Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Nuclear pore complex protein Nup160

Gene

NUP160

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Involved in poly(A)+ RNA transport.1 Publication

GO - Molecular functioni

  • nucleocytoplasmic transporter activity Source: UniProtKB

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

mRNA transport, Protein transport, Translocation, Transport

Enzyme and pathway databases

ReactomeiREACT_115831. ISG15 antiviral mechanism.
REACT_150425. Resolution of Sister Chromatid Cohesion.
REACT_150471. Separation of Sister Chromatids.
REACT_163931. Nuclear Pore Complex (NPC) Disassembly.
REACT_264487. Regulation of HSF1-mediated heat shock response.
REACT_268530. Transcriptional regulation by small RNAs.
REACT_355174. SUMOylation of DNA damage response and repair proteins.
REACT_355252. RHO GTPases Activate Formins.
REACT_6190. Rev-mediated nuclear export of HIV RNA.
REACT_6354. Viral Messenger RNA Synthesis.
REACT_6804. Regulation of Glucokinase by Glucokinase Regulatory Protein.
REACT_682. Mitotic Prometaphase.
REACT_7991. Vpr-mediated nuclear import of PICs.
REACT_9395. Nuclear import of Rev protein.

Names & Taxonomyi

Protein namesi
Recommended name:
Nuclear pore complex protein Nup160
Alternative name(s):
160 kDa nucleoporin
Nucleoporin Nup160
Gene namesi
Name:NUP160
Synonyms:KIAA0197, NUP120
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640 Componenti: Chromosome 11

Organism-specific databases

HGNCiHGNC:18017. NUP160.

Subcellular locationi

GO - Cellular componenti

  • cytosol Source: Reactome
  • nuclear envelope Source: Reactome
  • nuclear pore Source: UniProtKB
  • nuclear pore outer ring Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Nuclear pore complex, Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA31850.

Polymorphism and mutation databases

BioMutaiNUP160.
DMDMi238054372.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 14361436Nuclear pore complex protein Nup160PRO_0000204851Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei1157 – 11571Phosphoserine6 Publications

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ12769.
PaxDbiQ12769.
PRIDEiQ12769.

PTM databases

PhosphoSiteiQ12769.

Expressioni

Gene expression databases

BgeeiQ12769.
CleanExiHS_NUP160.
ExpressionAtlasiQ12769. baseline and differential.
GenevestigatoriQ12769.

Interactioni

Subunit structurei

Forms part of the Nup160 subcomplex in the nuclear pore which is composed of NUP160, NUP133, NUP107 and Nup96. This complex plays a role in RNA export and in tethering Nup98 and NUP153 to the nucleus.2 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
ESRRGP625083EBI-295715,EBI-2834260

Protein-protein interaction databases

BioGridi116879. 24 interactions.
DIPiDIP-31262N.
IntActiQ12769. 14 interactions.
MINTiMINT-4301556.
STRINGi9606.ENSP00000367721.

Structurei

3D structure databases

ProteinModelPortaliQ12769.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Phylogenomic databases

eggNOGiNOG254492.
GeneTreeiENSGT00390000000972.
HOVERGENiHBG052681.
InParanoidiQ12769.
KOiK14303.
OMAiPREMYLR.
OrthoDBiEOG7B31MH.
PhylomeDBiQ12769.
TreeFamiTF353082.

