Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q11203

- SIAT6_HUMAN

UniProt

Q11203 - SIAT6_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase

Gene

ST3GAL3

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Catalyzes the formation of the NeuAc-alpha-2,3-Gal-beta-1,4-GlcNAc-, NeuAc-alpha-2,3-Gal-beta-1,3-GlcNAc- or NeuAc-alpha-2,3-Gal-beta-1,3-GalNAc- sequences found in terminal carbohydrate groups of glycoproteins and glycolipids. The highest activity is toward Gal-beta-1,3-GlcNAc and the lowest toward Gal-beta-1,3-GalNAc (By similarity).By similarity

Catalytic activityi

CMP-N-acetylneuraminate + beta-D-galactosyl-(1->4)-N-acetyl-D-glucosaminyl-glycoprotein = CMP + alpha-N-acetylneuraminyl-(2->3)-beta-D-galactosyl-(1->4)-N-acetyl-D-glucosaminyl-glycoprotein.

Pathwayi

GO - Molecular functioni

  1. beta-galactoside (CMP) alpha-2,3-sialyltransferase activity Source: Ensembl
  2. N-acetyllactosaminide alpha-2,3-sialyltransferase activity Source: ProtInc

GO - Biological processi

  1. carbohydrate metabolic process Source: Reactome
  2. cellular protein metabolic process Source: Reactome
  3. glycosaminoglycan metabolic process Source: Reactome
  4. keratan sulfate biosynthetic process Source: Reactome
  5. keratan sulfate metabolic process Source: Reactome
  6. O-glycan processing Source: Reactome
  7. post-translational protein modification Source: Reactome
  8. sialylation Source: GOC
  9. small molecule metabolic process Source: Reactome
Complete GO annotation...

Keywords - Molecular functioni

Glycosyltransferase, Transferase

Enzyme and pathway databases

BioCyciMetaCyc:HS04994-MONOMER.
ReactomeiREACT_115835. Termination of O-glycan biosynthesis.
REACT_118798. Pre-NOTCH Processing in Golgi.
REACT_121120. Keratan sulfate biosynthesis.
REACT_200874. Sialic acid metabolism.
UniPathwayiUPA00378.

Protein family/group databases

CAZyiGT29. Glycosyltransferase Family 29.

Names & Taxonomyi

Protein namesi
Recommended name:
CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase (EC:2.4.99.6)
Alternative name(s):
Beta-galactoside alpha-2,3-sialyltransferase 3
Short name:
Alpha 2,3-ST 3
Gal beta-1,3(4) GlcNAc alpha-2,3 sialyltransferase
N-acetyllactosaminide alpha-2,3-sialyltransferase
ST3Gal III
Short name:
ST3GalIII
ST3N
Sialyltransferase 6
Gene namesi
Name:ST3GAL3
Synonyms:SIAT6
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 1

Organism-specific databases

HGNCiHGNC:10866. ST3GAL3.

Subcellular locationi

Golgi apparatusGolgi stack membrane; Single-pass type II membrane protein. Secreted
Note: Membrane-bound form in trans cisternae of Golgi. Secreted into the body fluid.

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 88CytoplasmicSequence Analysis
Transmembranei9 – 2820Helical; Signal-anchor for type II membrane proteinSequence AnalysisAdd
BLAST
Topological domaini29 – 375347LumenalSequence AnalysisAdd
BLAST

GO - Cellular componenti

  1. extracellular region Source: UniProtKB-KW
  2. Golgi membrane Source: Reactome
  3. integral component of Golgi membrane Source: InterPro
Complete GO annotation...

Keywords - Cellular componenti

Golgi apparatus, Membrane, Secreted

Pathology & Biotechi

Involvement in diseasei

Mental retardation, autosomal recessive 12 (MRT12) [MIM:611090]: A disorder characterized by significantly below average general intellectual functioning associated with impairments in adaptive behavior and manifested during the developmental period.1 Publication
Note: The disease is caused by mutations affecting the gene represented in this entry.
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti13 – 131A → D in MRT12; most of the mutant protein is improperly localized to the endoplasmic reticulum preventing the protein from interacting with its substrates in the Golgi and resulting in a loss-of-function. 1 Publication
VAR_066594
Natural varianti370 – 3701D → Y in MRT12; the mutant protein is improperly localized to the endoplasmic reticulum preventing the protein from interacting with its substrates in the Golgi and resulting in a loss-of-function; shows a complete lack of enzyme activity; secretion of the mutant protein is dramatically reduced compared to wild-type. 1 Publication
VAR_066595
Epileptic encephalopathy, early infantile, 15 (EIEE15) [MIM:615006]: A form of epilepsy that manifests in the neonatal or the early infantile period as severely impaired cognitive and motor development, due to recurrent clinical seizures or prominent interictal epileptiform discharges. Patients develop infantile spasms, mainly of the flexor type, between 3 and 7 months of age, which are accompanied by hypsarrhythmia on EEG. Other features include poor eye contact, hypotonia, primitive reflexes, and irritability. Seizures evolve clinically to Lennox-Gastaut syndrome.1 Publication
Note: The disease is caused by mutations affecting the gene represented in this entry.
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti320 – 3201A → P in EIEE15. 1 Publication
VAR_069319

Keywords - Diseasei

Disease mutation, Epilepsy, Mental retardation

Organism-specific databases

MIMi611090. phenotype.
615006. phenotype.
Orphaneti88616. Autosomal recessive non-syndromic intellectual disability.
3451. West syndrome.
PharmGKBiPA35768.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 375375CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferasePRO_0000149266Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi80 – 801N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi160 ↔ 314By similarity
Glycosylationi171 – 1711N-linked (GlcNAc...)Sequence Analysis

Post-translational modificationi

The soluble form derives from the membrane form by proteolytic processing.

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiQ11203.
PRIDEiQ11203.

