Q12791 (KCMA1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 118.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Calcium-activated potassium channel subunit alpha-1 Alternative name(s): BK channel BKCA alpha Calcium-activated potassium channel, subfamily M subunit alpha-1 K(VCA)alpha KCa1.1 Maxi K channel Short name=MaxiK Slo-alpha Slo1 Slowpoke homolog Short name=Slo homolog Short name=hSlo | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 1236 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Potassium channel activated by both membrane depolarization or increase in cytosolic Ca2+ that mediates export of K+. It is also activated by the concentration of cytosolic Mg2+. Its activation dampens the excitatory events that elevate the cytosolic Ca2+ concentration and/or depolarize the cell membrane. It therefore contributes to repolarization of the membrane potential. Plays a key role in controlling excitability in a number of systems, such as regulation of the contraction of smooth muscle, the tuning of hair cells in the cochlea, regulation of transmitter release, and innate immunity. In smooth muscles, its activation by high level of Ca2+, caused by ryanodine receptors in the sarcoplasmic reticulum, regulates the membrane potential. In cochlea cells, its number and kinetic properties partly determine the characteristic frequency of each hair cell and thereby helps to establish a tonotopic map. Kinetics of KCNMA1 channels are determined by alternative splicing, phosphorylation status and its combination with modulating beta subunits. Highly sensitive to both iberiotoxin (IbTx) and charybdotoxin (CTX). |
| Enzyme regulation | Ethanol and carbon monoxide-bound heme increase channel activation. Heme inhibits channel activation. Ref.22 |
| Subunit structure | Homotetramer; which constitutes the calcium-activated potassium channel. Interacts with beta subunits KCNMB1, KCNMB2, KCNMB3 and KCNMB4. Beta subunits are accessory, and modulate its activity. Interacts with LRRC26. Ref.18 Ref.19 Ref.20 Ref.21 Ref.26 |
| Subcellular location | |
| Tissue specificity | Widely expressed. Except in myocytes, it is almost ubiquitously expressed. Ref.13 |
| Domain | The S0 segment is essential for the modulation by the accessory beta subunits KCNMB1, KCNMB2, KCNMB3 and KCNMB4. Ref.15 Ref.17 The S4 segment, which is characterized by a series of positively charged amino acids at every third position, is part of the voltage-sensor. Ref.15 Ref.17 The pore-forming domain (also referred as P region) is imbedded into the membrane, and forms the selectivity filter of the pore. It contains the signature sequence of potassium channels that displays selectivity to potassium. Ref.15 Ref.17 The RCK N-terminal domain mediates the homotetramerization, thereby promoting the assembly of monomers into functional potassium channel. It includes binding sites for Ca2+ and Mg2+ By similarity. Ref.15 Ref.17 The calcium bowl constitutes one of the Ca2+ sensors and probably acts as a Ca2+-binding site. There are however other Ca2+ sensors regions required for activation of the channel. Ref.15 Ref.17 The heme-binding motif mediates inhibition of channel activation by heme. Carbon monoxide-bound heme leads to increased channel activation. Ref.15 Ref.17 |