Family and domain databases

InterProiIPR021717. Nucleoporin_Nup160.
[Graphical view]
PfamiPF11715. Nup160. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q12769-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MLHLSAAPPA PPPEVTATAR PCLCSVGRRG DGGKMAAAGA LERSFVELSG
60 70 80 90 100
AERERPRHFR EFTVCSIGTA NAVAGAVKYS ESAGGFYYVE SGKLFSVTRN
110 120 130 140 150
RFIHWKTSGD TLELMEESLD INLLNNAIRL KFQNCSVLPG GVYVSETQNR
160 170 180 190 200
VIILMLTNQT VHRLLLPHPS RMYRSELVVD SQMQSIFTDI GKVDFTDPCN
210 220 230 240 250
YQLIPAVPGI SPNSTASTAW LSSDGEALFA LPCASGGIFV LKLPPYDIPG
260 270 280 290 300
MVSVVELKQS SVMQRLLTGW MPTAIRGDQS PSDRPLSLAV HCVEHDAFIF
310 320 330 340 350
ALCQDHKLRM WSYKEQMCLM VADMLEYVPV KKDLRLTAGT GHKLRLAYSP
360 370 380 390 400
TMGLYLGIYM HAPKRGQFCI FQLVSTESNR YSLDHISSLF TSQETLIDFA
410 420 430 440 450
LTSTDIWALW HDAENQTVVK YINFEHNVAG QWNPVFMQPL PEEEIVIRDD
460 470 480 490 500
QDPREMYLQS LFTPGQFTNE ALCKALQIFC RGTERNLDLS WSELKKEVTL
510 520 530 540 550
AVENELQGSV TEYEFSQEEF RNLQQEFWCK FYACCLQYQE ALSHPLALHL
560 570 580 590 600
NPHTNMVCLL KKGYLSFLIP SSLVDHLYLL PYENLLTEDE TTISDDVDIA
610 620 630 640 650
RDVICLIKCL RLIEESVTVD MSVIMEMSCY NLQSPEKAAE QILEDMITID
660 670 680 690 700
VENVMEDICS KLQEIRNPIH AIGLLIREMD YETEVEMEKG FNPAQPLNIR
710 720 730 740 750
MNLTQLYGSN TAGYIVCRGV HKIASTRFLI CRDLLILQQL LMRLGDAVIW
760 770 780 790 800
GTGQLFQAQQ DLLHRTAPLL LSYYLIKWGS ECLATDVPLD TLESNLQHLS
810 820 830 840 850
VLELTDSGAL MANRFVSSPQ TIVELFFQEV ARKHIISHLF SQPKAPLSQT
860 870 880 890 900
GLNWPEMITA ITSYLLQLLW PSNPGCLFLE CLMGNCQYVQ LQDYIQLLHP
910 920 930 940 950
WCQVNVGSCR FMLGRCYLVT GEGQKALECF CQAASEVGKE EFLDRLIRSE
960 970 980 990 1000
DGEIVSTPRL QYYDKVLRLL DVIGLPELVI QLATSAITEA GDDWKSQATL
1010 1020 1030 1040 1050
RTCIFKHHLD LGHNSQAYEA LTQIPDSSRQ LDCLRQLVVV LCERSQLQDL
1060 1070 1080 1090 1100
VEFPYVNLHN EVVGIIESRA RAVDLMTHNY YELLYAFHIY RHNYRKAGTV
1110 1120 1130 1140 1150
MFEYGMRLGR EVRTLRGLEK QGNCYLAALN CLRLIRPEYA WIVQPVSGAV
1160 1170 1180 1190 1200
YDRPGASPKR NHDGECTAAP TNRQIEILEL EDLEKECSLA RIRLTLAQHD
1210 1220 1230 1240 1250
PSAVAVAGSS SAEEMVTLLV QAGLFDTAIS LCQTFKLPLT PVFEGLAFKC
1260 1270 1280 1290 1300
IKLQFGGEAA QAEAWAWLAA NQLSSVITTK ESSATDEAWR LLSTYLERYK
1310 1320 1330 1340 1350
VQNNLYHHCV INKLLSHGVP LPNWLINSYK KVDAAELLRL YLNYDLLEEA
1360 1370 1380 1390 1400
VDLVSEYVDA VLGKGHQYFG IEFPLSATAP MVWLPYSSID QLLQALGENS
1410 1420 1430
ANSHNIALSQ KILDKLEDYQ QKVDKATRDL LYRRTL
Length:1,436
Mass (Da):162,121
Last modified:May 26, 2009 - v3
Checksum:i274C063A3CE69F48
GO
Isoform 2 (identifier: Q12769-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     175-224: SELVVDSQMQ...TASTAWLSSD → SVSWLSAISF...QAYFDSYRLK
     225-1436: Missing.

Show »
Length:224
Mass (Da):24,898
Checksum:iC98755EBCB0E1BC7
GO
Isoform 3 (identifier: Q12769-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-250: Missing.
     367-367: Q → QRRGFAMLPGLKLLSSSSPPTSASQCAGITSVNHSTQPEFF
     694-695: AQ → GK
     696-1436: Missing.

