Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q11203

- SIAT6_HUMAN

UniProt

Q11203 - SIAT6_HUMAN

Protein

CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase

Gene

ST3GAL3

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 138 (01 Oct 2014)
      Sequence version 1 (01 Oct 1996)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Catalyzes the formation of the NeuAc-alpha-2,3-Gal-beta-1,4-GlcNAc-, NeuAc-alpha-2,3-Gal-beta-1,3-GlcNAc- or NeuAc-alpha-2,3-Gal-beta-1,3-GalNAc- sequences found in terminal carbohydrate groups of glycoproteins and glycolipids. The highest activity is toward Gal-beta-1,3-GlcNAc and the lowest toward Gal-beta-1,3-GalNAc By similarity.By similarity

    Catalytic activityi

    CMP-N-acetylneuraminate + beta-D-galactosyl-(1->4)-N-acetyl-D-glucosaminyl-glycoprotein = CMP + alpha-N-acetylneuraminyl-(2->3)-beta-D-galactosyl-(1->4)-N-acetyl-D-glucosaminyl-glycoprotein.

    Pathwayi

    GO - Molecular functioni

    1. beta-galactoside (CMP) alpha-2,3-sialyltransferase activity Source: Ensembl
    2. N-acetyllactosaminide alpha-2,3-sialyltransferase activity Source: ProtInc

    GO - Biological processi

    1. carbohydrate metabolic process Source: Reactome
    2. cellular protein metabolic process Source: Reactome
    3. glycosaminoglycan metabolic process Source: Reactome
    4. keratan sulfate biosynthetic process Source: Reactome
    5. keratan sulfate metabolic process Source: Reactome
    6. O-glycan processing Source: Reactome
    7. post-translational protein modification Source: Reactome
    8. sialylation Source: GOC
    9. small molecule metabolic process Source: Reactome

    Keywords - Molecular functioni

    Glycosyltransferase, Transferase

    Enzyme and pathway databases

    BioCyciMetaCyc:HS04994-MONOMER.
    ReactomeiREACT_115835. Termination of O-glycan biosynthesis.
    REACT_118798. Pre-NOTCH Processing in Golgi.
    REACT_121120. Keratan sulfate biosynthesis.
    REACT_200874. Sialic acid metabolism.
    UniPathwayiUPA00378.

    Protein family/group databases

    CAZyiGT29. Glycosyltransferase Family 29.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase (EC:2.4.99.6)
    Alternative name(s):
    Beta-galactoside alpha-2,3-sialyltransferase 3
    Short name:
    Alpha 2,3-ST 3
    Gal beta-1,3(4) GlcNAc alpha-2,3 sialyltransferase
    N-acetyllactosaminide alpha-2,3-sialyltransferase
    ST3Gal III
    Short name:
    ST3GalIII
    ST3N
    Sialyltransferase 6
    Gene namesi
    Name:ST3GAL3
    Synonyms:SIAT6
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 1

    Organism-specific databases

    HGNCiHGNC:10866. ST3GAL3.

    Subcellular locationi

    Golgi apparatusGolgi stack membrane; Single-pass type II membrane protein. Secreted
    Note: Membrane-bound form in trans cisternae of Golgi. Secreted into the body fluid.

    GO - Cellular componenti

    1. extracellular region Source: UniProtKB-SubCell
    2. Golgi cisterna membrane Source: UniProtKB-SubCell
    3. Golgi membrane Source: Reactome
    4. integral component of Golgi membrane Source: InterPro