| Post-translational modification | Phosphorylated Probable. Phosphorylation by kinases such as PKA and/or PKG. In smooth muscles, phosphorylation affects its activity. Ref.24 Ref.25 |
| Involvement in disease | Defects in KCNMA1 are the cause of generalized epilepsy and paroxysmal dyskinesia (GEPD) [MIM:609446]. Epilepsy is one of the most common and debilitating neurological disorders. Paroxysmal dyskinesias are neurological disorders characterized by sudden, unpredictable, disabling attacks of involuntary movement often requiring life-long treatment. The coexistence of epilepsy and paroxysmal dyskinesia in the same individual or family is an increasingly recognized phenomenon. Patients manifest absence seizures, generalized tonic-clonic seizures, paroxysmal nonkinesigenic dyskinesia, involuntary dystonic or choreiform movements. Onset is usually in childhood and patients may have seizures only, dyskinesia only, or both. Ref.28 |
| Miscellaneous | The protein was initially thought to contain two functionally distinct parts: The core channel (from the N-terminus to the S9 segment) that mediates the channel activity, and the cytoplasmic tail (from the S9 segment to the C-terminus) that mediates the calcium sensing. The situation is however more complex, since the core channel also contains binding sites for Ca2+ and Mg2+. |
| Sequence similarities | Belongs to the potassium channel family. Calcium-activated (TC 1.A.1.3) subfamily. KCa1.1/KCNMA1 sub-subfamily. [View classification] Contains 1 RCK N-terminal domain. |
| Sequence caution | The sequence AAA50216.1 differs from that shown. Reason: Contaminating sequence. Sequence of unknown origin in the N-terminal part. The sequence AAB65837.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. The sequence AAC50353.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. The sequence AAK91504.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. The sequence BAD06365.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. |
Ontologies
Alternative products
| This entry describes 7 isoforms produced by alternative splicing. [Align] [Select] Note: May be partially controlled by hormonal stress. Additional isoforms seem to exist. | ||||||
| Isoform 1 (identifier: Q12791-1) Also known as: SAKCA; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q12791-2) Also known as: BKTM; The sequence of this isoform differs from the canonical sequence as follows: 698-756: PKMSIYKRMRRACCFDCGRSERDCSCMSGRVRGNVDTLERAFPLSSVSVNDCSTSFRAF → L 828-828: L → LVTGWMPYLGPRVLMTCLDIGVVCMPTDIQSTSPASIKKFKE | ||||||
| Isoform 3 (identifier: Q12791-3) The sequence of this isoform differs from the canonical sequence as follows: 643-643: R → RSRKR | ||||||
| Isoform 4 (identifier: Q12791-4) Also known as: hbr5; The sequence of this isoform differs from the canonical sequence as follows: 698-756: PKMSIYKRMR...NDCSTSFRAF → LKVAARSRYSKDPFEFKKETPNSRLVTEPV | ||||||
| Isoform 5 (identifier: Q12791-5) The sequence of this isoform differs from the canonical sequence as follows: 698-756: PKMSIYKRMRRACCFDCGRSERDCSCMSGRVRGNVDTLERAFPLSSVSVNDCSTSFRAF → L | ||||||
| Isoform 6 (identifier: Q12791-6) The sequence of this isoform differs from the canonical sequence as follows: 127-168: EAQKINNGSS...MTSVKDWAGV → ATHFGSPEMP...ALEVARCRRL 169-1236: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 7 (identifier: Q12791-7) Also known as: gBK; The sequence of this isoform differs from the canonical sequence as follows: 698-756: PKMSIYKRMR...NDCSTSFRAF → RWEEHCSLWR...PNSRLVTEPV |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||
