Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q12769

- NU160_HUMAN

UniProt

Q12769 - NU160_HUMAN

Protein

Nuclear pore complex protein Nup160

Gene

NUP160

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 140 (01 Oct 2014)
      Sequence version 3 (26 May 2009)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Involved in poly(A)+ RNA transport.1 Publication

    GO - Molecular functioni

    1. nucleocytoplasmic transporter activity Source: UniProtKB
    2. protein binding Source: UniProtKB

    GO - Biological processi

    1. carbohydrate metabolic process Source: Reactome
    2. cytokine-mediated signaling pathway Source: Reactome
    3. glucose transport Source: Reactome
    4. hexose transport Source: Reactome
    5. mitotic cell cycle Source: Reactome
    6. mitotic nuclear envelope disassembly Source: Reactome
    7. mRNA export from nucleus Source: UniProtKB
    8. protein transport Source: UniProtKB-KW
    9. regulation of glucose transport Source: Reactome
    10. small molecule metabolic process Source: Reactome
    11. transmembrane transport Source: Reactome
    12. viral process Source: Reactome

    Keywords - Biological processi

    mRNA transport, Protein transport, Translocation, Transport

    Enzyme and pathway databases

    ReactomeiREACT_115831. ISG15 antiviral mechanism.
    REACT_150425. Resolution of Sister Chromatid Cohesion.
    REACT_150471. Separation of Sister Chromatids.
    REACT_163931. Nuclear Pore Complex (NPC) Disassembly.
    REACT_6190. Rev-mediated nuclear export of HIV RNA.
    REACT_6804. Regulation of Glucokinase by Glucokinase Regulatory Protein.
    REACT_682. Mitotic Prometaphase.
    REACT_7991. Vpr-mediated nuclear import of PICs.
    REACT_9395. Nuclear import of Rev protein.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Nuclear pore complex protein Nup160
    Alternative name(s):
    160 kDa nucleoporin
    Nucleoporin Nup160
    Gene namesi
    Name:NUP160
    Synonyms:KIAA0197, NUP120
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 11

    Organism-specific databases

    HGNCiHGNC:18017. NUP160.

    Subcellular locationi

    Nucleusnuclear pore complex 2 Publications

    GO - Cellular componenti

    1. cytosol Source: Reactome
    2. nuclear envelope Source: Reactome
    3. nuclear pore Source: UniProtKB
    4. nuclear pore outer ring Source: UniProtKB

    Keywords - Cellular componenti

    Nuclear pore complex, Nucleus

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA31850.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 14361436Nuclear pore complex protein Nup160PRO_0000204851Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei1157 – 11571Phosphoserine6 Publications

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    MaxQBiQ12769.
    PaxDbiQ12769.
    PRIDEiQ12769.

    PTM databases

    PhosphoSiteiQ12769.

    Expressioni

    Gene expression databases

    ArrayExpressiQ12769.
    BgeeiQ12769.
    CleanExiHS_NUP160.
    GenevestigatoriQ12769.

    Interactioni

    Subunit structurei

    Forms part of the Nup160 subcomplex in the nuclear pore which is composed of NUP160, NUP133, NUP107 and Nup96. This complex plays a role in RNA export and in tethering Nup98 and NUP153 to the nucleus.2 Publications

    Protein-protein interaction databases

    BioGridi116879. 19 interactions.
    DIPiDIP-31262N.
    IntActiQ12769. 13 interactions.
    MINTiMINT-4301556.
    STRINGi9606.ENSP00000367721.

    Structurei

    3D structure databases

    ProteinModelPortaliQ12769.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Phylogenomic databases

    eggNOGiNOG254492.
    HOVERGENiHBG052681.
    KOiK14303.
    OMAiMEMACSR.
    OrthoDBiEOG7B31MH.
    PhylomeDBiQ12769.
    TreeFamiTF353082.

