Q12769 (NU160_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 125.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Nuclear pore complex protein Nup160 Alternative name(s): 160 kDa nucleoporin Nucleoporin Nup160 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 1436 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Involved in poly(A)+ RNA transport. Ref.6 |
| Subunit structure | Forms part of the Nup160 subcomplex in the nuclear pore which is composed of NUP160, NUP133, NUP107 and Nup96. This complex plays a role in RNA export and in tethering Nup98 and NUP153 to the nucleus. Ref.5 Ref.6 |
| Subcellular location | |
| Caution | It is uncertain whether Met-1 or Met-35 is the initiator. |
| Sequence caution | The sequence AAH09822.1 differs from that shown. Reason: Erroneous initiation. The sequence BAA12110.1 differs from that shown. Reason: Probable cloning artifact. Aberrant splice sites. The sequence BAB15406.1 differs from that shown. Reason: Erroneous initiation. The sequence BAG65161.1 differs from that shown. Reason: Erroneous initiation. |
Ontologies
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q12769-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q12769-2) The sequence of this isoform differs from the canonical sequence as follows: 175-224: SELVVDSQMQ...TASTAWLSSD → SVSWLSAISF...QAYFDSYRLK 225-1436: Missing. | ||||||
| Isoform 3 (identifier: Q12769-3) The sequence of this isoform differs from the canonical sequence as follows: 1-250: Missing. 367-367: Q → QRRGFAMLPGLKLLSSSSPPTSASQCAGITSVNHSTQPEFF 694-695: AQ → GK 696-1436: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1436 | 1436 | Nuclear pore complex protein Nup160 | PRO_0000204851 | |||||
Amino acid modifications | |||||||||
| Modified residue | 1157 | 1 | Phosphoserine Ref.7 Ref.8 Ref.9 Ref.10 Ref.11 Ref.13 | ||||||
| Modified residue | 1195 | 1 | Phosphothreonine By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 250 | 250 | Missing in isoform 3. | VSP_037350 | |||||
| Alternative sequence | 175 – 224 | 50 | SELVV…WLSSD → SVSWLSAISFISQITLGVTN VVLERCLLELKEIWILVIPH QAYFDSYRLK in isoform 2. | VSP_007093 | |||||
| Alternative sequence | 225 – 1436 | 1212 | Missing in isoform 2. | VSP_007094 | |||||
| Alternative sequence | 367 | 1 | Q → QRRGFAMLPGLKLLSSSSPP TSASQCAGITSVNHSTQPEF F in isoform 3. | VSP_037351 | |||||
| Alternative sequence | 694 – 695 | 2 | AQ → GK in isoform 3. | VSP_037352 | |||||
| Alternative sequence | 696 – 1436 | 741 | Missing in isoform 3. | VSP_037353 | |||||
| Natural variant | 40 | 1 | A → T. Ref.1 Corresponds to variant rs2305984 [ dbSNP | Ensembl ]. | VAR_055409 | |||||
| Natural variant | 351 | 1 | T → A. Ref.3 Corresponds to variant rs3816605 [ dbSNP | Ensembl ]. | VAR_055410 | |||||
Experimental info | |||||||||
| Sequence conflict | 152 | 1 | I → K in BAG65161. Ref.1 | ||||||
| Sequence conflict | 991 | 1 | G → S in BAA12110. Ref.4 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 31-1436 (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 32-1436 (ISOFORM 2), VARIANT THR-40. Tissue: Small intestine, Testis and Trachea. |
| [2] | "Human chromosome 11 DNA sequence and analysis including novel gene identification." Taylor T.D., Noguchi H., Totoki Y., Toyoda A., Kuroki Y., Dewar K., Lloyd C., Itoh T., Takeda T., Kim D.-W., She X., Barlow K.F., Bloom T., Bruford E., Chang J.L., Cuomo C.A., Eichler E., FitzGerald M.G. Sakaki Y.Nature 440:497-500(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2), VARIANT ALA-351. Tissue: Muscle and Skin. |
| [4] | "Prediction of the coding sequences of unidentified human genes. V. The coding sequences of 40 new genes (KIAA0161-KIAA0200) deduced by analysis of cDNA clones from human cell line KG-1." Nagase T., Seki N., Ishikawa K., Tanaka A., Nomura N. DNA Res. 3:17-24(1996) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 37-1436 (ISOFORM 1). Tissue: Bone marrow. |
| [5] | "An evolutionarily conserved NPC subcomplex, which redistributes in part to kinetochores in mammalian cells." Belgareh N., Rabut G., Bai S.W., van Overbeek M., Beaudouin J., Daigle N., Zatsepina O.V., Pasteau F., Labas V., Fromont-Racine M., Ellenberg J., Doye V. J. Cell Biol. 154:1147-1160(2001) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION, SUBUNIT, SUBCELLULAR LOCATION. |
