVPEPYPP AEPRPLESCC RSEPEIPESS RQEQLEVPEP CPPAEPRPLE SYCRIEPEIP 

       610        620        630        640        650        660 
ESSRQEQLEV PEPCPPAEPG PLQPSTQGQS GPPGPCPRVE LGASEPCTLE HRSLESSLPP 

       670        680        690        700        710        720 
CCSQWAPATT SLIFSSQHPL CASPPICSLQ SLRPPAGQAG LSNLAPRTLA LRERLKSCLT 

       730        740        750        760        770 
AIHCFHEARL DDECAFYTSR APPSGPTRVC TNPVATLLEW QDALCFIPVG SAAPQGSP 

« Hide

Isoform 2 [UniParc].

Checksum: 59A5062A4CF71DD2
Show »

FASTA14415,893
Isoform 3 [UniParc].

Checksum: 644F8AB35FBBD459
Show »

FASTA12613,723

References

« Hide 'large scale' references
[1]"Trophinin and tastin, a novel cell adhesion molecule complex with potential involvement in embryo implantation."
Fukuda M.N., Sato T., Nakayama J., Klier G., Mikami M., Aoki D., Nozawa S.
Genes Dev. 9:1199-1210(1995) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
[2]Fukuda M., Sato T.
Submitted (JUL-2003) to the EMBL/GenBank/DDBJ databases
Cited for: SEQUENCE REVISION TO 714 AND 742.
[3]"The finished DNA sequence of human chromosome 12."
Scherer S.E., Muzny D.M., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R. expand/collapse author list , Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Montgomery K.T., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Lovering R.C., Wheeler D.A., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clerc-Blankenburg K.P., Davis C., Delgado O., Dinh H.H., Draper H., Gonzalez-Garay M.L., Havlak P., Jackson L.R., Jacob L.S., Kelly S.H., Li L., Li Z., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Pasternak S., Perez L.M., Plopper F.J.H., Santibanez J., Shen H., Tabor P.E., Verduzco D., Waldron L., Wang Q., Williams G.A., Zhang J., Zhou J., Allen C.C., Amin A.G., Anyalebechi V., Bailey M., Barbaria J.A., Bimage K.E., Bryant N.P., Burch P.E., Burkett C.E., Burrell K.L., Calderon E., Cardenas V., Carter K., Casias K., Cavazos I., Cavazos S.R., Ceasar H., Chacko J., Chan S.N., Chavez D., Christopoulos C., Chu J., Cockrell R., Cox C.D., Dang M., Dathorne S.R., David R., Davis C.M., Davy-Carroll L., Deshazo D.R., Donlin J.E., D'Souza L., Eaves K.A., Egan A., Emery-Cohen A.J., Escotto M., Flagg N., Forbes L.D., Gabisi A.M., Garza M., Hamilton C., Henderson N., Hernandez O., Hines S., Hogues M.E., Huang M., Idlebird D.G., Johnson R., Jolivet A., Jones S., Kagan R., King L.M., Leal B., Lebow H., Lee S., LeVan J.M., Lewis L.C., London P., Lorensuhewa L.M., Loulseged H., Lovett D.A., Lucier A., Lucier R.L., Ma J., Madu R.C., Mapua P., Martindale A.D., Martinez E., Massey E., Mawhiney S., Meador M.G., Mendez S., Mercado C., Mercado I.C., Merritt C.E., Miner Z.L., Minja E., Mitchell T., Mohabbat F., Mohabbat K., Montgomery B., Moore N., Morris S., Munidasa M., Ngo R.N., Nguyen N.B., Nickerson E., Nwaokelemeh O.O., Nwokenkwo S., Obregon M., Oguh M., Oragunye N., Oviedo R.J., Parish B.J., Parker D.N., Parrish J., Parks K.L., Paul H.A., Payton B.A., Perez A., Perrin W., Pickens A., Primus E.L., Pu L.-L., Puazo M., Quiles M.M., Quiroz J.B., Rabata D., Reeves K., Ruiz S.J., Shao H., Sisson I., Sonaike T., Sorelle R.P., Sutton A.E., Svatek A.F., Svetz L.A., Tamerisa K.S., Taylor T.R., Teague B., Thomas N., Thorn R.D., Trejos Z.Y., Trevino B.K., Ukegbu O.N., Urban J.B., Vasquez L.I., Vera V.A., Villasana D.M., Wang L., Ward-Moore S., Warren J.T., Wei X., White F., Williamson A.L., Wleczyk R., Wooden H.S., Wooden S.H., Yen J., Yoon L., Yoon V., Zorrilla S.E., Nelson D., Kucherlapati R., Weinstock G., Gibbs R.A.
Nature 440:346-351(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[4]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[5]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2 AND 3).
Tissue: Lymph.
[6]"A probability-based approach for high-throughput protein phosphorylation analysis and site localization."
Beausoleil S.A., Villen J., Gerber S.A., Rush J., Gygi S.P.
Nat. Biotechnol. 24:1285-1292(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-334 AND SER-344, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[7]"Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle."
Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M.
Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-98; SER-334 AND SER-376, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[8]"A quantitative atlas of mitotic phosphorylation."
Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P.
Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-16; SER-324; SER-334; SER-362 AND THR-363, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[9]"Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-334, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Leukemic T-cell.
[10]"Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-334, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
U04810 mRNA. Translation: AAA79333.2.
AC125611 Genomic DNA. No translation available.
CH471111 Genomic DNA. Translation: EAW58064.1.
BC011597 mRNA. Translation: AAH11597.1.
BC018627 mRNA. No translation available.
BC032583 mRNA. Translation: AAH32583.1.
CCDSCCDS41779.1. [Q12815-2]
CCDS8784.1. [Q12815-1]
PIRI38487.
RefSeqNP_001094090.1. NM_001100620.1. [Q12815-2]
NP_005471.3. NM_005480.3. [Q12815-1]
UniGeneHs.524399.