Molecule processing | ||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1236 | 1236 | Calcium-activated potassium channel subunit alpha-1 | PRO_0000054132 | ||||||||||
Regions | ||||||||||||||
| Topological domain | 1 – 86 | 86 | Extracellular Potential | |||||||||||
| Transmembrane | 87 – 107 | 21 | Helical; Name=Segment S0; Potential | |||||||||||
| Topological domain | 108 – 178 | 71 | Cytoplasmic Potential | |||||||||||
| Transmembrane | 179 – 199 | 21 | Helical; Name=Segment S1; Potential | |||||||||||
| Topological domain | 200 – 214 | 15 | Extracellular Potential | |||||||||||
| Transmembrane | 215 – 235 | 21 | Helical; Name=Segment S2; Potential | |||||||||||
| Topological domain | 236 – 239 | 4 | Cytoplasmic Potential | |||||||||||
| Transmembrane | 240 – 260 | 21 | Helical; Name=Segment S3; Potential | |||||||||||
| Topological domain | 261 – 264 | 4 | Extracellular Potential | |||||||||||
| Transmembrane | 265 – 285 | 21 | Helical; Name=Segment S4; Potential | |||||||||||
| Topological domain | 286 – 300 | 15 | Cytoplasmic Potential | |||||||||||
| Transmembrane | 301 – 321 | 21 | Helical; Name=Segment S5; Potential | |||||||||||
| Topological domain | 322 – 335 | 14 | Extracellular Potential | |||||||||||
| Intramembrane | 336 – 358 | 23 | Pore-forming; Name=P region; Potential | |||||||||||
| Topological domain | 359 – 367 | 9 | Extracellular Potential | |||||||||||
| Transmembrane | 368 – 388 | 21 | Helical; Name=Segment S6; Potential | |||||||||||
| Topological domain | 389 – 1236 | 848 | Cytoplasmic Potential | |||||||||||
| Domain | 415 – 558 | 144 | RCK N-terminal | |||||||||||
| Region | 556 – 576 | 21 | Segment S7 | |||||||||||
| Region | 613 – 633 | 21 | Segment S8 | |||||||||||
| Region | 677 – 681 | 5 | Heme-binding motif | |||||||||||
| Region | 837 – 857 | 21 | Segment S9 | |||||||||||
| Region | 1032 – 1052 | 21 | Segment S10 | |||||||||||
| Motif | 352 – 355 | 4 | Selectivity for potassium | |||||||||||
| Motif | 1003 – 1025 | 23 | Calcium bowl | |||||||||||
| Compositional bias | 4 – 10 | 7 | Poly-Gly | |||||||||||
| Compositional bias | 13 – 20 | 8 | Poly-Gly | |||||||||||
| Compositional bias | 39 – 60 | 22 | Poly-Ser | |||||||||||
Sites | ||||||||||||||
| Metal binding | 439 | 1 | Magnesium By similarity | |||||||||||
| Metal binding | 462 | 1 | Magnesium By similarity | |||||||||||
| Metal binding | 464 | 1 | Magnesium By similarity | |||||||||||
Amino acid modifications | ||||||||||||||
| Modified residue | 569 | 1 | Phosphoserine Ref.25 | |||||||||||
| Modified residue | 763 | 1 | Phosphothreonine By similarity | |||||||||||
| Modified residue | 765 | 1 | Phosphoserine By similarity | |||||||||||
| Modified residue | 977 | 1 | Phosphoserine By similarity | |||||||||||
| Modified residue | 978 | 1 | Phosphoserine By similarity | |||||||||||
| Modified residue | 1086 | 1 | Phosphotyrosine Ref.24 | |||||||||||
| Modified residue | 1088 | 1 | Phosphothreonine By similarity | |||||||||||
Natural variations | ||||||||||||||
| Alternative sequence | 127 – 168 | 42 | EAQKI…DWAGV → ATHFGSPEMPPAARSWSGSP PEAAVLRGASSLALEVARCR RL in isoform 6. | VSP_009952 | ||||||||||