    Keywords - Cellular componenti

    Golgi apparatus, Membrane, Secreted

    Pathology & Biotechi

    Involvement in diseasei

    Mental retardation, autosomal recessive 12 (MRT12) [MIM:611090]: A disorder characterized by significantly below average general intellectual functioning associated with impairments in adaptive behavior and manifested during the developmental period.1 Publication
    Note: The disease is caused by mutations affecting the gene represented in this entry.
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti13 – 131A → D in MRT12; most of the mutant protein is improperly localized to the endoplasmic reticulum preventing the protein from interacting with its substrates in the Golgi and resulting in a loss-of-function. 1 Publication
    VAR_066594
    Natural varianti370 – 3701D → Y in MRT12; the mutant protein is improperly localized to the endoplasmic reticulum preventing the protein from interacting with its substrates in the Golgi and resulting in a loss-of-function; shows a complete lack of enzyme activity; secretion of the mutant protein is dramatically reduced compared to wild-type. 1 Publication
    VAR_066595
    Epileptic encephalopathy, early infantile, 15 (EIEE15) [MIM:615006]: A form of epilepsy that manifests in the neonatal or the early infantile period as severely impaired cognitive and motor development, due to recurrent clinical seizures or prominent interictal epileptiform discharges. Patients develop infantile spasms, mainly of the flexor type, between 3 and 7 months of age, which are accompanied by hypsarrhythmia on EEG. Other features include poor eye contact, hypotonia, primitive reflexes, and irritability. Seizures evolve clinically to Lennox-Gastaut syndrome.1 Publication
    Note: The disease is caused by mutations affecting the gene represented in this entry.
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti320 – 3201A → P in EIEE15. 1 Publication
    VAR_069319

    Keywords - Diseasei

    Disease mutation, Epilepsy, Mental retardation

    Organism-specific databases

    MIMi611090. phenotype.
    615006. phenotype.
    Orphaneti88616. Autosomal recessive nonsyndromic intellectual disability.
    3451. West syndrome.
    PharmGKBiPA35768.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 375375CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferasePRO_0000149266Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi80 – 801N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi160 ↔ 314By similarity
    Glycosylationi171 – 1711N-linked (GlcNAc...)Sequence Analysis

    Post-translational modificationi

    The soluble form derives from the membrane form by proteolytic processing.

    Keywords - PTMi

    Disulfide bond, Glycoprotein

    Proteomic databases

    PaxDbiQ11203.
    PRIDEiQ11203.

    PTM databases

    PhosphoSiteiQ11203.

    Expressioni

    Tissue specificityi

    Highly expressed in adult skeletal muscle and in all fetal tissues examined and to a much lesser extent in placenta, lung and liver.

    Gene expression databases

    ArrayExpressiQ11203.
    BgeeiQ11203.
    GenevestigatoriQ11203.

    Organism-specific databases

    HPAiHPA051102.

    Interactioni

    Protein-protein interaction databases

    BioGridi112379. 4 interactions.
    IntActiQ11203. 5 interactions.
    MINTiMINT-1397196.

    Structurei

    3D structure databases

    ProteinModelPortaliQ11203.
    SMRiQ11203. Positions 111-339.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini1 – 88CytoplasmicSequence Analysis
    Topological domaini29 – 375347LumenalSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei9 – 2820Helical; Signal-anchor for type II membrane proteinSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the glycosyltransferase 29 family.Curated

    Keywords - Domaini

    Signal-anchor, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG257001.
    HOVERGENiHBG056676.
    KOiK00781.
    OMAiPRAKRNG.
    PhylomeDBiQ11203.
    TreeFamiTF354325.

    Family and domain databases

    InterProiIPR001675. Glyco_trans_29.
    IPR012163. Sialyl_trans.
    [Graphical view]
    PfamiPF00777. Glyco_transf_29. 1 hit.
    [Graphical view]
    PIRSFiPIRSF005557. Sialyl_trans. 1 hit.

    Sequences (26)i

    Sequence statusi: Complete.

