SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q12769

- NU160_HUMAN

UniProt

Q12769 - NU160_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Nuclear pore complex protein Nup160
Gene
NUP160, KIAA0197, NUP120
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Involved in poly(A)+ RNA transport.1 Publication

GO - Molecular functioni

  1. nucleocytoplasmic transporter activity Source: UniProtKB
  2. protein binding Source: UniProtKB

GO - Biological processi

  1. carbohydrate metabolic process Source: Reactome
  2. cytokine-mediated signaling pathway Source: Reactome
  3. glucose transport Source: Reactome
  4. hexose transport Source: Reactome
  5. mRNA export from nucleus Source: UniProtKB
  6. mitotic cell cycle Source: Reactome
  7. mitotic nuclear envelope disassembly Source: Reactome
  8. protein transport Source: UniProtKB-KW
  9. regulation of glucose transport Source: Reactome
  10. small molecule metabolic process Source: Reactome
  11. transmembrane transport Source: Reactome
  12. viral process Source: Reactome
Complete GO annotation...

Keywords - Biological processi

mRNA transport, Protein transport, Translocation, Transport

Enzyme and pathway databases

ReactomeiREACT_115831. ISG15 antiviral mechanism.
REACT_150425. Resolution of Sister Chromatid Cohesion.
REACT_150471. Separation of Sister Chromatids.
REACT_163931. Nuclear Pore Complex (NPC) Disassembly.
REACT_6190. Rev-mediated nuclear export of HIV RNA.
REACT_6804. Regulation of Glucokinase by Glucokinase Regulatory Protein.
REACT_682. Mitotic Prometaphase.
REACT_7991. Vpr-mediated nuclear import of PICs.
REACT_9395. Nuclear import of Rev protein.

Names & Taxonomyi

Protein namesi
Recommended name:
Nuclear pore complex protein Nup160
Alternative name(s):
160 kDa nucleoporin
Nucleoporin Nup160
Gene namesi
Name:NUP160
Synonyms:KIAA0197, NUP120
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 11

Organism-specific databases

HGNCiHGNC:18017. NUP160.

Subcellular locationi

Nucleusnuclear pore complex 2 Publications

GO - Cellular componenti

  1. cytosol Source: Reactome
  2. nuclear envelope Source: Reactome
  3. nuclear pore Source: UniProtKB
  4. nuclear pore outer ring Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Nuclear pore complex, Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA31850.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 14361436Nuclear pore complex protein Nup160
PRO_0000204851Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei1157 – 11571Phosphoserine6 Publications

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ12769.
PaxDbiQ12769.
PRIDEiQ12769.

PTM databases

PhosphoSiteiQ12769.

Expressioni

Gene expression databases

ArrayExpressiQ12769.
BgeeiQ12769.
CleanExiHS_NUP160.
GenevestigatoriQ12769.

Interactioni

Subunit structurei

Forms part of the Nup160 subcomplex in the nuclear pore which is composed of NUP160, NUP133, NUP107 and Nup96. This complex plays a role in RNA export and in tethering Nup98 and NUP153 to the nucleus.2 Publications

Protein-protein interaction databases

BioGridi116879. 19 interactions.
DIPiDIP-31262N.
IntActiQ12769. 13 interactions.
MINTiMINT-4301556.
STRINGi9606.ENSP00000367721.

Structurei

3D structure databases

ProteinModelPortaliQ12769.

Family & Domainsi

Phylogenomic databases

eggNOGiNOG254492.
HOVERGENiHBG052681.
KOiK14303.
OMAiMEMACSR.
OrthoDBiEOG7B31MH.
PhylomeDBiQ12769.
TreeFamiTF353082.