    Family and domain databases

    InterProiIPR021717. Nucleoporin_Nup160.
    [Graphical view]
    PfamiPF11715. Nup160. 1 hit.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q12769-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MLHLSAAPPA PPPEVTATAR PCLCSVGRRG DGGKMAAAGA LERSFVELSG     50
    AERERPRHFR EFTVCSIGTA NAVAGAVKYS ESAGGFYYVE SGKLFSVTRN 100
    RFIHWKTSGD TLELMEESLD INLLNNAIRL KFQNCSVLPG GVYVSETQNR 150
    VIILMLTNQT VHRLLLPHPS RMYRSELVVD SQMQSIFTDI GKVDFTDPCN 200
    YQLIPAVPGI SPNSTASTAW LSSDGEALFA LPCASGGIFV LKLPPYDIPG 250
    MVSVVELKQS SVMQRLLTGW MPTAIRGDQS PSDRPLSLAV HCVEHDAFIF 300
    ALCQDHKLRM WSYKEQMCLM VADMLEYVPV KKDLRLTAGT GHKLRLAYSP 350
    TMGLYLGIYM HAPKRGQFCI FQLVSTESNR YSLDHISSLF TSQETLIDFA 400
    LTSTDIWALW HDAENQTVVK YINFEHNVAG QWNPVFMQPL PEEEIVIRDD 450
    QDPREMYLQS LFTPGQFTNE ALCKALQIFC RGTERNLDLS WSELKKEVTL 500
    AVENELQGSV TEYEFSQEEF RNLQQEFWCK FYACCLQYQE ALSHPLALHL 550
    NPHTNMVCLL KKGYLSFLIP SSLVDHLYLL PYENLLTEDE TTISDDVDIA 600
    RDVICLIKCL RLIEESVTVD MSVIMEMSCY NLQSPEKAAE QILEDMITID 650
    VENVMEDICS KLQEIRNPIH AIGLLIREMD YETEVEMEKG FNPAQPLNIR 700
    MNLTQLYGSN TAGYIVCRGV HKIASTRFLI CRDLLILQQL LMRLGDAVIW 750
    GTGQLFQAQQ DLLHRTAPLL LSYYLIKWGS ECLATDVPLD TLESNLQHLS 800
    VLELTDSGAL MANRFVSSPQ TIVELFFQEV ARKHIISHLF SQPKAPLSQT 850
    GLNWPEMITA ITSYLLQLLW PSNPGCLFLE CLMGNCQYVQ LQDYIQLLHP 900
    WCQVNVGSCR FMLGRCYLVT GEGQKALECF CQAASEVGKE EFLDRLIRSE 950
    DGEIVSTPRL QYYDKVLRLL DVIGLPELVI QLATSAITEA GDDWKSQATL 1000
    RTCIFKHHLD LGHNSQAYEA LTQIPDSSRQ LDCLRQLVVV LCERSQLQDL 1050
    VEFPYVNLHN EVVGIIESRA RAVDLMTHNY YELLYAFHIY RHNYRKAGTV 1100
    MFEYGMRLGR EVRTLRGLEK QGNCYLAALN CLRLIRPEYA WIVQPVSGAV 1150
    YDRPGASPKR NHDGECTAAP TNRQIEILEL EDLEKECSLA RIRLTLAQHD 1200
    PSAVAVAGSS SAEEMVTLLV QAGLFDTAIS LCQTFKLPLT PVFEGLAFKC 1250
    IKLQFGGEAA QAEAWAWLAA NQLSSVITTK ESSATDEAWR LLSTYLERYK 1300
    VQNNLYHHCV INKLLSHGVP LPNWLINSYK KVDAAELLRL YLNYDLLEEA 1350
    VDLVSEYVDA VLGKGHQYFG IEFPLSATAP MVWLPYSSID QLLQALGENS 1400
    ANSHNIALSQ KILDKLEDYQ QKVDKATRDL LYRRTL 1436
    Length:1,436
    Mass (Da):162,121
    Last modified:May 26, 2009 - v3
    Checksum:i274C063A3CE69F48
    GO
    Isoform 2 (identifier: Q12769-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         175-224: SELVVDSQMQ...TASTAWLSSD → SVSWLSAISF...QAYFDSYRLK
         225-1436: Missing.

    Show »
    Length:224
    Mass (Da):24,898
    Checksum:iC98755EBCB0E1BC7
    GO
    Isoform 3 (identifier: Q12769-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-250: Missing.
         367-367: Q → QRRGFAMLPGLKLLSSSSPPTSASQCAGITSVNHSTQPEFF
         694-695: AQ → GK
         696-1436: Missing.