Show »
Length:485
Mass (Da):55,554
Checksum:i4650AE42B030DFBC
GO

Sequence cautioni

The sequence AAH09822.1 differs from that shown. Reason: Erroneous initiation. Curated
The sequence BAA12110.1 differs from that shown.Probable cloning artifact. Aberrant splice sites.Curated
The sequence BAB15406.1 differs from that shown. Reason: Erroneous initiation. Curated
The sequence BAG65161.1 differs from that shown. Reason: Erroneous initiation. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti152 – 1521I → K in BAG65161 (PubMed:14702039).Curated
Sequence conflicti991 – 9911G → S in BAA12110 (PubMed:8724849).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti40 – 401A → T.1 Publication
Corresponds to variant rs2305984 [ dbSNP | Ensembl ].
VAR_055409
Natural varianti351 – 3511T → A.1 Publication
Corresponds to variant rs3816605 [ dbSNP | Ensembl ].
VAR_055410

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 250250Missing in isoform 3. 1 PublicationVSP_037350Add
BLAST
Alternative sequencei175 – 22450SELVV…WLSSD → SVSWLSAISFISQITLGVTN VVLERCLLELKEIWILVIPH QAYFDSYRLK in isoform 2. 2 PublicationsVSP_007093Add
BLAST
Alternative sequencei225 – 14361212Missing in isoform 2. 2 PublicationsVSP_007094Add
BLAST
Alternative sequencei367 – 3671Q → QRRGFAMLPGLKLLSSSSPP TSASQCAGITSVNHSTQPEF F in isoform 3. 1 PublicationVSP_037351
Alternative sequencei694 – 6952AQ → GK in isoform 3. 1 PublicationVSP_037352
Alternative sequencei696 – 1436741Missing in isoform 3. 1 PublicationVSP_037353Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK026236 mRNA. Translation: BAB15406.1. Different initiation.
AK302396 mRNA. Translation: BAG63710.1.
AK304308 mRNA. Translation: BAG65161.1. Different initiation.
AC021443 Genomic DNA. No translation available.
AC023232 Genomic DNA. No translation available.
BC008700 mRNA. Translation: AAH08700.1.
BC009822 mRNA. Translation: AAH09822.1. Different initiation.
BC125227 mRNA. Translation: AAI25228.1.
BC125228 mRNA. Translation: AAI25229.1.
D83781 mRNA. Translation: BAA12110.1. Sequence problems.
CCDSiCCDS31484.1. [Q12769-1]
PIRiG02870.
RefSeqiNP_056046.1. NM_015231.1. [Q12769-1]
UniGeneiHs.744107.

Genome annotation databases

EnsembliENST00000378460; ENSP00000367721; ENSG00000030066. [Q12769-1]
ENST00000526870; ENSP00000431495; ENSG00000030066. [Q12769-2]
GeneIDi23279.
KEGGihsa:23279.
UCSCiuc001ngm.3. human. [Q12769-1]
uc001ngn.1. human. [Q12769-2]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK026236 mRNA. Translation: BAB15406.1. Different initiation.
AK302396 mRNA. Translation: BAG63710.1.
AK304308 mRNA. Translation: BAG65161.1. Different initiation.
AC021443 Genomic DNA. No translation available.
AC023232 Genomic DNA. No translation available.
BC008700 mRNA. Translation: AAH08700.1.
BC009822 mRNA. Translation: AAH09822.1. Different initiation.
BC125227 mRNA. Translation: AAI25228.1.
BC125228 mRNA. Translation: AAI25229.1.
D83781 mRNA. Translation: BAA12110.1. Sequence problems.
CCDSiCCDS31484.1. [Q12769-1]
PIRiG02870.
RefSeqiNP_056046.1. NM_015231.1. [Q12769-1]
UniGeneiHs.744107.

3D structure databases

ProteinModelPortaliQ12769.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi116879. 24 interactions.
DIPiDIP-31262N.
IntActiQ12769. 14 interactions.
MINTiMINT-4301556.
STRINGi9606.ENSP00000367721.

PTM databases

PhosphoSiteiQ12769.

Polymorphism and mutation databases

BioMutaiNUP160.
DMDMi238054372.