PTM databases

PhosphoSiteiQ11203.

Expressioni

Tissue specificityi

Highly expressed in adult skeletal muscle and in all fetal tissues examined and to a much lesser extent in placenta, lung and liver.

Gene expression databases

BgeeiQ11203.
ExpressionAtlasiQ11203. baseline and differential.
GenevestigatoriQ11203.

Organism-specific databases

HPAiHPA051102.

Interactioni

Protein-protein interaction databases

BioGridi112379. 4 interactions.
IntActiQ11203. 5 interactions.
MINTiMINT-1397196.

Structurei

3D structure databases

ProteinModelPortaliQ11203.
SMRiQ11203. Positions 111-339.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the glycosyltransferase 29 family.Curated

Keywords - Domaini

Signal-anchor, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG257001.
GeneTreeiENSGT00760000119095.
HOVERGENiHBG056676.
InParanoidiQ11203.
KOiK00781.
OMAiPRAKRNG.
PhylomeDBiQ11203.
TreeFamiTF354325.

Family and domain databases

InterProiIPR001675. Glyco_trans_29.
IPR012163. Sialyl_trans.
[Graphical view]
PfamiPF00777. Glyco_transf_29. 1 hit.
[Graphical view]
PIRSFiPIRSF005557. Sialyl_trans. 1 hit.

Sequences (26)i

Sequence statusi: Complete.

This entry describes 26 isoformsi produced by alternative splicing. Align

Isoform B1 (identifier: Q11203-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGLLVFVRNL LLALCLFLVL GFLYYSAWKL HLLQWEEDSN SVVLSFDSAG
60 70 80 90 100
QTLGSEYDRL GFLLNLDSKL PAELATKYAN FSEGACKPGY ASALMTAIFP
110 120 130 140 150
RFSKPAPMFL DDSFRKWARI REFVPPFGIK GQDNLIKAIL SVTKEYRLTP
160 170 180 190 200
ALDSLRCRRC IIVGNGGVLA NKSLGSRIDD YDIVVRLNSA PVKGFEKDVG
210 220 230 240 250
SKTTLRITYP EGAMQRPEQY ERDSLFVLAG FKWQDFKWLK YIVYKERVSA
260 270 280 290 300
SDGFWKSVAT RVPKEPPEIR ILNPYFIQEA AFTLIGLPFN NGLMGRGNIP
310 320 330 340 350
TLGSVAVTMA LHGCDEVAVA GFGYDMSTPN APLHYYETVR MAAIKESWTH
360 370
NIQREKEFLR KLVKARVITD LSSGI
Length:375
Mass (Da):42,171
Last modified:October 1, 1996 - v1
Checksum:iC9B7B61AD580EC2E
GO
Isoform A1 (identifier: Q11203-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     40-40: N → SKYSHSSSPQEKPVAD

Show »
Length:390
Mass (Da):43,786
Checksum:iDCBE59B0BFF74B3A
GO
Isoform A7 (identifier: Q11203-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     40-40: N → SKYSHSSSPQEKPVAD
     133-155: DNLIKAILSVTKEYRLTPALDSL → VLDAQYPARERVSAEAGESSRHH
     156-375: Missing.

Show »
Length:170
Mass (Da):19,043
Checksum:i73BE2801C40F2F9B
GO
Isoform A8 (identifier: Q11203-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     40-40: N → SKYSHSSSPQEKPVAD
     70-70: L → LSPRTLCTVVFGLDCILESPGEPKKLLMPASHPLEILKSLSEDTAFALGFLKLPR

Show »
Length:444
Mass (Da):49,649
Checksum:iEDFBE742E527970E
GO
Isoform B1-90 (identifier: Q11203-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     249-278: Missing.

Show »
Length:345
Mass (Da):38,742
Checksum:i0AA0ED4823826782
GO
Isoform B1+32 (identifier: Q11203-6) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     187-189: LNS → PRL
     190-375: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.

Show »
Length:189
Mass (Da):21,204
Checksum:i73A783656B89AAF0
GO
Isoform B3 (identifier: Q11203-7) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     71-101: Missing.

Show »
Length:344
Mass (Da):38,912
Checksum:i9BA97BCA7FA29E8A
GO
Isoform B4 (identifier: Q11203-8) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     249-346: Missing.

Show »
Length:277
Mass (Da):31,587
Checksum:i7C84EE03A5D6ABCE
GO
Isoform B4+173 (identifier: Q11203-9) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     102-115: FSKPAPMFLDDSFR → EKVRTFMAWLAWYG
     116-375: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.

Show »
Length:115
Mass (Da):12,969
Checksum:i933010B3A0B41729
GO
Isoform B5+26 (identifier: Q11203-10) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     187-375: Missing.

Show »
Length:186
Mass (Da):20,837
Checksum:iE56B89AAF01B90F8
GO
Isoform B5+173 (identifier: Q11203-11) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     102-121: FSKPAPMFLDDSFRKWARIR → AKRNGAWRQKHIQAYVLRQR
     122-375: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.

Show »
Length:121
Mass (Da):13,691
Checksum:i709ABCEF09B26251
GO
Isoform B7 (identifier: Q11203-12) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     133-155: DNLIKAILSVTKEYRLTPALDSL → VLDAQYPARERVSAEAGESSRHH
     156-375: Missing.

Show »
Length:155
Mass (Da):17,428
Checksum:iA881E409E96468F9
GO
Isoform B8 (identifier: Q11203-13) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     70-70: L → LSPRTLCTVVFGLDCILESPGEPKKLLMPASHPLEILKSLSEDTAFALGFLKLPR

Show »
Length:429
Mass (Da):48,034
Checksum:iDF45CA4E6D931B3D
GO
Isoform B10 (identifier: Q11203-14) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     133-151: DNLIKAILSVTKEYRLTPA → ECIGWLLEICGHSSAQGAP
     152-375: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.

