Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q12769 (NU160_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 135. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (4) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Nuclear pore complex protein Nup160
Alternative name(s):
160 kDa nucleoporin
Nucleoporin Nup160
Gene names
Name:NUP160
Synonyms:KIAA0197, NUP120
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length1436 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Involved in poly(A)+ RNA transport. Ref.6

Subunit structure

Forms part of the Nup160 subcomplex in the nuclear pore which is composed of NUP160, NUP133, NUP107 and Nup96. This complex plays a role in RNA export and in tethering Nup98 and NUP153 to the nucleus. Ref.5 Ref.6

Subcellular location

Nucleusnuclear pore complex Ref.5 Ref.6.

Caution

It is uncertain whether Met-1 or Met-35 is the initiator.

Sequence caution

The sequence AAH09822.1 differs from that shown. Reason: Erroneous initiation.

The sequence BAA12110.1 differs from that shown. Reason: Probable cloning artifact. Aberrant splice sites.

The sequence BAB15406.1 differs from that shown. Reason: Erroneous initiation.

The sequence BAG65161.1 differs from that shown. Reason: Erroneous initiation.

Ontologies

Keywords
   Biological processmRNA transport
Protein transport
Translocation
Transport
   Cellular componentNuclear pore complex
Nucleus
   Coding sequence diversityAlternative splicing
Polymorphism
   PTMPhosphoprotein
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processcarbohydrate metabolic process

Traceable author statement. Source: Reactome

cytokine-mediated signaling pathway

Traceable author statement. Source: Reactome

glucose transport

Traceable author statement. Source: Reactome

hexose transport

Traceable author statement. Source: Reactome

mRNA export from nucleus

Inferred from direct assay Ref.6. Source: UniProtKB

mitotic cell cycle

Traceable author statement. Source: Reactome

mitotic nuclear envelope disassembly

Traceable author statement. Source: Reactome

protein transport

Inferred from electronic annotation. Source: UniProtKB-KW

regulation of glucose transport

Traceable author statement. Source: Reactome

small molecule metabolic process

Traceable author statement. Source: Reactome

transmembrane transport

Traceable author statement. Source: Reactome

viral process

Traceable author statement. Source: Reactome

   Cellular_componentcytosol

Traceable author statement. Source: Reactome

nuclear envelope

Traceable author statement. Source: Reactome

nuclear pore

Inferred from direct assay Ref.5Ref.6PubMed 17098863. Source: UniProtKB

nuclear pore outer ring

Inferred from direct assay PubMed 17360435. Source: UniProtKB

   Molecular_functionnucleocytoplasmic transporter activity

Inferred from direct assay Ref.6. Source: UniProtKB

Complete GO annotation...

Alternative products

This entry describes 3 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q12769-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q12769-2)

The sequence of this isoform differs from the canonical sequence as follows:
     175-224: SELVVDSQMQ...TASTAWLSSD → SVSWLSAISF...QAYFDSYRLK
     225-1436: Missing.
Isoform 3 (identifier: Q12769-3)

The sequence of this isoform differs from the canonical sequence as follows:
     1-250: Missing.
     367-367: Q → QRRGFAMLPGLKLLSSSSPPTSASQCAGITSVNHSTQPEFF
     694-695: AQ → GK
     696-1436: Missing.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 14361436Nuclear pore complex protein Nup160
PRO_0000204851

Amino acid modifications

Modified residue11571Phosphoserine Ref.7 Ref.8 Ref.9 Ref.11 Ref.12 Ref.14

Natural variations

Alternative sequence1 – 250250Missing in isoform 3.
VSP_037350
Alternative sequence175 – 22450SELVV…WLSSD → SVSWLSAISFISQITLGVTN VVLERCLLELKEIWILVIPH QAYFDSYRLK in isoform 2.
VSP_007093
Alternative sequence225 – 14361212Missing in isoform 2.
VSP_007094
Alternative sequence3671Q → QRRGFAMLPGLKLLSSSSPP TSASQCAGITSVNHSTQPEF F in isoform 3.
VSP_037351
Alternative sequence694 – 6952AQ → GK in isoform 3.
VSP_037352
Alternative sequence696 – 1436741Missing in isoform 3.
VSP_037353
Natural variant401A → T. Ref.1
Corresponds to variant rs2305984 [ dbSNP | Ensembl ].
VAR_055409
Natural variant3511T → A. Ref.3
Corresponds to variant rs3816605 [ dbSNP | Ensembl ].
VAR_055410