Proteomic databases

MaxQBiQ12769.
PaxDbiQ12769.
PRIDEiQ12769.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000378460; ENSP00000367721; ENSG00000030066. [Q12769-1]
ENST00000526870; ENSP00000431495; ENSG00000030066. [Q12769-2]
GeneIDi23279.
KEGGihsa:23279.
UCSCiuc001ngm.3. human. [Q12769-1]
uc001ngn.1. human. [Q12769-2]

Organism-specific databases

CTDi23279.
GeneCardsiGC11M049912.
H-InvDBHIX0009624.
HGNCiHGNC:18017. NUP160.
MIMi607614. gene.
neXtProtiNX_Q12769.
PharmGKBiPA31850.
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiNOG254492.
GeneTreeiENSGT00390000000972.
HOVERGENiHBG052681.
InParanoidiQ12769.
KOiK14303.
OMAiPREMYLR.
OrthoDBiEOG7B31MH.
PhylomeDBiQ12769.
TreeFamiTF353082.

Enzyme and pathway databases

ReactomeiREACT_115831. ISG15 antiviral mechanism.
REACT_150425. Resolution of Sister Chromatid Cohesion.
REACT_150471. Separation of Sister Chromatids.
REACT_163931. Nuclear Pore Complex (NPC) Disassembly.
REACT_264487. Regulation of HSF1-mediated heat shock response.
REACT_268530. Transcriptional regulation by small RNAs.
REACT_355174. SUMOylation of DNA damage response and repair proteins.
REACT_355252. RHO GTPases Activate Formins.
REACT_6190. Rev-mediated nuclear export of HIV RNA.
REACT_6354. Viral Messenger RNA Synthesis.
REACT_6804. Regulation of Glucokinase by Glucokinase Regulatory Protein.
REACT_682. Mitotic Prometaphase.
REACT_7991. Vpr-mediated nuclear import of PICs.
REACT_9395. Nuclear import of Rev protein.

Miscellaneous databases

ChiTaRSiNUP160. human.
GeneWikiiNUP160.
GenomeRNAii23279.
NextBioi45070.
PROiQ12769.
SOURCEiSearch...

Gene expression databases

BgeeiQ12769.
CleanExiHS_NUP160.
ExpressionAtlasiQ12769. baseline and differential.
GenevestigatoriQ12769.

Family and domain databases

InterProiIPR021717. Nucleoporin_Nup160.
[Graphical view]
PfamiPF11715. Nup160. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 31-1436 (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 32-1436 (ISOFORM 2), VARIANT THR-40.
    Tissue: Small intestine, Testis and Trachea.
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2), VARIANT ALA-351.
    Tissue: Muscle and Skin.
  4. "Prediction of the coding sequences of unidentified human genes. V. The coding sequences of 40 new genes (KIAA0161-KIAA0200) deduced by analysis of cDNA clones from human cell line KG-1."
    Nagase T., Seki N., Ishikawa K., Tanaka A., Nomura N.
    DNA Res. 3:17-24(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 37-1436 (ISOFORM 1).
    Tissue: Bone marrow.
  5. "An evolutionarily conserved NPC subcomplex, which redistributes in part to kinetochores in mammalian cells."
    Belgareh N., Rabut G., Bai S.W., van Overbeek M., Beaudouin J., Daigle N., Zatsepina O.V., Pasteau F., Labas V., Fromont-Racine M., Ellenberg J., Doye V.
    J. Cell Biol. 154:1147-1160(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION, SUBUNIT, SUBCELLULAR LOCATION.
  6. "Novel vertebrate nucleoporins Nup133 and Nup160 play a role in mRNA export."
    Vasu S., Shah S., Orjalo A., Park M., Fischer W.H., Forbes D.J.
    J. Cell Biol. 155:339-354(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION, FUNCTION, SUBUNIT, SUBCELLULAR LOCATION.
  7. "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks."
    Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M.
    Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1157, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  8. "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle."
    Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M.
    Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1157, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  9. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1157, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  10. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
    Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
    Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1157, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Leukemic T-cell.
  11. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
    Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
    Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1157, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  12. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  13. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
    Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
    Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1157, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  14. "An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome."
    Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.
    J. Proteomics 96:253-262(2014) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Liver.

Entry informationi

Entry nameiNU160_HUMAN
AccessioniPrimary (citable) accession number: Q12769
Secondary accession number(s): B4DYE8
, B4E2J9, Q08AD3, Q7Z5X6, Q96GB3, Q9H660
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 21, 2001
Last sequence update: May 26, 2009
Last modified: May 27, 2015
This is version 148 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Caution

It is uncertain whether Met-1 or Met-35 is the initiator.Curated

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.