Show »
Length:151
Mass (Da):16,834
Checksum:i8EF2DF5A045B8511
GO
Isoform C1 (identifier: Q11203-15) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     40-56: NSVVLSFDSAGQTLGSE → K

Show »
Length:359
Mass (Da):40,606
Checksum:i8A84C7FB0ABDD7C9
GO
Isoform C4 (identifier: Q11203-16) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     40-56: NSVVLSFDSAGQTLGSE → K
     249-346: Missing.

Show »
Length:261
Mass (Da):30,022
Checksum:i3DC939A6817E18B0
GO
Isoform C5 (identifier: Q11203-17) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     40-56: NSVVLSFDSAGQTLGSE → K
     186-202: RLNSAPVKGFEKDVGSK → SPGRTISSERKSFCGSW
     203-375: Missing.

Show »
Length:186
Mass (Da):20,984
Checksum:i1E7D22F363B85B30
GO
Isoform C7 (identifier: Q11203-18) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     40-56: NSVVLSFDSAGQTLGSE → K
     133-155: DNLIKAILSVTKEYRLTPALDSL → VLDAQYPARERVSAEAGESSRHH
     156-375: Missing.

Show »
Length:139
Mass (Da):15,863
Checksum:i04B51A49F74C6F42
GO
Isoform C8 (identifier: Q11203-19) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     40-56: NSVVLSFDSAGQTLGSE → K
     70-70: L → LSPRTLCTVVFGLDCILESPGEPKKLLMPASHPLEILKSLSEDTAFALGFLKLPR

Show »
Length:413
Mass (Da):46,469
Checksum:i1CD13FC0AEB4560D
GO
Isoform C9 (identifier: Q11203-20) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     40-56: NSVVLSFDSAGQTLGSE → K
     187-244: LNSAPVKGFE...DFKWLKYIVY → VHRMASGNLW...GTSLPLAVWQ
     245-375: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.

Show »
Length:228
Mass (Da):25,558
Checksum:i87D5C4311A1FE514
GO
Isoform C11 (identifier: Q11203-21) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     40-56: NSVVLSFDSAGQTLGSE → K
     71-101: Missing.
     249-346: Missing.

Show »
Length:230
Mass (Da):26,763
Checksum:i073EA4B17DC68FB0
GO
Isoform C12 (identifier: Q11203-22) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     40-56: NSVVLSFDSAGQTLGSE → K
     102-117: FSKPAPMFLDDSFRKW → PGRTISSERKSFCGSW
     118-375: Missing.

Show »
Length:101
Mass (Da):11,444
Checksum:i33196D8AF2BED686
GO
Isoform D2+26 (identifier: Q11203-23) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     40-55: NSVVLSFDSAGQTLGS → SKYSHSSSPQEKPVA
     187-375: Missing.

Show »
Length:185
Mass (Da):20,887
Checksum:iC50EA375D4F01821
GO
Isoform D5 (identifier: Q11203-24) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     40-55: NSVVLSFDSAGQTLGS → SKYSHSSSPQEKPVA
     186-202: RLNSAPVKGFEKDVGSK → SPGRTISSERKSFCGSW
     203-375: Missing.

Show »
Length:201
Mass (Da):22,598
Checksum:i14056E7DD7DD50AB
GO
Isoform E1 (identifier: Q11203-25) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     40-43: NSVV → SLLN
     44-375: Missing.

Show »
Length:43
Mass (Da):5,056
Checksum:i9E7CF581E6CD3813
GO
Isoform E3+32 (identifier: Q11203-26) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     40-73: NSVVLSFDSAGQTLGSEYDRLGFLLNLDSKLPAE → SSPSQHPCSWMTPFASGLESGSSCRLLGSKVKTI
     74-375: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.

Show »
Length:73
Mass (Da):8,178
Checksum:iDE5BE566E4BDF07D
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti38 – 381D → N in AAO38806. 1 PublicationCurated
Sequence conflicti94 – 941L → S in AAO38810. 1 PublicationCurated
Sequence conflicti123 – 1231F → L in AAO38810. 1 PublicationCurated
Sequence conflicti351 – 3511N → S in AAO38811. 1 PublicationCurated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti13 – 131A → D in MRT12; most of the mutant protein is improperly localized to the endoplasmic reticulum preventing the protein from interacting with its substrates in the Golgi and resulting in a loss-of-function. 1 Publication
VAR_066594
Natural varianti320 – 3201A → P in EIEE15. 1 Publication
VAR_069319
Natural varianti370 – 3701D → Y in MRT12; the mutant protein is improperly localized to the endoplasmic reticulum preventing the protein from interacting with its substrates in the Golgi and resulting in a loss-of-function; shows a complete lack of enzyme activity; secretion of the mutant protein is dramatically reduced compared to wild-type. 1 Publication
VAR_066595