    This entry describes 26 isoformsi produced by alternative splicing. Align

    Isoform B1 (identifier: Q11203-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MGLLVFVRNL LLALCLFLVL GFLYYSAWKL HLLQWEEDSN SVVLSFDSAG    50
    QTLGSEYDRL GFLLNLDSKL PAELATKYAN FSEGACKPGY ASALMTAIFP 100
    RFSKPAPMFL DDSFRKWARI REFVPPFGIK GQDNLIKAIL SVTKEYRLTP 150
    ALDSLRCRRC IIVGNGGVLA NKSLGSRIDD YDIVVRLNSA PVKGFEKDVG 200
    SKTTLRITYP EGAMQRPEQY ERDSLFVLAG FKWQDFKWLK YIVYKERVSA 250
    SDGFWKSVAT RVPKEPPEIR ILNPYFIQEA AFTLIGLPFN NGLMGRGNIP 300
    TLGSVAVTMA LHGCDEVAVA GFGYDMSTPN APLHYYETVR MAAIKESWTH 350
    NIQREKEFLR KLVKARVITD LSSGI 375
    Length:375
    Mass (Da):42,171
    Last modified:October 1, 1996 - v1
    Checksum:iC9B7B61AD580EC2E
    GO
    Isoform A1 (identifier: Q11203-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         40-40: N → SKYSHSSSPQEKPVAD

    Show »
    Length:390
    Mass (Da):43,786
    Checksum:iDCBE59B0BFF74B3A
    GO
    Isoform A7 (identifier: Q11203-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         40-40: N → SKYSHSSSPQEKPVAD
         133-155: DNLIKAILSVTKEYRLTPALDSL → VLDAQYPARERVSAEAGESSRHH
         156-375: Missing.

    Show »
    Length:170
    Mass (Da):19,043
    Checksum:i73BE2801C40F2F9B
    GO
    Isoform A8 (identifier: Q11203-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         40-40: N → SKYSHSSSPQEKPVAD
         70-70: L → LSPRTLCTVVFGLDCILESPGEPKKLLMPASHPLEILKSLSEDTAFALGFLKLPR

    Show »
    Length:444
    Mass (Da):49,649
    Checksum:iEDFBE742E527970E
    GO
    Isoform B1-90 (identifier: Q11203-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         249-278: Missing.

    Show »
    Length:345
    Mass (Da):38,742
    Checksum:i0AA0ED4823826782
    GO
    Isoform B1+32 (identifier: Q11203-6) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         187-189: LNS → PRL
         190-375: Missing.

    Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.

    Show »
    Length:189
    Mass (Da):21,204
    Checksum:i73A783656B89AAF0
    GO
    Isoform B3 (identifier: Q11203-7) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         71-101: Missing.

    Show »
    Length:344
    Mass (Da):38,912
    Checksum:i9BA97BCA7FA29E8A
    GO
    Isoform B4 (identifier: Q11203-8) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         249-346: Missing.

    Show »
    Length:277
    Mass (Da):31,587
    Checksum:i7C84EE03A5D6ABCE
    GO
    Isoform B4+173 (identifier: Q11203-9) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         102-115: FSKPAPMFLDDSFR → EKVRTFMAWLAWYG
         116-375: Missing.

    Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.

    Show »
    Length:115
    Mass (Da):12,969
    Checksum:i933010B3A0B41729
    GO
    Isoform B5+26 (identifier: Q11203-10) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         187-375: Missing.

    Show »
    Length:186
    Mass (Da):20,837
    Checksum:iE56B89AAF01B90F8
    GO
    Isoform B5+173 (identifier: Q11203-11) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         102-121: FSKPAPMFLDDSFRKWARIR → AKRNGAWRQKHIQAYVLRQR
         122-375: Missing.

    Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.

    Show »
    Length:121
    Mass (Da):13,691
    Checksum:i709ABCEF09B26251
    GO
    Isoform B7 (identifier: Q11203-12) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         133-155: DNLIKAILSVTKEYRLTPALDSL → VLDAQYPARERVSAEAGESSRHH
         156-375: Missing.

    Show »
    Length:155
    Mass (Da):17,428
    Checksum:iA881E409E96468F9
    GO
    Isoform B8 (identifier: Q11203-13) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         70-70: L → LSPRTLCTVVFGLDCILESPGEPKKLLMPASHPLEILKSLSEDTAFALGFLKLPR

    Show »
    Length:429
    Mass (Da):48,034
    Checksum:iDF45CA4E6D931B3D
    GO
    Isoform B10 (identifier: Q11203-14) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         133-151: DNLIKAILSVTKEYRLTPA → ECIGWLLEICGHSSAQGAP
         152-375: Missing.

    Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.