| Alternative sequence | 169 – 1236 | 1068 | Missing in isoform 6. | VSP_009953 | ||||||||||
| Alternative sequence | 643 | 1 | R → RSRKR in isoform 3. | VSP_009954 | ||||||||||
| Alternative sequence | 698 – 756 | 59 | PKMSI…SFRAF → L in isoform 2 and isoform 5. | VSP_009955 | ||||||||||
| Alternative sequence | 698 – 756 | 59 | PKMSI…SFRAF → LKVAARSRYSKDPFEFKKET PNSRLVTEPV in isoform 4. | VSP_009956 | ||||||||||
| Alternative sequence | 698 – 756 | 59 | PKMSI…SFRAF → RWEEHCSLWRLESKGNVRRL NYCRGQQTSFVKVKVAARSR YSKDPFEFKKETPNSRLVTE PV in isoform 7. | VSP_009957 | ||||||||||
| Alternative sequence | 828 | 1 | L → LVTGWMPYLGPRVLMTCLDI GVVCMPTDIQSTSPASIKKF KE in isoform 2. | VSP_009958 | ||||||||||
| Natural variant | 434 | 1 | D → G in GEPD; may have a synergistic effect with ethanol in the triggering of symptoms. Ref.28 | VAR_023821 | ||||||||||
Experimental info | ||||||||||||||
| Mutagenesis | 269 | 1 | L → R or H: No effect in the coupling between calcium and channel opening. Ref.17 | |||||||||||
| Mutagenesis | 272 | 1 | R → E: Induces reduction in the coupling between calcium and channel opening. Ref.17 | |||||||||||
| Mutagenesis | 275 | 1 | R → N: Induces reduction in the coupling between calcium and channel opening. Ref.17 | |||||||||||
| Mutagenesis | 278 | 1 | R → Q: Induces reduction in the coupling between calcium and channel opening. Ref.17 | |||||||||||
| Mutagenesis | 281 | 1 | Q → R: No effect in the coupling between calcium and channel opening. Ref.17 | |||||||||||
| Mutagenesis | 284 | 1 | E → K: No effect in the coupling between calcium and channel opening. Ref.17 | |||||||||||
| Mutagenesis | 352 | 1 | T → S: Activated at more negative voltages. Slower rate of inactivation. Impaired inhibition by HMIMP. No effect on channel inhibition by Iberiotoxin. Ref.27 | |||||||||||
| Mutagenesis | 354 – 356 | 3 | GYG → AAA: Loss of function. Ref.20 | |||||||||||
| Mutagenesis | 380 | 1 | F → A: Loss of function. Ref.27 | |||||||||||
| Mutagenesis | 381 | 1 | A → S: Activated at more negative voltages. No effect on inhibition by HMIMP. Ref.27 | |||||||||||
| Mutagenesis | 384 | 1 | V → I: No effect on activation voltage. No effect on inhibition by HMIMP. Ref.27 | |||||||||||
| Mutagenesis | 680 | 1 | C → S: Loss of heme-induced channel inhibition. Ref.22 | |||||||||||
| Mutagenesis | 681 | 1 | H → R: Loss of heme-induced channel inhibition. Ref.22 | |||||||||||
| Sequence conflict | 25 | 1 | M → N in AAA50216. Ref.9 | |||||||||||
| Sequence conflict | 35 | 1 | S → G in AAA50216. Ref.9 | |||||||||||
| Sequence conflict | 38 | 1 | A → V in AAA85104. Ref.1 | |||||||||||
| Sequence conflict | 449 | 1 | N → D in AAD31173. Ref.12 | |||||||||||
| Sequence conflict | 805 | 1 | N → H in AAC50353. Ref.6 | |||||||||||
| Sequence conflict | 1152 | 1 | T → A in AAD31173. Ref.12 | |||||||||||
| Sequence conflict | 1230 – 1236 | 7 | YVQEERL → KEMVYR in CAI39730. Ref.3 | |||||||||||
| Sequence conflict | 1230 – 1236 | 7 | YVQEERL → KEMVYR in CAI40870. Ref.3 | |||||||||||
| Sequence conflict | 1230 – 1236 | 7 | YVQEERL → KEMVYR in CAI14074. Ref.3 | |||||||||||
| Sequence conflict | 1230 – 1236 | 7 | YVQEERL → KEMVYR in CAI16162. Ref.3 | |||||||||||
Secondary structure | ||||||||||||||
Helix Strand Turn | ||||||||||||||
| Helix | 261 – 265 | 5 | ||||||||||||