Family and domain databases

InterProiIPR021717. Nucleoporin_Nup160.
[Graphical view]
PfamiPF11715. Nup160. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q12769-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MLHLSAAPPA PPPEVTATAR PCLCSVGRRG DGGKMAAAGA LERSFVELSG     50
AERERPRHFR EFTVCSIGTA NAVAGAVKYS ESAGGFYYVE SGKLFSVTRN 100
RFIHWKTSGD TLELMEESLD INLLNNAIRL KFQNCSVLPG GVYVSETQNR 150
VIILMLTNQT VHRLLLPHPS RMYRSELVVD SQMQSIFTDI GKVDFTDPCN 200
YQLIPAVPGI SPNSTASTAW LSSDGEALFA LPCASGGIFV LKLPPYDIPG 250
MVSVVELKQS SVMQRLLTGW MPTAIRGDQS PSDRPLSLAV HCVEHDAFIF 300
ALCQDHKLRM WSYKEQMCLM VADMLEYVPV KKDLRLTAGT GHKLRLAYSP 350
TMGLYLGIYM HAPKRGQFCI FQLVSTESNR YSLDHISSLF TSQETLIDFA 400
LTSTDIWALW HDAENQTVVK YINFEHNVAG QWNPVFMQPL PEEEIVIRDD 450
QDPREMYLQS LFTPGQFTNE ALCKALQIFC RGTERNLDLS WSELKKEVTL 500
AVENELQGSV TEYEFSQEEF RNLQQEFWCK FYACCLQYQE ALSHPLALHL 550
NPHTNMVCLL KKGYLSFLIP SSLVDHLYLL PYENLLTEDE TTISDDVDIA 600
RDVICLIKCL RLIEESVTVD MSVIMEMSCY NLQSPEKAAE QILEDMITID 650
VENVMEDICS KLQEIRNPIH AIGLLIREMD YETEVEMEKG FNPAQPLNIR 700
MNLTQLYGSN TAGYIVCRGV HKIASTRFLI CRDLLILQQL LMRLGDAVIW 750
GTGQLFQAQQ DLLHRTAPLL LSYYLIKWGS ECLATDVPLD TLESNLQHLS 800
VLELTDSGAL MANRFVSSPQ TIVELFFQEV ARKHIISHLF SQPKAPLSQT 850
GLNWPEMITA ITSYLLQLLW PSNPGCLFLE CLMGNCQYVQ LQDYIQLLHP 900
WCQVNVGSCR FMLGRCYLVT GEGQKALECF CQAASEVGKE EFLDRLIRSE 950
DGEIVSTPRL QYYDKVLRLL DVIGLPELVI QLATSAITEA GDDWKSQATL 1000
RTCIFKHHLD LGHNSQAYEA LTQIPDSSRQ LDCLRQLVVV LCERSQLQDL 1050
VEFPYVNLHN EVVGIIESRA RAVDLMTHNY YELLYAFHIY RHNYRKAGTV 1100
MFEYGMRLGR EVRTLRGLEK QGNCYLAALN CLRLIRPEYA WIVQPVSGAV 1150
YDRPGASPKR NHDGECTAAP TNRQIEILEL EDLEKECSLA RIRLTLAQHD 1200
PSAVAVAGSS SAEEMVTLLV QAGLFDTAIS LCQTFKLPLT PVFEGLAFKC 1250
IKLQFGGEAA QAEAWAWLAA NQLSSVITTK ESSATDEAWR LLSTYLERYK 1300
VQNNLYHHCV INKLLSHGVP LPNWLINSYK KVDAAELLRL YLNYDLLEEA 1350
VDLVSEYVDA VLGKGHQYFG IEFPLSATAP MVWLPYSSID QLLQALGENS 1400
ANSHNIALSQ KILDKLEDYQ QKVDKATRDL LYRRTL 1436
Length:1,436
Mass (Da):162,121
Last modified:May 26, 2009 - v3
Checksum:i274C063A3CE69F48
GO
Isoform 2 (identifier: Q12769-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     175-224: SELVVDSQMQ...TASTAWLSSD → SVSWLSAISF...QAYFDSYRLK
     225-1436: Missing.

Show »
Length:224
Mass (Da):24,898
Checksum:iC98755EBCB0E1BC7
GO
Isoform 3 (identifier: Q12769-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-250: Missing.
     367-367: Q → QRRGFAMLPGLKLLSSSSPPTSASQCAGITSVNHSTQPEFF
     694-695: AQ → GK
     696-1436: Missing.