    Show »
    Length:485
    Mass (Da):55,554
    Checksum:i4650AE42B030DFBC
    GO

    Sequence cautioni

    The sequence BAA12110.1 differs from that shown. Reason: Probable cloning artifact. Aberrant splice sites.
    The sequence AAH09822.1 differs from that shown. Reason: Erroneous initiation.
    The sequence BAB15406.1 differs from that shown. Reason: Erroneous initiation.
    The sequence BAG65161.1 differs from that shown. Reason: Erroneous initiation.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti152 – 1521I → K in BAG65161. (PubMed:14702039)Curated
    Sequence conflicti991 – 9911G → S in BAA12110. (PubMed:8724849)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti40 – 401A → T.1 Publication
    Corresponds to variant rs2305984 [ dbSNP | Ensembl ].
    VAR_055409
    Natural varianti351 – 3511T → A.1 Publication
    Corresponds to variant rs3816605 [ dbSNP | Ensembl ].
    VAR_055410

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 250250Missing in isoform 3. 1 PublicationVSP_037350Add
    BLAST
    Alternative sequencei175 – 22450SELVV…WLSSD → SVSWLSAISFISQITLGVTN VVLERCLLELKEIWILVIPH QAYFDSYRLK in isoform 2. 2 PublicationsVSP_007093Add
    BLAST
    Alternative sequencei225 – 14361212Missing in isoform 2. 2 PublicationsVSP_007094Add
    BLAST
    Alternative sequencei367 – 3671Q → QRRGFAMLPGLKLLSSSSPP TSASQCAGITSVNHSTQPEF F in isoform 3. 1 PublicationVSP_037351
    Alternative sequencei694 – 6952AQ → GK in isoform 3. 1 PublicationVSP_037352
    Alternative sequencei696 – 1436741Missing in isoform 3. 1 PublicationVSP_037353Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK026236 mRNA. Translation: BAB15406.1. Different initiation.
    AK302396 mRNA. Translation: BAG63710.1.
    AK304308 mRNA. Translation: BAG65161.1. Different initiation.
    AC021443 Genomic DNA. No translation available.
    AC023232 Genomic DNA. No translation available.
    BC008700 mRNA. Translation: AAH08700.1.
    BC009822 mRNA. Translation: AAH09822.1. Different initiation.
    BC125227 mRNA. Translation: AAI25228.1.
    BC125228 mRNA. Translation: AAI25229.1.
    D83781 mRNA. Translation: BAA12110.1. Sequence problems.
    CCDSiCCDS31484.1. [Q12769-1]
    PIRiG02870.
    RefSeqiNP_056046.1. NM_015231.1. [Q12769-1]
    UniGeneiHs.744107.

    Genome annotation databases

    EnsembliENST00000378460; ENSP00000367721; ENSG00000030066. [Q12769-1]
    ENST00000526870; ENSP00000431495; ENSG00000030066. [Q12769-2]
    GeneIDi23279.
    KEGGihsa:23279.
    UCSCiuc001ngm.3. human. [Q12769-1]
    uc001ngn.1. human. [Q12769-2]

    Polymorphism databases

    DMDMi238054372.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK026236 mRNA. Translation: BAB15406.1 . Different initiation.
    AK302396 mRNA. Translation: BAG63710.1 .
    AK304308 mRNA. Translation: BAG65161.1 . Different initiation.
    AC021443 Genomic DNA. No translation available.
    AC023232 Genomic DNA. No translation available.
    BC008700 mRNA. Translation: AAH08700.1 .
    BC009822 mRNA. Translation: AAH09822.1 . Different initiation.
    BC125227 mRNA. Translation: AAI25228.1 .
    BC125228 mRNA. Translation: AAI25229.1 .
    D83781 mRNA. Translation: BAA12110.1 . Sequence problems.
    CCDSi CCDS31484.1. [Q12769-1 ]
    PIRi G02870.
    RefSeqi NP_056046.1. NM_015231.1. [Q12769-1 ]
    UniGenei Hs.744107.

    3D structure databases

    ProteinModelPortali Q12769.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 116879. 19 interactions.
    DIPi DIP-31262N.
    IntActi Q12769. 13 interactions.
    MINTi MINT-4301556.
    STRINGi 9606.ENSP00000367721.

    PTM databases

    PhosphoSitei Q12769.

    Polymorphism databases

    DMDMi 238054372.