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei40 – 7334NSVVL…KLPAE → SSPSQHPCSWMTPFASGLES GSSCRLLGSKVKTI in isoform E3+32. 1 PublicationVSP_010595Add
BLAST
Alternative sequencei40 – 5617NSVVL…TLGSE → K in isoform C1, isoform C4, isoform C5, isoform C7, isoform C8, isoform C9, isoform C11 and isoform C12. 2 PublicationsVSP_010594Add
BLAST
Alternative sequencei40 – 5516NSVVL…QTLGS → SKYSHSSSPQEKPVA in isoform D5 and isoform D2+26. 2 PublicationsVSP_010593Add
BLAST
Alternative sequencei40 – 434NSVV → SLLN in isoform E1. 1 PublicationVSP_010592
Alternative sequencei40 – 401N → SKYSHSSSPQEKPVAD in isoform A1, isoform A7 and isoform A8. 1 PublicationVSP_010591
Alternative sequencei44 – 375332Missing in isoform E1. 1 PublicationVSP_010596Add
BLAST
Alternative sequencei70 – 701L → LSPRTLCTVVFGLDCILESP GEPKKLLMPASHPLEILKSL SEDTAFALGFLKLPR in isoform A8, isoform B8 and isoform C8. 1 PublicationVSP_010597
Alternative sequencei71 – 10131Missing in isoform B3 and isoform C11. 2 PublicationsVSP_010598Add
BLAST
Alternative sequencei74 – 375302Missing in isoform E3+32. 1 PublicationVSP_010599Add
BLAST
Alternative sequencei102 – 12120FSKPA…WARIR → AKRNGAWRQKHIQAYVLRQR in isoform B5+173. 1 PublicationVSP_010602Add
BLAST
Alternative sequencei102 – 11716FSKPA…SFRKW → PGRTISSERKSFCGSW in isoform C12. 1 PublicationVSP_010601Add
BLAST
Alternative sequencei102 – 11514FSKPA…DDSFR → EKVRTFMAWLAWYG in isoform B4+173. 1 PublicationVSP_010600Add
BLAST
Alternative sequencei116 – 375260Missing in isoform B4+173. 1 PublicationVSP_010603Add
BLAST
Alternative sequencei118 – 375258Missing in isoform C12. 1 PublicationVSP_010604Add
BLAST
Alternative sequencei122 – 375254Missing in isoform B5+173. 1 PublicationVSP_010605Add
BLAST
Alternative sequencei133 – 15523DNLIK…ALDSL → VLDAQYPARERVSAEAGESS RHH in isoform A7, isoform B7 and isoform C7. 1 PublicationVSP_010607Add
BLAST
Alternative sequencei133 – 15119DNLIK…RLTPA → ECIGWLLEICGHSSAQGAP in isoform B10. 1 PublicationVSP_010606Add
BLAST
Alternative sequencei152 – 375224Missing in isoform B10. 1 PublicationVSP_010608Add
BLAST
Alternative sequencei156 – 375220Missing in isoform A7, isoform B7 and isoform C7. 1 PublicationVSP_010609Add
BLAST
Alternative sequencei186 – 20217RLNSA…DVGSK → SPGRTISSERKSFCGSW in isoform C5 and isoform D5. 1 PublicationVSP_010610Add
BLAST
Alternative sequencei187 – 375189Missing in isoform B5+26 and isoform D2+26. 1 PublicationVSP_010613Add
BLAST
Alternative sequencei187 – 24458LNSAP…KYIVY → VHRMASGNLWPLECPRSPLR FESSTHISSRRPPSPSLACP STMASWAGGTSLPLAVWQ in isoform C9. 1 PublicationVSP_010612Add
BLAST
Alternative sequencei187 – 1893LNS → PRL in isoform B1+32. 1 PublicationVSP_010611
Alternative sequencei190 – 375186Missing in isoform B1+32. 1 PublicationVSP_010614Add
BLAST
Alternative sequencei203 – 375173Missing in isoform C5 and isoform D5. 1 PublicationVSP_010615Add
BLAST
Alternative sequencei245 – 375131Missing in isoform C9. 1 PublicationVSP_010616Add
BLAST
Alternative sequencei249 – 34698Missing in isoform B4, isoform C4 and isoform C11. 2 PublicationsVSP_010618Add
BLAST
Alternative sequencei249 – 27830Missing in isoform B1-90. 1 PublicationVSP_010617Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L23768 mRNA. Translation: AAA35778.1.
AF425851 mRNA. Translation: AAO13859.1.
AF425852 mRNA. Translation: AAO13860.1.
AF425853 mRNA. Translation: AAO13861.1.
AF425854 mRNA. Translation: AAO13862.1.
AF425855 mRNA. Translation: AAO13863.1.
AF425856 mRNA. Translation: AAO13864.1.
AF425857 mRNA. Translation: AAO13865.1.
AF425858 mRNA. Translation: AAO13866.1.
AF425859 mRNA. Translation: AAO13867.1.
AF425860 mRNA. Translation: AAO13868.1.
AF425861 mRNA. Translation: AAO13869.1.
AF425862 mRNA. Translation: AAO13870.1.
AF425863 mRNA. Translation: AAO13871.1.
AF425864 mRNA. Translation: AAO13872.1.
AF425865 mRNA. Translation: AAO13873.1.
AF425866 mRNA. Translation: AAO13874.1.
AF425867 mRNA. Translation: AAO13875.1.
AF425868 mRNA. Translation: AAO13876.1.
AF425869 mRNA. Translation: AAO13877.1.
AY167992 mRNA. Translation: AAO38806.1.
AY167993 mRNA. Translation: AAO38807.1.
AY167994 mRNA. Translation: AAO38808.1.
AY167995 mRNA. Translation: AAO38809.1.
AY167996 mRNA. Translation: AAO38810.1.
AY167997 mRNA. Translation: AAO38811.1.
AY167998 mRNA. Translation: AAO38812.1.
AL451062, AL357079, AL592548 Genomic DNA. Translation: CAH71022.1.
AL451062, AL357079, AL592548 Genomic DNA. Translation: CAH71023.1.
AL451062, AL357079, AL592548 Genomic DNA. Translation: CAH71024.1.
AL451062, AL357079, AL592548 Genomic DNA. Translation: CAH71025.1.
AL451062, AL357079, AL592548 Genomic DNA. Translation: CAH71027.1.
AL451062, AL357079, AL592548 Genomic DNA. Translation: CAH71028.1.
AL451062, AL357079, AL592548 Genomic DNA. Translation: CAH71029.1.
AL451062, AL357079, AL592548 Genomic DNA. Translation: CAH71031.1.
AL451062, AL357079, AL592548 Genomic DNA. Translation: CAH71032.1.
AL451062, AL357079, AL592548 Genomic DNA. Translation: CAH71033.1.
AL357079, AL451062, AL592548 Genomic DNA. Translation: CAI16785.1.
AL357079, AL451062, AL592548 Genomic DNA. Translation: CAI16786.1.
AL357079, AL451062, AL592548 Genomic DNA. Translation: CAI16787.1.
AL357079, AL451062, AL592548 Genomic DNA. Translation: CAI16789.1.
AL357079, AL451062, AL592548 Genomic DNA. Translation: CAI16790.1.
AL357079, AL451062, AL592548 Genomic DNA. Translation: CAI16791.1.
AL357079, AL451062, AL592548 Genomic DNA. Translation: CAI16792.1.
AL357079, AL451062, AL592548 Genomic DNA. Translation: CAI16793.1.
AL357079, AL451062, AL592548 Genomic DNA. Translation: CAI16794.1.
AL357079, AL451062, AL592548 Genomic DNA. Translation: CAI16795.1.
AL592548, AL357079, AL451062 Genomic DNA. Translation: CAI22181.1.
AL592548, AL357079, AL451062 Genomic DNA. Translation: CAI22182.1.
AL592548, AL357079, AL451062 Genomic DNA. Translation: CAI22183.1.
AL592548, AL357079, AL451062 Genomic DNA. Translation: CAI22184.1.
AL592548, AL357079, AL451062 Genomic DNA. Translation: CAI22186.1.
AL592548, AL357079, AL451062 Genomic DNA. Translation: CAI22188.1.
AL592548, AL357079, AL451062 Genomic DNA. Translation: CAI22189.1.
AL592548, AL357079, AL451062 Genomic DNA. Translation: CAI22190.1.
AL592548, AL357079, AL451062 Genomic DNA. Translation: CAI22191.1.
AL592548, AL357079, AL451062 Genomic DNA. Translation: CAI22192.1.
CH471059 Genomic DNA. Translation: EAX07082.1.
CH471059 Genomic DNA. Translation: EAX07083.1.
BC050380 mRNA. Translation: AAH50380.1.
CCDSiCCDS492.1. [Q11203-1]
CCDS493.1. [Q11203-4]
CCDS494.1. [Q11203-2]
CCDS495.1. [Q11203-8]
CCDS496.1. [Q11203-13]
CCDS497.1. [Q11203-15]
CCDS498.1. [Q11203-19]
CCDS499.1. [Q11203-3]
CCDS500.1. [Q11203-12]
CCDS53310.1. [Q11203-18]
CCDS57988.1. [Q11203-5]
CCDS57989.1. [Q11203-7]
CCDS57990.1. [Q11203-16]
CCDS57991.1. [Q11203-17]
CCDS57992.1. [Q11203-22]
CCDS57993.1. [Q11203-24]
CCDS57994.1. [Q11203-23]
PIRiJN0618.
RefSeqiNP_001257388.1. NM_001270459.1. [Q11203-5]
NP_001257389.1. NM_001270460.1. [Q11203-7]
NP_001257390.1. NM_001270461.1. [Q11203-16]
NP_001257391.1. NM_001270462.1. [Q11203-21]
NP_001257392.1. NM_001270463.1. [Q11203-24]
NP_001257393.1. NM_001270464.1. [Q11203-17]
NP_001257394.1. NM_001270465.1. [Q11203-23]
NP_001257395.1. NM_001270466.1. [Q11203-22]
NP_006270.1. NM_006279.3. [Q11203-1]
NP_777623.2. NM_174963.3. [Q11203-4]
NP_777624.1. NM_174964.2. [Q11203-2]
NP_777625.1. NM_174965.2. [Q11203-3]
NP_777626.1. NM_174966.2. [Q11203-8]
NP_777627.1. NM_174967.2. [Q11203-12]
NP_777628.2. NM_174968.3. [Q11203-13]
NP_777629.1. NM_174969.2. [Q11203-15]
NP_777630.1. NM_174970.2. [Q11203-18]
NP_777631.2. NM_174971.3. [Q11203-19]
UniGeneiHs.597915.