3D structure databases

ProteinModelPortalQ12815.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid115341. 11 interactions.
IntActQ12815. 9 interactions.
STRING9606.ENSP00000257909.

Polymorphism databases

DMDM223634724.

Proteomic databases

MaxQBQ12815.
PaxDbQ12815.
PRIDEQ12815.

Protocols and materials databases

DNASU10024.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000257909; ENSP00000257909; ENSG00000135451. [Q12815-1]
ENST00000380327; ENSP00000369684; ENSG00000135451. [Q12815-2]
ENST00000548311; ENSP00000448313; ENSG00000135451.
GeneID10024.
KEGGhsa:10024.
UCSCuc001rtw.4. human. [Q12815-2]
uc001rtx.4. human. [Q12815-1]

Organism-specific databases

CTD10024.
GeneCardsGC12P049716.
H-InvDBHIX0010602.
HGNCHGNC:12327. TROAP.
HPAHPA044102.
MIM603872. gene.
neXtProtNX_Q12815.
PharmGKBPA37003.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG47246.
HOGENOMHOG000082520.
HOVERGENHBG069140.
InParanoidQ12815.
OMAGNECANS.
PhylomeDBQ12815.
TreeFamTF338049.

Gene expression databases

ArrayExpressQ12815.
BgeeQ12815.
CleanExHS_TROAP.
GenevestigatorQ12815.

Family and domain databases

InterProIPR026133. Tastin.
[Graphical view]
PANTHERPTHR15289. PTHR15289. 1 hit.
ProtoNetSearch...

Other

GeneWikiTROAP.
GenomeRNAi10024.
NextBio37877.
PROQ12815.
SOURCESearch...

Entry information

Entry nameTROAP_HUMAN
AccessionPrimary (citable) accession number: Q12815
Secondary accession number(s): F8VSF9, Q6PJU7, Q8N5B2
Entry history
Integrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: February 10, 2009
Last modified: July 9, 2014
This is version 103 of the entry and version 3 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human chromosome 12

Human chromosome 12: entries, gene names and cross-references to MIM