Experimental info

Sequence conflict1521I → K in BAG65161. Ref.1
Sequence conflict9911G → S in BAA12110. Ref.4

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified May 26, 2009. Version 3.
Checksum: 274C063A3CE69F48

FASTA1,436162,121
        10         20         30         40         50         60 
MLHLSAAPPA PPPEVTATAR PCLCSVGRRG DGGKMAAAGA LERSFVELSG AERERPRHFR 

        70         80         90        100        110        120 
EFTVCSIGTA NAVAGAVKYS ESAGGFYYVE SGKLFSVTRN RFIHWKTSGD TLELMEESLD 

       130        140        150        160        170        180 
INLLNNAIRL KFQNCSVLPG GVYVSETQNR VIILMLTNQT VHRLLLPHPS RMYRSELVVD 

       190        200        210        220        230        240 
SQMQSIFTDI GKVDFTDPCN YQLIPAVPGI SPNSTASTAW LSSDGEALFA LPCASGGIFV 

       250        260        270        280        290        300 
LKLPPYDIPG MVSVVELKQS SVMQRLLTGW MPTAIRGDQS PSDRPLSLAV HCVEHDAFIF 

       310        320        330        340        350        360 
ALCQDHKLRM WSYKEQMCLM VADMLEYVPV KKDLRLTAGT GHKLRLAYSP TMGLYLGIYM 

       370        380        390        400        410        420 
HAPKRGQFCI FQLVSTESNR YSLDHISSLF TSQETLIDFA LTSTDIWALW HDAENQTVVK 

       430        440        450        460        470        480 
YINFEHNVAG QWNPVFMQPL PEEEIVIRDD QDPREMYLQS LFTPGQFTNE ALCKALQIFC 

       490        500        510        520        530        540 
RGTERNLDLS WSELKKEVTL AVENELQGSV TEYEFSQEEF RNLQQEFWCK FYACCLQYQE 

       550        560        570        580        590        600 
ALSHPLALHL NPHTNMVCLL KKGYLSFLIP SSLVDHLYLL PYENLLTEDE TTISDDVDIA 

       610        620        630        640        650        660 
RDVICLIKCL RLIEESVTVD MSVIMEMSCY NLQSPEKAAE QILEDMITID VENVMEDICS 

       670        680        690        700        710        720 
KLQEIRNPIH AIGLLIREMD YETEVEMEKG FNPAQPLNIR MNLTQLYGSN TAGYIVCRGV 

       730        740        750        760        770        780 
HKIASTRFLI CRDLLILQQL LMRLGDAVIW GTGQLFQAQQ DLLHRTAPLL LSYYLIKWGS 

       790        800        810        820        830        840 
ECLATDVPLD TLESNLQHLS VLELTDSGAL MANRFVSSPQ TIVELFFQEV ARKHIISHLF 

       850        860        870        880        890        900 
SQPKAPLSQT GLNWPEMITA ITSYLLQLLW PSNPGCLFLE CLMGNCQYVQ LQDYIQLLHP 

       910        920        930        940        950        960 
WCQVNVGSCR FMLGRCYLVT GEGQKALECF CQAASEVGKE EFLDRLIRSE DGEIVSTPRL 

       970        980        990       1000       1010       1020 
QYYDKVLRLL DVIGLPELVI QLATSAITEA GDDWKSQATL RTCIFKHHLD LGHNSQAYEA 

      1030       1040       1050       1060       1070       1080 
LTQIPDSSRQ LDCLRQLVVV LCERSQLQDL VEFPYVNLHN EVVGIIESRA RAVDLMTHNY 