Genome annotation databases

EnsembliENST00000262915; ENSP00000262915; ENSG00000126091. [Q11203-4]
ENST00000330208; ENSP00000333494; ENSG00000126091. [Q11203-22]
ENST00000332628; ENSP00000329755; ENSG00000126091. [Q11203-7]
ENST00000335430; ENSP00000335633; ENSG00000126091. [Q11203-23]
ENST00000347631; ENSP00000317192; ENSG00000126091. [Q11203-2]
ENST00000351035; ENSP00000316999; ENSG00000126091. [Q11203-19]
ENST00000353126; ENSP00000330463; ENSG00000126091. [Q11203-8]
ENST00000361392; ENSP00000355341; ENSG00000126091. [Q11203-1]
ENST00000361400; ENSP00000354748; ENSG00000126091. [Q11203-15]
ENST00000361746; ENSP00000354657; ENSG00000126091. [Q11203-4]
ENST00000361812; ENSP00000355201; ENSG00000126091. [Q11203-3]
ENST00000372362; ENSP00000361437; ENSG00000126091. [Q11203-12]
ENST00000372365; ENSP00000361440; ENSG00000126091. [Q11203-10]
ENST00000372366; ENSP00000361441; ENSG00000126091. [Q11203-23]
ENST00000372367; ENSP00000361442; ENSG00000126091. [Q11203-24]
ENST00000372368; ENSP00000361443; ENSG00000126091. [Q11203-13]
ENST00000372369; ENSP00000361444; ENSG00000126091. [Q11203-5]
ENST00000372372; ENSP00000361447; ENSG00000126091. [Q11203-19]
ENST00000372374; ENSP00000361449; ENSG00000126091. [Q11203-7]
ENST00000469715; ENSP00000431700; ENSG00000126091. [Q11203-6]
ENST00000489897; ENSP00000437206; ENSG00000126091. [Q11203-11]
ENST00000490541; ENSP00000435018; ENSG00000126091. [Q11203-26]
ENST00000528371; ENSP00000434876; ENSG00000126091. [Q11203-17]
ENST00000530581; ENSP00000437293; ENSG00000126091. [Q11203-20]
ENST00000531451; ENSP00000435603; ENSG00000126091. [Q11203-18]
ENST00000531816; ENSP00000434378; ENSG00000126091. [Q11203-22]
ENST00000531993; ENSP00000432682; ENSG00000126091. [Q11203-16]
ENST00000533212; ENSP00000435621; ENSG00000126091. [Q11203-14]
ENST00000533933; ENSP00000432965; ENSG00000126091. [Q11203-8]
ENST00000533997; ENSP00000432071; ENSG00000126091. [Q11203-9]
ENST00000545417; ENSP00000439634; ENSG00000126091. [Q11203-3]
GeneIDi6487.
KEGGihsa:6487.
UCSCiuc001cka.4. human. [Q11203-18]
uc001ckb.4. human. [Q11203-4]
uc001ckc.4. human. [Q11203-1]
uc001ckd.4. human. [Q11203-13]
uc001cke.4. human. [Q11203-15]
uc001ckf.4. human. [Q11203-19]
uc001ckg.4. human. [Q11203-8]
uc001cki.4. human. [Q11203-12]
uc001ckk.4. human. [Q11203-7]
uc001ckl.4. human. [Q11203-10]
uc001ckm.4. human. [Q11203-23]
uc001cko.4. human. [Q11203-16]
uc001ckp.4. human. [Q11203-24]
uc001ckq.4. human. [Q11203-17]
uc001ckr.4. human. [Q11203-21]
uc009vwv.4. human. [Q11203-5]
uc009vxb.4. human. [Q11203-22]