    Proteomic databases

    MaxQBi Q12769.
    PaxDbi Q12769.
    PRIDEi Q12769.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000378460 ; ENSP00000367721 ; ENSG00000030066 . [Q12769-1 ]
    ENST00000526870 ; ENSP00000431495 ; ENSG00000030066 . [Q12769-2 ]
    GeneIDi 23279.
    KEGGi hsa:23279.
    UCSCi uc001ngm.3. human. [Q12769-1 ]
    uc001ngn.1. human. [Q12769-2 ]

    Organism-specific databases

    CTDi 23279.
    GeneCardsi GC11M048807.
    H-InvDB HIX0009624.
    HGNCi HGNC:18017. NUP160.
    MIMi 607614. gene.
    neXtProti NX_Q12769.
    PharmGKBi PA31850.
    HUGEi Search...
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG254492.
    HOVERGENi HBG052681.
    KOi K14303.
    OMAi MEMACSR.
    OrthoDBi EOG7B31MH.
    PhylomeDBi Q12769.
    TreeFami TF353082.

    Enzyme and pathway databases

    Reactomei REACT_115831. ISG15 antiviral mechanism.
    REACT_150425. Resolution of Sister Chromatid Cohesion.
    REACT_150471. Separation of Sister Chromatids.
    REACT_163931. Nuclear Pore Complex (NPC) Disassembly.
    REACT_6190. Rev-mediated nuclear export of HIV RNA.
    REACT_6804. Regulation of Glucokinase by Glucokinase Regulatory Protein.
    REACT_682. Mitotic Prometaphase.
    REACT_7991. Vpr-mediated nuclear import of PICs.
    REACT_9395. Nuclear import of Rev protein.

    Miscellaneous databases

    ChiTaRSi NUP160. human.
    GeneWikii NUP160.
    GenomeRNAii 23279.
    NextBioi 45070.
    PROi Q12769.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q12769.
    Bgeei Q12769.
    CleanExi HS_NUP160.
    Genevestigatori Q12769.

    Family and domain databases

    InterProi IPR021717. Nucleoporin_Nup160.
    [Graphical view ]
    Pfami PF11715. Nup160. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 31-1436 (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 32-1436 (ISOFORM 2), VARIANT THR-40.
      Tissue: Small intestine, Testis and Trachea.
    2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2), VARIANT ALA-351.
      Tissue: Muscle and Skin.
    4. "Prediction of the coding sequences of unidentified human genes. V. The coding sequences of 40 new genes (KIAA0161-KIAA0200) deduced by analysis of cDNA clones from human cell line KG-1."
      Nagase T., Seki N., Ishikawa K., Tanaka A., Nomura N.
      DNA Res. 3:17-24(1996) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 37-1436 (ISOFORM 1).
      Tissue: Bone marrow.
    5. "An evolutionarily conserved NPC subcomplex, which redistributes in part to kinetochores in mammalian cells."
      Belgareh N., Rabut G., Bai S.W., van Overbeek M., Beaudouin J., Daigle N., Zatsepina O.V., Pasteau F., Labas V., Fromont-Racine M., Ellenberg J., Doye V.
      J. Cell Biol. 154:1147-1160(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION, SUBUNIT, SUBCELLULAR LOCATION.
    6. "Novel vertebrate nucleoporins Nup133 and Nup160 play a role in mRNA export."
      Vasu S., Shah S., Orjalo A., Park M., Fischer W.H., Forbes D.J.
      J. Cell Biol. 155:339-354(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION, FUNCTION, SUBUNIT, SUBCELLULAR LOCATION.
    7. "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks."
      Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M.
      Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1157, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    8. "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle."
      Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M.
      Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1157, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    9. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1157, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    10. "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
      Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
      Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    11. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
      Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
      Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1157, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Leukemic T-cell.
    12. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
      Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
      Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1157, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    13. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    14. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
      Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
      Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1157, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    15. "Comparative large-scale characterisation of plant vs. mammal proteins reveals similar and idiosyncratic N-alpha acetylation features."
      Bienvenut W.V., Sumpton D., Martinez A., Lilla S., Espagne C., Meinnel T., Giglione C.
      Mol. Cell. Proteomics 11:M111.015131-M111.015131(2012) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    16. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

    Entry informationi

    Entry nameiNU160_HUMAN
    AccessioniPrimary (citable) accession number: Q12769
    Secondary accession number(s): B4DYE8
    , B4E2J9, Q08AD3, Q7Z5X6, Q96GB3, Q9H660
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: February 21, 2001
    Last sequence update: May 26, 2009
    Last modified: October 1, 2014
    This is version 140 of the entry and version 3 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Caution

    It is uncertain whether Met-1 or Met-35 is the initiator.Curated

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 11
      Human chromosome 11: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

    External Data

    Dasty 3