      1090       1100       1110       1120       1130       1140 
YELLYAFHIY RHNYRKAGTV MFEYGMRLGR EVRTLRGLEK QGNCYLAALN CLRLIRPEYA 

      1150       1160       1170       1180       1190       1200 
WIVQPVSGAV YDRPGASPKR NHDGECTAAP TNRQIEILEL EDLEKECSLA RIRLTLAQHD 

      1210       1220       1230       1240       1250       1260 
PSAVAVAGSS SAEEMVTLLV QAGLFDTAIS LCQTFKLPLT PVFEGLAFKC IKLQFGGEAA 

      1270       1280       1290       1300       1310       1320 
QAEAWAWLAA NQLSSVITTK ESSATDEAWR LLSTYLERYK VQNNLYHHCV INKLLSHGVP 

      1330       1340       1350       1360       1370       1380 
LPNWLINSYK KVDAAELLRL YLNYDLLEEA VDLVSEYVDA VLGKGHQYFG IEFPLSATAP 

      1390       1400       1410       1420       1430 
MVWLPYSSID QLLQALGENS ANSHNIALSQ KILDKLEDYQ QKVDKATRDL LYRRTL 

« Hide

Isoform 2 [UniParc].

Checksum: C98755EBCB0E1BC7
Show »

FASTA22424,898
Isoform 3 [UniParc].

Checksum: 4650AE42B030DFBC
Show »

FASTA48555,554

References

« Hide 'large scale' references
[1]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 31-1436 (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 32-1436 (ISOFORM 2), VARIANT THR-40.
Tissue: Small intestine, Testis and Trachea.
[2]"Human chromosome 11 DNA sequence and analysis including novel gene identification."
Taylor T.D., Noguchi H., Totoki Y., Toyoda A., Kuroki Y., Dewar K., Lloyd C., Itoh T., Takeda T., Kim D.-W., She X., Barlow K.F., Bloom T., Bruford E., Chang J.L., Cuomo C.A., Eichler E., FitzGerald M.G. expand/collapse author list , Jaffe D.B., LaButti K., Nicol R., Park H.-S., Seaman C., Sougnez C., Yang X., Zimmer A.R., Zody M.C., Birren B.W., Nusbaum C., Fujiyama A., Hattori M., Rogers J., Lander E.S., Sakaki Y.
Nature 440:497-500(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[3]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2), VARIANT ALA-351.
Tissue: Muscle and Skin.
[4]"Prediction of the coding sequences of unidentified human genes. V. The coding sequences of 40 new genes (KIAA0161-KIAA0200) deduced by analysis of cDNA clones from human cell line KG-1."
Nagase T., Seki N., Ishikawa K., Tanaka A., Nomura N.
DNA Res. 3:17-24(1996) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 37-1436 (ISOFORM 1).
Tissue: Bone marrow.
[5]"An evolutionarily conserved NPC subcomplex, which redistributes in part to kinetochores in mammalian cells."
Belgareh N., Rabut G., Bai S.W., van Overbeek M., Beaudouin J., Daigle N., Zatsepina O.V., Pasteau F., Labas V., Fromont-Racine M., Ellenberg J., Doye V.
J. Cell Biol. 154:1147-1160(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION, SUBUNIT, SUBCELLULAR LOCATION.
[6]"Novel vertebrate nucleoporins Nup133 and Nup160 play a role in mRNA export."
Vasu S., Shah S., Orjalo A., Park M., Fischer W.H., Forbes D.J.
J. Cell Biol. 155:339-354(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION, FUNCTION, SUBUNIT, SUBCELLULAR LOCATION.
[7]"Global, in vivo, and site-specific phosphorylation dynamics in signaling networks."
Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M.
Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1157, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[8]"Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle."
Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M.
Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1157, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[9]"A quantitative atlas of mitotic phosphorylation."
Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P.
Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1157, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[10]"Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
[11]"Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1157, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Leukemic T-cell.
[12]"Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1157, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[13]"Initial characterization of the human central proteome."
Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.
BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
[14]"System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1157, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
[15]"Comparative large-scale characterisation of plant vs. mammal proteins reveals similar and idiosyncratic N-alpha acetylation features."
Bienvenut W.V., Sumpton D., Martinez A., Lilla S., Espagne C., Meinnel T., Giglione C.
Mol. Cell. Proteomics 11:M111.015131-M111.015131(2012) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
[16]"N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB."
Van Damme P., Lasa M., Polevoda B., Gazquez C., Elosegui-Artola A., Kim D.S., De Juan-Pardo E., Demeyer K., Hole K., Larrea E., Timmerman E., Prieto J., Arnesen T., Sherman F., Gevaert K., Aldabe R.
Proc. Natl. Acad. Sci. U.S.A. 109:12449-12454(2012) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AK026236 mRNA. Translation: BAB15406.1. Different initiation.
AK302396 mRNA. Translation: BAG63710.1.
AK304308 mRNA. Translation: BAG65161.1. Different initiation.
AC021443 Genomic DNA. No translation available.
AC023232 Genomic DNA. No translation available.
BC008700 mRNA. Translation: AAH08700.1.
BC009822 mRNA. Translation: AAH09822.1. Different initiation.
BC125227 mRNA. Translation: AAI25228.1.
BC125228 mRNA. Translation: AAI25229.1.
D83781 mRNA. Translation: BAA12110.1. Sequence problems.
PIRG02870.
RefSeqNP_056046.1. NM_015231.1.
UniGeneHs.744107.