    Show »
    Length:151
    Mass (Da):16,834
    Checksum:i8EF2DF5A045B8511
    GO
    Isoform C1 (identifier: Q11203-15) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         40-56: NSVVLSFDSAGQTLGSE → K

    Show »
    Length:359
    Mass (Da):40,606
    Checksum:i8A84C7FB0ABDD7C9
    GO
    Isoform C4 (identifier: Q11203-16) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         40-56: NSVVLSFDSAGQTLGSE → K
         249-346: Missing.

    Show »
    Length:261
    Mass (Da):30,022
    Checksum:i3DC939A6817E18B0
    GO
    Isoform C5 (identifier: Q11203-17) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         40-56: NSVVLSFDSAGQTLGSE → K
         186-202: RLNSAPVKGFEKDVGSK → SPGRTISSERKSFCGSW
         203-375: Missing.

    Show »
    Length:186
    Mass (Da):20,984
    Checksum:i1E7D22F363B85B30
    GO
    Isoform C7 (identifier: Q11203-18) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         40-56: NSVVLSFDSAGQTLGSE → K
         133-155: DNLIKAILSVTKEYRLTPALDSL → VLDAQYPARERVSAEAGESSRHH
         156-375: Missing.

    Show »
    Length:139
    Mass (Da):15,863
    Checksum:i04B51A49F74C6F42
    GO
    Isoform C8 (identifier: Q11203-19) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         40-56: NSVVLSFDSAGQTLGSE → K
         70-70: L → LSPRTLCTVVFGLDCILESPGEPKKLLMPASHPLEILKSLSEDTAFALGFLKLPR

    Show »
    Length:413
    Mass (Da):46,469
    Checksum:i1CD13FC0AEB4560D
    GO
    Isoform C9 (identifier: Q11203-20) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         40-56: NSVVLSFDSAGQTLGSE → K
         187-244: LNSAPVKGFE...DFKWLKYIVY → VHRMASGNLW...GTSLPLAVWQ
         245-375: Missing.

    Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.

    Show »
    Length:228
    Mass (Da):25,558
    Checksum:i87D5C4311A1FE514
    GO
    Isoform C11 (identifier: Q11203-21) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         40-56: NSVVLSFDSAGQTLGSE → K
         71-101: Missing.
         249-346: Missing.

    Show »
    Length:230
    Mass (Da):26,763
    Checksum:i073EA4B17DC68FB0
    GO
    Isoform C12 (identifier: Q11203-22) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         40-56: NSVVLSFDSAGQTLGSE → K
         102-117: FSKPAPMFLDDSFRKW → PGRTISSERKSFCGSW
         118-375: Missing.

    Show »
    Length:101
    Mass (Da):11,444
    Checksum:i33196D8AF2BED686
    GO
    Isoform D2+26 (identifier: Q11203-23) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         40-55: NSVVLSFDSAGQTLGS → SKYSHSSSPQEKPVA
         187-375: Missing.

    Show »
    Length:185
    Mass (Da):20,887
    Checksum:iC50EA375D4F01821
    GO
    Isoform D5 (identifier: Q11203-24) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         40-55: NSVVLSFDSAGQTLGS → SKYSHSSSPQEKPVA
         186-202: RLNSAPVKGFEKDVGSK → SPGRTISSERKSFCGSW
         203-375: Missing.

    Show »
    Length:201
    Mass (Da):22,598
    Checksum:i14056E7DD7DD50AB
    GO
    Isoform E1 (identifier: Q11203-25) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         40-43: NSVV → SLLN
         44-375: Missing.

    Show »
    Length:43
    Mass (Da):5,056
    Checksum:i9E7CF581E6CD3813
    GO
    Isoform E3+32 (identifier: Q11203-26) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         40-73: NSVVLSFDSAGQTLGSEYDRLGFLLNLDSKLPAE → SSPSQHPCSWMTPFASGLESGSSCRLLGSKVKTI
         74-375: Missing.

    Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.