| [6] | "Novel vertebrate nucleoporins Nup133 and Nup160 play a role in mRNA export." Vasu S., Shah S., Orjalo A., Park M., Fischer W.H., Forbes D.J. J. Cell Biol. 155:339-354(2001) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION, FUNCTION, SUBUNIT, SUBCELLULAR LOCATION. |
| [7] | "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks." Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M. Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1157, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [8] | "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle." Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M. Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1157, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [9] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1157, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [10] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1157, MASS SPECTROMETRY. Tissue: Leukemic T-cell. |
| [11] | "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis." Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M. Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1157, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [12] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [13] | "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation." Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B. Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1157, MASS SPECTROMETRY. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AK026236 mRNA. Translation: BAB15406.1. Different initiation. AK302396 mRNA. Translation: BAG63710.1. AK304308 mRNA. Translation: BAG65161.1. Different initiation. AC021443 Genomic DNA. No translation available. AC023232 Genomic DNA. No translation available. BC008700 mRNA. Translation: AAH08700.1. BC009822 mRNA. Translation: AAH09822.1. Different initiation. BC125227 mRNA. Translation: AAI25228.1. BC125228 mRNA. Translation: AAI25229.1. D83781 mRNA. Translation: BAA12110.1. Sequence problems. |
| IPI | IPI00221235. IPI00748807. IPI00909318. |
| PIR | G02870. |
| RefSeq | NP_056046.1. NM_015231.1. |
| UniGene | Hs.731939. |
3D structure databases | |
| ProteinModelPortal | Q12769. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q12769. 9 interactions. |
| MINT | MINT-4301556. |
| STRING | 9606.ENSP00000367721. |
PTM databases | |
| PhosphoSite | Q12769. |
Polymorphism databases | |
| DMDM | 238054372. |
Proteomic databases | |
| PaxDb | Q12769. |
| PRIDE | Q12769. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000378460; ENSP00000367721; ENSG00000030066. ENST00000526870; ENSP00000431495; ENSG00000030066. |
| GeneID | 23279. |
| KEGG | hsa:23279. |
| UCSC | uc001ngm.3. human. uc001ngn.1. human. |
Organism-specific databases | |
| CTD | 23279. |
| GeneCards | GC11M047866. |
| H-InvDB | HIX0009624. |
| HGNC | HGNC:18017. NUP160. |
| MIM | 607614. gene. |
| neXtProt | NX_Q12769. |
| PharmGKB | PA31850. |
| HUGE | Search... |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG254492. |
| HOVERGEN | HBG052681. |
| KO | K14303. |
| OMA | KCIKLQF. |
| OrthoDB | EOG43TZTN. |
Enzyme and pathway databases | |
| Reactome | REACT_111217. Metabolism. REACT_115566. Cell Cycle. REACT_116125. Disease. REACT_15518. Transmembrane transport of small molecules. REACT_21300. Mitotic M-M/G1 phases. REACT_6900. Immune System. |
Gene expression databases | |
| ArrayExpress | Q12769. |
| Bgee | Q12769. |
| CleanEx | HS_NUP160. |
| Genevestigator | Q12769. |
| GermOnline | ENSG00000030066. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR021717. Nucleoporin_Nup160. [Graphical view] |
| Pfam | PF11715. Nup160. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | NUP160. human. |
| GenomeRNAi | 23279. |
| NextBio | 45070. |
| SOURCE | Search... |
Entry information
| Entry name | NU160_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q12769 Secondary accession number(s): B4DYE8 Q9H660 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 11 Human chromosome 11: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |

Clusters with
