Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

T-complex protein 10A homolog

Gene

TCP10

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 2 out of 5-Experimental evidence at transcript leveli

Names & Taxonomyi

Protein namesi
Recommended name:
T-complex protein 10A homolog
Gene namesi
Name:TCP10
Synonyms:TCP10A
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 6

Organism-specific databases

HGNCiHGNC:11656. TCP10.

Subcellular locationi

GO - Cellular componenti

  • cytosol Source: ProtInc

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA36407.

Polymorphism and mutation databases

BioMutaiTCP10.
DMDMi281185494.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000724611 – 353T-complex protein 10A homologAdd BLAST353

Proteomic databases

PaxDbiQ12799.
PRIDEiQ12799.

PTM databases

iPTMnetiQ12799.
PhosphoSitePlusiQ12799.

Expressioni

Gene expression databases

BgeeiENSG00000203690.
CleanExiHS_TCP10.
ExpressionAtlasiQ12799. baseline and differential.
GenevisibleiQ12799. HS.

Organism-specific databases

HPAiHPA044709.

Interactioni

Protein-protein interaction databases

BioGridi112813. 3 interactors.
IntActiQ12799. 3 interactors.

Structurei

3D structure databases

ProteinModelPortaliQ12799.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili69 – 105Sequence analysisAdd BLAST37

Sequence similaritiesi

Belongs to the TCP10 family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiENOG410JCHC. Eukaryota.
ENOG4111BX3. LUCA.
HOGENOMiHOG000136328.
HOVERGENiHBG052890.
InParanoidiQ12799.
PhylomeDBiQ12799.

Family and domain databases

InterProiView protein in InterPro
IPR026581. TCP10_fam.
PANTHERiPTHR10331. PTHR10331. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q12799-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MLEGQLEAGE PKEGTHPEDP CPGAGAAMEK TPAAAEVPRE DSNAGEMPSL
60 70 80 90 100
QQQITSLHQE LGRQQSLWAD IHRKLQSHMD ALRKQNRELR EELRGLQRQQ
110 120 130 140 150
WEAGKKPAAS PHAGRESHTL ALEPAFGKIS HLSADEDTTP KYAGRKSQSA
160 170 180 190 200
TLLGQRWSSN HLAPPKPMSL KTERINSGKT PPQEDREKSP PGRRQDRSPA
210 220 230 240 250
PTGRPTPGAE RRGVSEDGKI MHPSSRSPQN SGGRKSPVQA SQATTLQEQT
260 270 280 290 300
AAARGADRSS SVLGSSEGGF LSRVQADEFA SSAPDSAERQ NLPVNPPSSL
310 320 330 340 350
EIAQAMDTKM KKEEVQEEKR HPKGKADDCR RSGFPSEFPG ALHAAPSRQD

MGP
Length:353
Mass (Da):38,267
Last modified:December 15, 2009 - v3
Checksum:i4AC5FA1886BF0977
GO
Isoform 2 (identifier: Q12799-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     291-353: NLPVNPPSSL...AAPSRQDMGP → KNSTPMAPKKSCFPTGRWNISRMDRKRPYFLMGQS

Show »
Length:325
Mass (Da):35,441
Checksum:i1102A726D280AC04
GO

Sequence cautioni

The sequence AAA82109 differs from that shown. Aberrant splicing.Curated
The sequence CAI39675 differs from that shown. Reason: Erroneous termination at position 10. Translated as Glu.Curated
The sequence CAI42705 differs from that shown. Reason: Erroneous termination at position 10. Translated as Glu.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti42S → G in AAH63451 (PubMed:15489334).Curated1
Sequence conflicti131H → P in AAA82109 (PubMed:8111376).Curated1
Sequence conflicti131H → P in AAH63451 (PubMed:15489334).Curated1
Sequence conflicti137D → E in AAA82109 (PubMed:8111376).Curated1
Sequence conflicti137D → E in AAH63451 (PubMed:15489334).Curated1
Sequence conflicti213G → E in AAA82109 (PubMed:8111376).Curated1
Sequence conflicti213G → E in AAH63451 (PubMed:15489334).Curated1
Sequence conflicti283A → S in AAA82109 (PubMed:8111376).Curated1
Sequence conflicti283A → S in AAH63451 (PubMed:15489334).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_06224945G → E1 PublicationCorresponds to variant dbSNP:rs17855834Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_038517291 – 353NLPVN…QDMGP → KNSTPMAPKKSCFPTGRWNI SRMDRKRPYFLMGQS in isoform 2. 1 PublicationAdd BLAST63

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U03399 mRNA. Translation: AAA82109.1. Sequence problems.
AL592444, AL021331 Genomic DNA. Translation: CAI39675.1. Sequence problems.
AL021331, AL592444 Genomic DNA. Translation: CAI42705.1. Sequence problems.
BC063451 mRNA. Translation: AAH63451.1.
PIRiI38428.
RefSeqiNP_004601.3. NM_004610.3.
UniGeneiHs.351.

Genome annotation databases

EnsembliENST00000366827; ENSP00000355792; ENSG00000203690.
GeneIDi6953.
KEGGihsa:6953.
UCSCiuc003qvu.4. human. [Q12799-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.

Entry informationi

Entry nameiTCP10_HUMAN
AccessioniPrimary (citable) accession number: Q12799
Secondary accession number(s): Q5JR60, Q6P4F4
Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 10, 2002
Last sequence update: December 15, 2009
Last modified: February 15, 2017
This is version 116 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families