Polymorphism databases

DMDMi1705561.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Web resourcesi

GGDB

GlycoGene database

Functional Glycomics Gateway - GTase

ST3Gal III

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L23768 mRNA. Translation: AAA35778.1 .
AF425851 mRNA. Translation: AAO13859.1 .
AF425852 mRNA. Translation: AAO13860.1 .
AF425853 mRNA. Translation: AAO13861.1 .
AF425854 mRNA. Translation: AAO13862.1 .
AF425855 mRNA. Translation: AAO13863.1 .
AF425856 mRNA. Translation: AAO13864.1 .
AF425857 mRNA. Translation: AAO13865.1 .
AF425858 mRNA. Translation: AAO13866.1 .
AF425859 mRNA. Translation: AAO13867.1 .
AF425860 mRNA. Translation: AAO13868.1 .
AF425861 mRNA. Translation: AAO13869.1 .
AF425862 mRNA. Translation: AAO13870.1 .
AF425863 mRNA. Translation: AAO13871.1 .
AF425864 mRNA. Translation: AAO13872.1 .
AF425865 mRNA. Translation: AAO13873.1 .
AF425866 mRNA. Translation: AAO13874.1 .
AF425867 mRNA. Translation: AAO13875.1 .
AF425868 mRNA. Translation: AAO13876.1 .
AF425869 mRNA. Translation: AAO13877.1 .
AY167992 mRNA. Translation: AAO38806.1 .
AY167993 mRNA. Translation: AAO38807.1 .
AY167994 mRNA. Translation: AAO38808.1 .
AY167995 mRNA. Translation: AAO38809.1 .
AY167996 mRNA. Translation: AAO38810.1 .
AY167997 mRNA. Translation: AAO38811.1 .
AY167998 mRNA. Translation: AAO38812.1 .
AL451062 , AL357079 , AL592548 Genomic DNA. Translation: CAH71022.1 .
AL451062 , AL357079 , AL592548 Genomic DNA. Translation: CAH71023.1 .
AL451062 , AL357079 , AL592548 Genomic DNA. Translation: CAH71024.1 .
AL451062 , AL357079 , AL592548 Genomic DNA. Translation: CAH71025.1 .
AL451062 , AL357079 , AL592548 Genomic DNA. Translation: CAH71027.1 .
AL451062 , AL357079 , AL592548 Genomic DNA. Translation: CAH71028.1 .
AL451062 , AL357079 , AL592548 Genomic DNA. Translation: CAH71029.1 .
AL451062 , AL357079 , AL592548 Genomic DNA. Translation: CAH71031.1 .
AL451062 , AL357079 , AL592548 Genomic DNA. Translation: CAH71032.1 .
AL451062 , AL357079 , AL592548 Genomic DNA. Translation: CAH71033.1 .
AL357079 , AL451062 , AL592548 Genomic DNA. Translation: CAI16785.1 .
AL357079 , AL451062 , AL592548 Genomic DNA. Translation: CAI16786.1 .
AL357079 , AL451062 , AL592548 Genomic DNA. Translation: CAI16787.1 .
AL357079 , AL451062 , AL592548 Genomic DNA. Translation: CAI16789.1 .
AL357079 , AL451062 , AL592548 Genomic DNA. Translation: CAI16790.1 .
AL357079 , AL451062 , AL592548 Genomic DNA. Translation: CAI16791.1 .
AL357079 , AL451062 , AL592548 Genomic DNA. Translation: CAI16792.1 .
AL357079 , AL451062 , AL592548 Genomic DNA. Translation: CAI16793.1 .
AL357079 , AL451062 , AL592548 Genomic DNA. Translation: CAI16794.1 .
AL357079 , AL451062 , AL592548 Genomic DNA. Translation: CAI16795.1 .
AL592548 , AL357079 , AL451062 Genomic DNA. Translation: CAI22181.1 .
AL592548 , AL357079 , AL451062 Genomic DNA. Translation: CAI22182.1 .
AL592548 , AL357079 , AL451062 Genomic DNA. Translation: CAI22183.1 .
AL592548 , AL357079 , AL451062 Genomic DNA. Translation: CAI22184.1 .
AL592548 , AL357079 , AL451062 Genomic DNA. Translation: CAI22186.1 .
AL592548 , AL357079 , AL451062 Genomic DNA. Translation: CAI22188.1 .
AL592548 , AL357079 , AL451062 Genomic DNA. Translation: CAI22189.1 .
AL592548 , AL357079 , AL451062 Genomic DNA. Translation: CAI22190.1 .
AL592548 , AL357079 , AL451062 Genomic DNA. Translation: CAI22191.1 .
AL592548 , AL357079 , AL451062 Genomic DNA. Translation: CAI22192.1 .
CH471059 Genomic DNA. Translation: EAX07082.1 .
CH471059 Genomic DNA. Translation: EAX07083.1 .
BC050380 mRNA. Translation: AAH50380.1 .
CCDSi CCDS492.1. [Q11203-1 ]
CCDS493.1. [Q11203-4 ]
CCDS494.1. [Q11203-2 ]
CCDS495.1. [Q11203-8 ]
CCDS496.1. [Q11203-13 ]
CCDS497.1. [Q11203-15 ]
CCDS498.1. [Q11203-19 ]
CCDS499.1. [Q11203-3 ]
CCDS500.1. [Q11203-12 ]
CCDS53310.1. [Q11203-18 ]
CCDS57988.1. [Q11203-5 ]
CCDS57989.1. [Q11203-7 ]
CCDS57990.1. [Q11203-16 ]
CCDS57991.1. [Q11203-17 ]
CCDS57992.1. [Q11203-22 ]
CCDS57993.1. [Q11203-24 ]
CCDS57994.1. [Q11203-23 ]
PIRi JN0618.
RefSeqi NP_001257388.1. NM_001270459.1. [Q11203-5 ]
NP_001257389.1. NM_001270460.1. [Q11203-7 ]
NP_001257390.1. NM_001270461.1. [Q11203-16 ]
NP_001257391.1. NM_001270462.1. [Q11203-21 ]
NP_001257392.1. NM_001270463.1. [Q11203-24 ]
NP_001257393.1. NM_001270464.1. [Q11203-17 ]
NP_001257394.1. NM_001270465.1. [Q11203-23 ]
NP_001257395.1. NM_001270466.1. [Q11203-22 ]
NP_006270.1. NM_006279.3. [Q11203-1 ]
NP_777623.2. NM_174963.3. [Q11203-4 ]
NP_777624.1. NM_174964.2. [Q11203-2 ]
NP_777625.1. NM_174965.2. [Q11203-3 ]
NP_777626.1. NM_174966.2. [Q11203-8 ]
NP_777627.1. NM_174967.2. [Q11203-12 ]
NP_777628.2. NM_174968.3. [Q11203-13 ]
NP_777629.1. NM_174969.2. [Q11203-15 ]
NP_777630.1. NM_174970.2. [Q11203-18 ]
NP_777631.2. NM_174971.3. [Q11203-19 ]
UniGenei Hs.597915.