3D structure databases

ProteinModelPortalQ12769.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid116879. 18 interactions.
DIPDIP-31262N.
IntActQ12769. 12 interactions.
MINTMINT-4301556.
STRING9606.ENSP00000367721.

PTM databases

PhosphoSiteQ12769.

Polymorphism databases

DMDM238054372.

Proteomic databases

PaxDbQ12769.
PRIDEQ12769.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000378460; ENSP00000367721; ENSG00000030066. [Q12769-1]
ENST00000526870; ENSP00000431495; ENSG00000030066. [Q12769-2]
GeneID23279.
KEGGhsa:23279.
UCSCuc001ngm.3. human. [Q12769-1]
uc001ngn.1. human. [Q12769-2]

Organism-specific databases

CTD23279.
GeneCardsGC11M048807.
H-InvDBHIX0009624.
HGNCHGNC:18017. NUP160.
MIM607614. gene.
neXtProtNX_Q12769.
PharmGKBPA31850.
HUGESearch...
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG254492.
HOVERGENHBG052681.
KOK14303.
OMAPREMYLR.
OrthoDBEOG7B31MH.
PhylomeDBQ12769.
TreeFamTF353082.

Enzyme and pathway databases

ReactomeREACT_111217. Metabolism.
REACT_115566. Cell Cycle.
REACT_116125. Disease.
REACT_15518. Transmembrane transport of small molecules.
REACT_21300. Mitotic M-M/G1 phases.
REACT_6900. Immune System.

Gene expression databases

ArrayExpressQ12769.
BgeeQ12769.
CleanExHS_NUP160.
GenevestigatorQ12769.

Family and domain databases

InterProIPR021717. Nucleoporin_Nup160.
[Graphical view]
PfamPF11715. Nup160. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSNUP160. human.
GeneWikiNUP160.
GenomeRNAi23279.
NextBio45070.
PROQ12769.
SOURCESearch...

Entry information

Entry nameNU160_HUMAN
AccessionPrimary (citable) accession number: Q12769
Secondary accession number(s): B4DYE8 expand/collapse secondary AC list , B4E2J9, Q08AD3, Q7Z5X6, Q96GB3, Q9H660
Entry history
Integrated into UniProtKB/Swiss-Prot: February 21, 2001
Last sequence update: May 26, 2009
Last modified: April 16, 2014
This is version 135 of the entry and version 3 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 11

Human chromosome 11: entries, gene names and cross-references to MIM