Show »
Length:485
Mass (Da):55,554
Checksum:i4650AE42B030DFBC
GO

Sequence cautioni

The sequence BAA12110.1 differs from that shown. Reason: Probable cloning artifact. Aberrant splice sites.
The sequence AAH09822.1 differs from that shown. Reason: Erroneous initiation.
The sequence BAB15406.1 differs from that shown. Reason: Erroneous initiation.
The sequence BAG65161.1 differs from that shown. Reason: Erroneous initiation.

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti40 – 401A → T.1 Publication
Corresponds to variant rs2305984 [ dbSNP | Ensembl ].
VAR_055409
Natural varianti351 – 3511T → A.1 Publication
Corresponds to variant rs3816605 [ dbSNP | Ensembl ].
VAR_055410

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 250250Missing in isoform 3.
VSP_037350Add
BLAST
Alternative sequencei175 – 22450SELVV…WLSSD → SVSWLSAISFISQITLGVTN VVLERCLLELKEIWILVIPH QAYFDSYRLK in isoform 2.
VSP_007093Add
BLAST
Alternative sequencei225 – 14361212Missing in isoform 2.
VSP_007094Add
BLAST
Alternative sequencei367 – 3671Q → QRRGFAMLPGLKLLSSSSPP TSASQCAGITSVNHSTQPEF F in isoform 3.
VSP_037351
Alternative sequencei694 – 6952AQ → GK in isoform 3.
VSP_037352
Alternative sequencei696 – 1436741Missing in isoform 3.
VSP_037353Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti152 – 1521I → K in BAG65161. 1 Publication
Sequence conflicti991 – 9911G → S in BAA12110. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK026236 mRNA. Translation: BAB15406.1. Different initiation.
AK302396 mRNA. Translation: BAG63710.1.
AK304308 mRNA. Translation: BAG65161.1. Different initiation.
AC021443 Genomic DNA. No translation available.
AC023232 Genomic DNA. No translation available.
BC008700 mRNA. Translation: AAH08700.1.
BC009822 mRNA. Translation: AAH09822.1. Different initiation.
BC125227 mRNA. Translation: AAI25228.1.
BC125228 mRNA. Translation: AAI25229.1.
D83781 mRNA. Translation: BAA12110.1. Sequence problems.
CCDSiCCDS31484.1. [Q12769-1]
PIRiG02870.
RefSeqiNP_056046.1. NM_015231.1. [Q12769-1]
UniGeneiHs.744107.

Genome annotation databases

EnsembliENST00000378460; ENSP00000367721; ENSG00000030066. [Q12769-1]
ENST00000526870; ENSP00000431495; ENSG00000030066. [Q12769-2]
GeneIDi23279.
KEGGihsa:23279.
UCSCiuc001ngm.3. human. [Q12769-1]
uc001ngn.1. human. [Q12769-2]

Polymorphism databases

DMDMi238054372.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK026236 mRNA. Translation: BAB15406.1 . Different initiation.
AK302396 mRNA. Translation: BAG63710.1 .
AK304308 mRNA. Translation: BAG65161.1 . Different initiation.
AC021443 Genomic DNA. No translation available.
AC023232 Genomic DNA. No translation available.
BC008700 mRNA. Translation: AAH08700.1 .
BC009822 mRNA. Translation: AAH09822.1 . Different initiation.
BC125227 mRNA. Translation: AAI25228.1 .
BC125228 mRNA. Translation: AAI25229.1 .
D83781 mRNA. Translation: BAA12110.1 . Sequence problems.
CCDSi CCDS31484.1. [Q12769-1 ]
PIRi G02870.
RefSeqi NP_056046.1. NM_015231.1. [Q12769-1 ]
UniGenei Hs.744107.

3D structure databases

ProteinModelPortali Q12769.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 116879. 19 interactions.
DIPi DIP-31262N.
IntActi Q12769. 13 interactions.
MINTi MINT-4301556.
STRINGi 9606.ENSP00000367721.

PTM databases

PhosphoSitei Q12769.

Polymorphism databases

DMDMi 238054372.