    Show »
    Length:73
    Mass (Da):8,178
    Checksum:iDE5BE566E4BDF07D
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti38 – 381D → N in AAO38806. 1 PublicationCurated
    Sequence conflicti94 – 941L → S in AAO38810. 1 PublicationCurated
    Sequence conflicti123 – 1231F → L in AAO38810. 1 PublicationCurated
    Sequence conflicti351 – 3511N → S in AAO38811. 1 PublicationCurated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti13 – 131A → D in MRT12; most of the mutant protein is improperly localized to the endoplasmic reticulum preventing the protein from interacting with its substrates in the Golgi and resulting in a loss-of-function. 1 Publication
    VAR_066594
    Natural varianti320 – 3201A → P in EIEE15. 1 Publication
    VAR_069319
    Natural varianti370 – 3701D → Y in MRT12; the mutant protein is improperly localized to the endoplasmic reticulum preventing the protein from interacting with its substrates in the Golgi and resulting in a loss-of-function; shows a complete lack of enzyme activity; secretion of the mutant protein is dramatically reduced compared to wild-type. 1 Publication
    VAR_066595

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei40 – 7334NSVVL…KLPAE → SSPSQHPCSWMTPFASGLES GSSCRLLGSKVKTI in isoform E3+32. 1 PublicationVSP_010595Add
    BLAST
    Alternative sequencei40 – 5617NSVVL…TLGSE → K in isoform C1, isoform C4, isoform C5, isoform C7, isoform C8, isoform C9, isoform C11 and isoform C12. 2 PublicationsVSP_010594Add
    BLAST
    Alternative sequencei40 – 5516NSVVL…QTLGS → SKYSHSSSPQEKPVA in isoform D5 and isoform D2+26. 2 PublicationsVSP_010593Add
    BLAST
    Alternative sequencei40 – 434NSVV → SLLN in isoform E1. 1 PublicationVSP_010592
    Alternative sequencei40 – 401N → SKYSHSSSPQEKPVAD in isoform A1, isoform A7 and isoform A8. 1 PublicationVSP_010591
    Alternative sequencei44 – 375332Missing in isoform E1. 1 PublicationVSP_010596Add
    BLAST
    Alternative sequencei70 – 701L → LSPRTLCTVVFGLDCILESP GEPKKLLMPASHPLEILKSL SEDTAFALGFLKLPR in isoform A8, isoform B8 and isoform C8. 1 PublicationVSP_010597
    Alternative sequencei71 – 10131Missing in isoform B3 and isoform C11. 2 PublicationsVSP_010598Add
    BLAST
    Alternative sequencei74 – 375302Missing in isoform E3+32. 1 PublicationVSP_010599Add
    BLAST
    Alternative sequencei102 – 12120FSKPA…WARIR → AKRNGAWRQKHIQAYVLRQR in isoform B5+173. 1 PublicationVSP_010602Add
    BLAST
    Alternative sequencei102 – 11716FSKPA…SFRKW → PGRTISSERKSFCGSW in isoform C12. 1 PublicationVSP_010601Add
    BLAST
    Alternative sequencei102 – 11514FSKPA…DDSFR → EKVRTFMAWLAWYG in isoform B4+173. 1 PublicationVSP_010600Add
    BLAST
    Alternative sequencei116 – 375260Missing in isoform B4+173. 1 PublicationVSP_010603Add
    BLAST
    Alternative sequencei118 – 375258Missing in isoform C12. 1 PublicationVSP_010604Add
    BLAST
    Alternative sequencei122 – 375254Missing in isoform B5+173. 1 PublicationVSP_010605Add
    BLAST
    Alternative sequencei133 – 15523DNLIK…ALDSL → VLDAQYPARERVSAEAGESS RHH in isoform A7, isoform B7 and isoform C7. 1 PublicationVSP_010607Add
    BLAST
    Alternative sequencei133 – 15119DNLIK…RLTPA → ECIGWLLEICGHSSAQGAP in isoform B10. 1 PublicationVSP_010606Add
    BLAST