| Turn | 266 – 268 | 3 | ||||||||||||
| Helix | 277 – 280 | 4 | ||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Cloning and expression of a human large-conductance calcium-activated potassium channel." Dworetzky S.I., Trojnacki J.T., Gribkoff V.K. Brain Res. Mol. Brain Res. 27:189-193(1994) [PubMed: 7877450] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 5). Tissue: Substantia nigra. |
| [2] | "A human calcium-activated potassium channel gene expressed in vascular smooth muscle." McCobb D.P., Fowler N.L., Featherstone T., Lingle C.J., Saito M., Krause J.E., Salkoff L. Am. J. Physiol. 269:H767-H777(1995) [PubMed: 7573516] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 5). Tissue: Aortic smooth muscle and Umbilical smooth muscle. |
| [3] | "The DNA sequence and comparative analysis of human chromosome 10." Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L., Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K., Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L., Taylor A., Battles J. Rogers J.Nature 429:375-381(2004) [PubMed: 15164054] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 5 AND 6). Tissue: Cerebellum, Neuroectoderm and Testis. |
| [6] | "Cloning, expression, and distribution of functionally distinct Ca(2+)-activated K+ channel isoforms from human brain." Tseng-Crank J., Foster C.D., Krause J.D., Mertz R., Godinot N., DiChiara T.J., Reinhart P.H. Neuron 13:1315-1330(1994) [PubMed: 7993625] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 17-1236 (ISOFORM 5). |
| [7] | "Calcium-activated potassium channel expression in human myometrium: effect of pregnancy." Mazzone J.N., Kaiser R.A., Buxton I.L.O. Proc. West. Pharmacol. Soc. 45:184-186(2002) [PubMed: 12434576] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 21-1236 (ISOFORM 5). Tissue: Myometrium. |
| [8] | "BK variant from human heart." Naruse K. Submitted (JUN-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 21-1236 (ISOFORM 1), NUCLEOTIDE SEQUENCE [MRNA] OF 25-1236 (ISOFORM 2). Tissue: Heart. |
| [9] | "Cloning and characterization of human and mouse homologs of the Drosophila calcium-activated potassium channel gene, slowpoke." Pallanck L., Ganetzky B. Hum. Mol. Genet. 3:1239-1243(1994) [PubMed: 7987297] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 24-670 (ISOFORM 3), NUCLEOTIDE SEQUENCE [MRNA] OF 323-1236 (ISOFORM 4). Tissue: Muscle. |
| [10] | "Identification of potassium channels in human lens epithelium." Rae J.L., Shepard A.R. (In) Civan M.M. (eds.); Current topics in membranes. The eye's aqueous humor - from secretion to glaucoma, pp.45:69-104, Academic Press, San Diego (1998) Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 25-1236 (ISOFORM 5). Tissue: Lens epithelium. |
| [11] | "Characterization of and modulation by a beta-subunit of a human maxi KCa channel cloned from myometrium." Wallner M., Meera P., Ottolia M., Kaczorowski G.J., Latorre R., Garcia M.L., Stefani E., Toro L. Recept. Channels 3:185-199(1995) [PubMed: 8821792] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 38-1236 (ISOFORM 5), NUCLEOTIDE SEQUENCE [MRNA] OF 693-764 (ISOFORM 4). Tissue: Myometrium. |
| [12] | "Cloning and characterization of BKCA alpha subunit from human pulmonary artery." Cairns V.R., Aebly M.R., Rusch N.J. Submitted (JAN-1999) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 66-1236 (ISOFORM 5). Tissue: Pulmonary artery. |