Proteomic databases

MaxQBi Q12769.
PaxDbi Q12769.
PRIDEi Q12769.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000378460 ; ENSP00000367721 ; ENSG00000030066 . [Q12769-1 ]
ENST00000526870 ; ENSP00000431495 ; ENSG00000030066 . [Q12769-2 ]
GeneIDi 23279.
KEGGi hsa:23279.
UCSCi uc001ngm.3. human. [Q12769-1 ]
uc001ngn.1. human. [Q12769-2 ]

Organism-specific databases

CTDi 23279.
GeneCardsi GC11M048807.
H-InvDB HIX0009624.
HGNCi HGNC:18017. NUP160.
MIMi 607614. gene.
neXtProti NX_Q12769.
PharmGKBi PA31850.
HUGEi Search...
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG254492.
HOVERGENi HBG052681.
KOi K14303.
OMAi MEMACSR.
OrthoDBi EOG7B31MH.
PhylomeDBi Q12769.
TreeFami TF353082.

Enzyme and pathway databases

Reactomei REACT_115831. ISG15 antiviral mechanism.
REACT_150425. Resolution of Sister Chromatid Cohesion.
REACT_150471. Separation of Sister Chromatids.
REACT_163931. Nuclear Pore Complex (NPC) Disassembly.
REACT_6190. Rev-mediated nuclear export of HIV RNA.
REACT_6804. Regulation of Glucokinase by Glucokinase Regulatory Protein.
REACT_682. Mitotic Prometaphase.
REACT_7991. Vpr-mediated nuclear import of PICs.
REACT_9395. Nuclear import of Rev protein.

Miscellaneous databases

ChiTaRSi NUP160. human.
GeneWikii NUP160.
GenomeRNAii 23279.
NextBioi 45070.
PROi Q12769.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q12769.
Bgeei Q12769.
CleanExi HS_NUP160.
Genevestigatori Q12769.

Family and domain databases

InterProi IPR021717. Nucleoporin_Nup160.
[Graphical view ]
Pfami PF11715. Nup160. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 31-1436 (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 32-1436 (ISOFORM 2), VARIANT THR-40.
    Tissue: Small intestine, Testis and Trachea.
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2), VARIANT ALA-351.
    Tissue: Muscle and Skin.
  4. "Prediction of the coding sequences of unidentified human genes. V. The coding sequences of 40 new genes (KIAA0161-KIAA0200) deduced by analysis of cDNA clones from human cell line KG-1."
    Nagase T., Seki N., Ishikawa K., Tanaka A., Nomura N.
    DNA Res. 3:17-24(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 37-1436 (ISOFORM 1).
    Tissue: Bone marrow.
  5. "An evolutionarily conserved NPC subcomplex, which redistributes in part to kinetochores in mammalian cells."
    Belgareh N., Rabut G., Bai S.W., van Overbeek M., Beaudouin J., Daigle N., Zatsepina O.V., Pasteau F., Labas V., Fromont-Racine M., Ellenberg J., Doye V.
    J. Cell Biol. 154:1147-1160(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION, SUBUNIT, SUBCELLULAR LOCATION.
  6. "Novel vertebrate nucleoporins Nup133 and Nup160 play a role in mRNA export."
    Vasu S., Shah S., Orjalo A., Park M., Fischer W.H., Forbes D.J.
    J. Cell Biol. 155:339-354(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION, FUNCTION, SUBUNIT, SUBCELLULAR LOCATION.
  7. "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks."
    Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M.
    Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1157, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  8. "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle."
    Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M.
    Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1157, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  9. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1157, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  10. "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
    Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
    Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  11. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
    Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
    Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1157, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Leukemic T-cell.
  12. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
    Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
    Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1157, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  13. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  14. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
    Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
    Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1157, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  15. "Comparative large-scale characterisation of plant vs. mammal proteins reveals similar and idiosyncratic N-alpha acetylation features."
    Bienvenut W.V., Sumpton D., Martinez A., Lilla S., Espagne C., Meinnel T., Giglione C.
    Mol. Cell. Proteomics 11:M111.015131-M111.015131(2012) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  16. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiNU160_HUMAN
AccessioniPrimary (citable) accession number: Q12769
Secondary accession number(s): B4DYE8
, B4E2J9, Q08AD3, Q7Z5X6, Q96GB3, Q9H660
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 21, 2001
Last sequence update: May 26, 2009
Last modified: September 3, 2014
This is version 139 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Caution

It is uncertain whether Met-1 or Met-35 is the initiator.

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

External Data

Dasty 3

Similar proteinsi