3D structure databases

ProteinModelPortali Q11203.
SMRi Q11203. Positions 111-339.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 112379. 4 interactions.
IntActi Q11203. 5 interactions.
MINTi MINT-1397196.

Protein family/group databases

CAZyi GT29. Glycosyltransferase Family 29.

PTM databases

PhosphoSitei Q11203.

Polymorphism databases

DMDMi 1705561.

Proteomic databases

PaxDbi Q11203.
PRIDEi Q11203.

Protocols and materials databases

DNASUi 6487.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000262915 ; ENSP00000262915 ; ENSG00000126091 . [Q11203-4 ]
ENST00000330208 ; ENSP00000333494 ; ENSG00000126091 . [Q11203-22 ]
ENST00000332628 ; ENSP00000329755 ; ENSG00000126091 . [Q11203-7 ]
ENST00000335430 ; ENSP00000335633 ; ENSG00000126091 . [Q11203-23 ]
ENST00000347631 ; ENSP00000317192 ; ENSG00000126091 . [Q11203-2 ]
ENST00000351035 ; ENSP00000316999 ; ENSG00000126091 . [Q11203-19 ]
ENST00000353126 ; ENSP00000330463 ; ENSG00000126091 . [Q11203-8 ]
ENST00000361392 ; ENSP00000355341 ; ENSG00000126091 . [Q11203-1 ]
ENST00000361400 ; ENSP00000354748 ; ENSG00000126091 . [Q11203-15 ]
ENST00000361746 ; ENSP00000354657 ; ENSG00000126091 . [Q11203-4 ]
ENST00000361812 ; ENSP00000355201 ; ENSG00000126091 . [Q11203-3 ]
ENST00000372362 ; ENSP00000361437 ; ENSG00000126091 . [Q11203-12 ]
ENST00000372365 ; ENSP00000361440 ; ENSG00000126091 . [Q11203-10 ]
ENST00000372366 ; ENSP00000361441 ; ENSG00000126091 . [Q11203-23 ]
ENST00000372367 ; ENSP00000361442 ; ENSG00000126091 . [Q11203-24 ]
ENST00000372368 ; ENSP00000361443 ; ENSG00000126091 . [Q11203-13 ]
ENST00000372369 ; ENSP00000361444 ; ENSG00000126091 . [Q11203-5 ]
ENST00000372372 ; ENSP00000361447 ; ENSG00000126091 . [Q11203-19 ]
ENST00000372374 ; ENSP00000361449 ; ENSG00000126091 . [Q11203-7 ]
ENST00000469715 ; ENSP00000431700 ; ENSG00000126091 . [Q11203-6 ]
ENST00000489897 ; ENSP00000437206 ; ENSG00000126091 . [Q11203-11 ]
ENST00000490541 ; ENSP00000435018 ; ENSG00000126091 . [Q11203-26 ]
ENST00000528371 ; ENSP00000434876 ; ENSG00000126091 . [Q11203-17 ]
ENST00000530581 ; ENSP00000437293 ; ENSG00000126091 . [Q11203-20 ]
ENST00000531451 ; ENSP00000435603 ; ENSG00000126091 . [Q11203-18 ]
ENST00000531816 ; ENSP00000434378 ; ENSG00000126091 . [Q11203-22 ]
ENST00000531993 ; ENSP00000432682 ; ENSG00000126091 . [Q11203-16 ]
ENST00000533212 ; ENSP00000435621 ; ENSG00000126091 . [Q11203-14 ]
ENST00000533933 ; ENSP00000432965 ; ENSG00000126091 . [Q11203-8 ]
ENST00000533997 ; ENSP00000432071 ; ENSG00000126091 . [Q11203-9 ]
ENST00000545417 ; ENSP00000439634 ; ENSG00000126091 . [Q11203-3 ]
GeneIDi 6487.
KEGGi hsa:6487.
UCSCi uc001cka.4. human. [Q11203-18 ]
uc001ckb.4. human. [Q11203-4 ]
uc001ckc.4. human. [Q11203-1 ]
uc001ckd.4. human. [Q11203-13 ]
uc001cke.4. human. [Q11203-15 ]
uc001ckf.4. human. [Q11203-19 ]
uc001ckg.4. human. [Q11203-8 ]
uc001cki.4. human. [Q11203-12 ]
uc001ckk.4. human. [Q11203-7 ]
uc001ckl.4. human. [Q11203-10 ]
uc001ckm.4. human. [Q11203-23 ]
uc001cko.4. human. [Q11203-16 ]
uc001ckp.4. human. [Q11203-24 ]
uc001ckq.4. human. [Q11203-17 ]
uc001ckr.4. human. [Q11203-21 ]
uc009vwv.4. human. [Q11203-5 ]
uc009vxb.4. human. [Q11203-22 ]