| [13] | "Cloning and characterization of glioma BK, a novel BK channel isoform highly expressed in human glioma cells." Liu X., Chang Y., Reinhart P.H., Sontheimer H., Chang Y. J. Neurosci. 22:1840-1849(2002) [PubMed: 11880513] [Abstract] Cited for: ALTERNATIVE SPLICING (ISOFORM 7), TISSUE SPECIFICITY. Tissue: Glioblastoma. |
| [14] | Erratum Liu X., Chang Y., Reinhart P.H., Sontheimer H., Chang Y. J. Neurosci. 22:1B-1B(2002) |
| [15] | "Determinant for beta-subunit regulation in high-conductance voltage-activated and Ca(2+)-sensitive K+ channels: an additional transmembrane region at the N-terminus." Wallner M., Meera P., Toro L. Proc. Natl. Acad. Sci. U.S.A. 93:14922-14927(1996) [PubMed: 8962157] [Abstract] Cited for: DOMAIN S0. |
| [16] | "Large conductance voltage- and calcium-dependent K+ channel, a distinct member of voltage-dependent ion channels with seven N-terminal transmembrane segments (S0-S6), an extracellular N-terminus, and an intracellular (S9-S10) C-terminus." Meera P., Wallner M., Song M., Toro L. Proc. Natl. Acad. Sci. U.S.A. 94:14066-14071(1997) [PubMed: 9391153] [Abstract] Cited for: MEMBRANE TOPOLOGY. |
| [17] | "Role of the S4 segment in a voltage-dependent calcium-sensitive potassium (hSlo) channel." Diaz L., Meera P., Amigo J., Stefani E., Alvarez O., Toro L., Latorre R. J. Biol. Chem. 273:32430-32436(1998) [PubMed: 9829973] [Abstract] Cited for: DOMAIN S4, MUTAGENESIS OF LEU-269; ARG-272; ARG-275; ARG-278; GLN-281 AND GLU-284. |
| [18] | "Molecular basis of fast inactivation in voltage and Ca2+-activated K+ channels: a transmembrane beta-subunit homolog." Wallner M., Meera P., Toro L. Proc. Natl. Acad. Sci. U.S.A. 96:4137-4142(1999) [PubMed: 10097176] [Abstract] Cited for: INTERACTION WITH KCNMB2. |
| [19] | "Cloning and functional characterization of novel large conductance calcium-activated potassium channel beta subunits, hKCNMB3 and hKCNMB4." Brenner R., Jegla T.J., Wickenden A., Liu Y., Aldrich R.W. J. Biol. Chem. 275:6453-6461(2000) [PubMed: 10692449] [Abstract] Cited for: INTERACTION WITH KCNMB3 AND KCNMB4. |
| [20] | "Identification of a novel tetramerization domain in large conductance K(ca) channels." Quirk J.C., Reinhart P.H. Neuron 32:13-23(2001) [PubMed: 11604135] [Abstract] Cited for: HOMOTETRAMERIZATION, MUTAGENESIS OF 354-GLY--GLY-356. |
| [21] | "Consequences of the stoichiometry of Slo1 alpha and auxiliary beta subunits on functional properties of large-conductance Ca2+-activated K+ channels." Wang Y.-W., Ding J.-P., Xia X.-M., Lingle C.J. J. Neurosci. 22:1550-1561(2002) [PubMed: 11880485] [Abstract] Cited for: INTERACTION WITH KCNMB1; KCNMB2; KCNMB3 AND KCNMB4. |
| [22] | "Haem can bind to and inhibit mammalian calcium-dependent Slo1 BK channels." Tang X.D., Xu R., Reynolds M.F., Garcia M.L., Heinemann S.H., Hoshi T. Nature 425:531-535(2003) [PubMed: 14523450] [Abstract] Cited for: ENZYME REGULATION, MUTAGENESIS OF CYS-680 AND HIS-681. |
| [23] | "Gating mechanism of BK (Slo1) channels: so near, yet so far." Magleby K.L. J. Gen. Physiol. 121:81-96(2003) [PubMed: 12566537] [Abstract] Cited for: REVIEW. |
| [24] | "Global survey of phosphotyrosine signaling identifies oncogenic kinases in lung cancer." Rikova K., Guo A., Zeng Q., Possemato A., Yu J., Haack H., Nardone J., Lee K., Reeves C., Li Y., Hu Y., Tan Z., Stokes M., Sullivan L., Mitchell J., Wetzel R., Macneill J., Ren J.M. Comb M.J.Cell 131:1190-1203(2007) [PubMed: 18083107] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-1086, MASS SPECTROMETRY. Tissue: Lung carcinoma. |
| [25] | "Automated phosphoproteome analysis for cultured cancer cells by two-dimensional nanoLC-MS using a calcined titania/C18 biphasic column." Imami K., Sugiyama N., Kyono Y., Tomita M., Ishihama Y. Anal. Sci. 24:161-166(2008) [PubMed: 18187866] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-569, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [26] | "LRRC26 auxiliary protein allows BK channel activation at resting voltage without calcium." Yan J., Aldrich R.W. Nature 466:513-516(2010) [PubMed: 20613726] [Abstract] Cited for: INTERACTION WITH LRRC26. |
| [27] | "Characterizing the role of Thr352 in the inhibition of the large conductance Ca2+-activated K+ channels by 1-[1-Hexyl-6-(methyloxy)-1H-indazol-3-yl]-2-methyl-1-propanone." Gordon E., Semus S.F., Lozinskaya I.M., Lin Z., Xu X. J. Pharmacol. Exp. Ther. 334:402-409(2010) [PubMed: 20430843] [Abstract] Cited for: MUTAGENESIS OF THR-352; PHE-380; ALA-381 AND VAL-384. |
| [28] | "Calcium-sensitive potassium channelopathy in human epilepsy and paroxysmal movement disorder." Du W., Bautista J.F., Yang H., Diez-Sampedro A., You S.-A., Wang L., Kotagal P., Lueders H.O., Shi J., Cui J., Richerson G.B., Wang Q.K. Nat. Genet. 37:733-738(2005) [PubMed: 15937479] [Abstract] Cited for: VARIANT GEPD GLY-434. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | U13913 mRNA. Translation: AAA85104.1. U23767 mRNA. Translation: AAA92290.1. AL157833 AC011439 Genomic DNA. Translation: CAI39730.1.AL157833 AL731560 Genomic DNA. Translation: CAI39736.1.AL627447 AL157833 Genomic DNA. Translation: CAI16162.1.AL627447 AL731560 Genomic DNA. Translation: CAI16171.1.AL731556 AL627447 Genomic DNA. Translation: CAI14074.1.AL731556 AL731560 Genomic DNA. Translation: CAI14082.1.AL731560 AL627447 Genomic DNA. Translation: CAI40870.1.AL731560 AL731556 Genomic DNA. Translation: CAI40877.1.CH471083 Genomic DNA. Translation: EAW54599.1. BC062659 mRNA. Translation: AAH62659.1. BC137115 mRNA. Translation: AAI37116.1. BC137137 mRNA. Translation: AAI37138.1. U11717 mRNA. Translation: AAC50353.1. Different initiation. AY040849 mRNA. Translation: AAK91504.1. Different initiation. AB113575 mRNA. Translation: BAD06397.1. AB113382 mRNA. Translation: BAD06365.1. Different initiation. U02632 mRNA. Translation: AAA50173.1. U09384 mRNA. Translation: AAA50216.1. Sequence problems. AF025999 mRNA. Translation: AAB88802.1. U11058 mRNA. Translation: AAB65837.1. Different initiation. AF118141 mRNA. Translation: AAD31173.1. | ||||||||||||||||||||||||
| IPI | IPI00164387. IPI00410168. IPI00410169. IPI00410170. IPI00410172. IPI00410173. IPI00478411. | ||||||||||||||||||||||||
| PIR | I38596. S62904. | ||||||||||||||||||||||||
| RefSeq | NP_001014797.1. NM_001014797.2. NP_001154824.1. NM_001161352.1. NP_001154825.1. NM_001161353.1. NP_002238.2. NM_002247.3. | ||||||||||||||||||||||||
| UniGene | Hs.144795. | ||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||
| ProteinModelPortal | Q12791. | ||||||||||||||||||||||||
| SMR | Q12791. Positions 257-284, 308-1179. | ||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||