Organism-specific databases

CTDi 6487.
GeneCardsi GC01P044173.
HGNCi HGNC:10866. ST3GAL3.
HPAi HPA051102.
MIMi 606494. gene.
611090. phenotype.
615006. phenotype.
neXtProti NX_Q11203.
Orphaneti 88616. Autosomal recessive non-syndromic intellectual disability.
3451. West syndrome.
PharmGKBi PA35768.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG257001.
GeneTreei ENSGT00760000119095.
HOVERGENi HBG056676.
InParanoidi Q11203.
KOi K00781.
OMAi PRAKRNG.
PhylomeDBi Q11203.
TreeFami TF354325.

Enzyme and pathway databases

UniPathwayi UPA00378 .
BioCyci MetaCyc:HS04994-MONOMER.
Reactomei REACT_115835. Termination of O-glycan biosynthesis.
REACT_118798. Pre-NOTCH Processing in Golgi.
REACT_121120. Keratan sulfate biosynthesis.
REACT_200874. Sialic acid metabolism.

Miscellaneous databases

ChiTaRSi ST3GAL3. human.
GeneWikii ST3GAL3.
GenomeRNAii 6487.
NextBioi 25195.
PROi Q11203.
SOURCEi Search...

Gene expression databases

Bgeei Q11203.
ExpressionAtlasi Q11203. baseline and differential.
Genevestigatori Q11203.

Family and domain databases

InterProi IPR001675. Glyco_trans_29.
IPR012163. Sialyl_trans.
[Graphical view ]
Pfami PF00777. Glyco_transf_29. 1 hit.
[Graphical view ]
PIRSFi PIRSF005557. Sialyl_trans. 1 hit.
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Cloning and expression of human Gal beta 1,3(4)GlcNAc alpha 2,3-sialyltransferase."
    Kitagawa H., Paulson J.C.
    Biochem. Biophys. Res. Commun. 194:375-382(1993) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM B1).
    Tissue: Placenta.
  2. "Structural variations of the alpha 2,3-sialyltransferase III, ST3GalIII, transcripts in human peripheral white blood cells."
    Grahn A., Larson G.
    Submitted (SEP-2001) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS A1; A7; A8; B1; B1-90; B1+32; B3; B4; B4+173; B5+26; B5+173; B7; B8; C1; C7; C8; D2+26; E1 AND E3+32).
  3. "Structural variations of the alpha 2,3-sialyltransferase III, ST3GalIII, transcripts in human fetal brain."
    Grahn A., Larson G.
    Submitted (OCT-2002) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS B10; C4; C5; C9; C11; C12 AND D5).
    Tissue: Fetal brain.
  4. "The DNA sequence and biological annotation of human chromosome 1."
    Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
    , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
    Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM B1).
    Tissue: Brain.
  7. Cited for: VARIANTS MRT12 ASP-13 AND TYR-370, CHARACTERIZATION OF VARIANTS MRT12 ASP-13 AND TYR-370.
  8. Cited for: VARIANT EIEE15 PRO-320, CHARACTERIZATION OF VARIANT EIEE15 PRO-320.

Entry informationi

Entry nameiSIAT6_HUMAN
AccessioniPrimary (citable) accession number: Q11203
Secondary accession number(s): A9Z1W2
, D3DPX8, Q5T4W9, Q5T4X0, Q5T4X7, Q5T4X8, Q5T4X9, Q5T4Y0, Q5T4Y2, Q5T4Y3, Q5T4Y4, Q86UR6, Q86UR7, Q86UR8, Q86UR9, Q86US0, Q86US1, Q86US2, Q8IX41, Q8IX42, Q8IX43, Q8IX44, Q8IX45, Q8IX46, Q8IX47, Q8IX48, Q8IX49, Q8IX50, Q8IX51, Q8IX52, Q8IX53, Q8IX54, Q8IX55, Q8IX56, Q8IX57, Q8IX58
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 1, 1996
Last sequence update: October 1, 1996
Last modified: October 29, 2014
This is version 139 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3