| DIP | DIP-29729N. | ||||||||||||||||||||||||
| IntAct | Q12791. 1 interaction. | ||||||||||||||||||||||||
| STRING | Q12791. | ||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||
| PhosphoSite | Q12791. | ||||||||||||||||||||||||
Polymorphism databases | |||||||||||||||||||||||||
| DMDM | 46396283. | ||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||
| PRIDE | Q12791. | ||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||
| Ensembl | ENST00000406533; ENSP00000385552; ENSG00000156113. | ||||||||||||||||||||||||
| GeneID | 3778. | ||||||||||||||||||||||||
| KEGG | hsa:3778. | ||||||||||||||||||||||||
| UCSC | uc001jxn.1. human. uc001jxo.1. human. uc001jxs.2. human. | ||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||
| CTD | 3778. | ||||||||||||||||||||||||
| GeneCards | GC10M078629. | ||||||||||||||||||||||||
| HGNC | HGNC:6284. KCNMA1. | ||||||||||||||||||||||||
| MIM | 600150. gene. 609446. phenotype. | ||||||||||||||||||||||||
| neXtProt | NX_Q12791. | ||||||||||||||||||||||||
| Orphanet | 79137. Generalized Epilepsy - paroxysmal dyskinesia. | ||||||||||||||||||||||||
| PharmGKB | PA220. | ||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||
| eggNOG | prNOG13890. | ||||||||||||||||||||||||
| HOVERGEN | HBG052222. | ||||||||||||||||||||||||
| InParanoid | Q12791. | ||||||||||||||||||||||||
| OMA | SFPTVCX. | ||||||||||||||||||||||||
| PhylomeDB | Q12791. | ||||||||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||||||||
| Reactome | REACT_13685. Neuronal System. REACT_604. Hemostasis. | ||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||
| ArrayExpress | Q12791. | ||||||||||||||||||||||||
| Bgee | Q12791. | ||||||||||||||||||||||||
| Genevestigator | Q12791. | ||||||||||||||||||||||||
| GermOnline | ENSG00000156113. Homo sapiens. | ||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||
| InterPro | IPR005821. Ion_trans. IPR003091. K_chnl. IPR003929. K_chnl_Ca-activ_BK_asu. IPR016040. NAD(P)-bd_dom. IPR003148. RCK_N. [Graphical view] | ||||||||||||||||||||||||
| Gene3D | G3DSA:3.40.50.720. NAD(P)-bd. 3 hits. | ||||||||||||||||||||||||
| KO | K04936. | ||||||||||||||||||||||||
| PANTHER | PTHR10027. PTHR10027. 1 hit. | ||||||||||||||||||||||||
| Pfam | PF03493. BK_channel_a. 1 hit. PF00520. Ion_trans. 1 hit. PF02254. TrkA_N. 1 hit. [Graphical view] | ||||||||||||||||||||||||
| PRINTS | PR01449. BKCHANNELA. PR00169. KCHANNEL. | ||||||||||||||||||||||||
| PROSITE | PS51201. RCK_N. False negative. [Graphical view] | ||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||
Other | |||||||||||||||||||||||||
| DrugBank | DB00436. Bendroflumethiazide. DB00562. Benzthiazide. DB00880. Chlorothiazide. DB00356. Chlorzoxazone. DB01003. Cromoglicate. DB00606. Cyclothiazide. DB01119. Diazoxide. DB00228. Enflurane. DB00999. Hydrochlorothiazide. DB00774. Hydroflumethiazide. DB00232. Methyclothiazide. DB01325. Quinethazone. DB01021. Trichlormethiazide. | ||||||||||||||||||||||||
| NextBio | 14823. | ||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||
Entry information
| Entry name | KCMA1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q12791 Secondary accession number(s): Q12886 Q9UQK6 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 10 Human chromosome 10: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with