    Alternative sequencei152 – 375224Missing in isoform B10. 1 PublicationVSP_010608Add
    BLAST
    Alternative sequencei156 – 375220Missing in isoform A7, isoform B7 and isoform C7. 1 PublicationVSP_010609Add
    BLAST
    Alternative sequencei186 – 20217RLNSA…DVGSK → SPGRTISSERKSFCGSW in isoform C5 and isoform D5. 1 PublicationVSP_010610Add
    BLAST
    Alternative sequencei187 – 375189Missing in isoform B5+26 and isoform D2+26. 1 PublicationVSP_010613Add
    BLAST
    Alternative sequencei187 – 24458LNSAP…KYIVY → VHRMASGNLWPLECPRSPLR FESSTHISSRRPPSPSLACP STMASWAGGTSLPLAVWQ in isoform C9. 1 PublicationVSP_010612Add
    BLAST
    Alternative sequencei187 – 1893LNS → PRL in isoform B1+32. 1 PublicationVSP_010611
    Alternative sequencei190 – 375186Missing in isoform B1+32. 1 PublicationVSP_010614Add
    BLAST
    Alternative sequencei203 – 375173Missing in isoform C5 and isoform D5. 1 PublicationVSP_010615Add
    BLAST
    Alternative sequencei245 – 375131Missing in isoform C9. 1 PublicationVSP_010616Add
    BLAST
    Alternative sequencei249 – 34698Missing in isoform B4, isoform C4 and isoform C11. 2 PublicationsVSP_010618Add
    BLAST
    Alternative sequencei249 – 27830Missing in isoform B1-90. 1 PublicationVSP_010617Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    L23768 mRNA. Translation: AAA35778.1.
    AF425851 mRNA. Translation: AAO13859.1.
    AF425852 mRNA. Translation: AAO13860.1.
    AF425853 mRNA. Translation: AAO13861.1.
    AF425854 mRNA. Translation: AAO13862.1.
    AF425855 mRNA. Translation: AAO13863.1.
    AF425856 mRNA. Translation: AAO13864.1.
    AF425857 mRNA. Translation: AAO13865.1.
    AF425858 mRNA. Translation: AAO13866.1.
    AF425859 mRNA. Translation: AAO13867.1.
    AF425860 mRNA. Translation: AAO13868.1.
    AF425861 mRNA. Translation: AAO13869.1.
    AF425862 mRNA. Translation: AAO13870.1.
    AF425863 mRNA. Translation: AAO13871.1.
    AF425864 mRNA. Translation: AAO13872.1.
    AF425865 mRNA. Translation: AAO13873.1.
    AF425866 mRNA. Translation: AAO13874.1.
    AF425867 mRNA. Translation: AAO13875.1.
    AF425868 mRNA. Translation: AAO13876.1.
    AF425869 mRNA. Translation: AAO13877.1.
    AY167992 mRNA. Translation: AAO38806.1.
    AY167993 mRNA. Translation: AAO38807.1.
    AY167994 mRNA. Translation: AAO38808.1.
    AY167995 mRNA. Translation: AAO38809.1.
    AY167996 mRNA. Translation: AAO38810.1.
    AY167997 mRNA. Translation: AAO38811.1.
    AY167998 mRNA. Translation: AAO38812.1.
    AL451062, AL357079, AL592548 Genomic DNA. Translation: CAH71022.1.
    AL451062, AL357079, AL592548 Genomic DNA. Translation: CAH71023.1.
    AL451062, AL357079, AL592548 Genomic DNA. Translation: CAH71024.1.
    AL451062, AL357079, AL592548 Genomic DNA. Translation: CAH71025.1.
    AL451062, AL357079, AL592548 Genomic DNA. Translation: CAH71027.1.
    AL451062, AL357079, AL592548 Genomic DNA. Translation: CAH71028.1.
    AL451062, AL357079, AL592548 Genomic DNA. Translation: CAH71029.1.
    AL451062, AL357079, AL592548 Genomic DNA. Translation: CAH71031.1.
    AL451062, AL357079, AL592548 Genomic DNA. Translation: CAH71032.1.
    AL451062, AL357079, AL592548 Genomic DNA. Translation: CAH71033.1.
    AL357079, AL451062, AL592548 Genomic DNA. Translation: CAI16785.1.
    AL357079, AL451062, AL592548 Genomic DNA. Translation: CAI16786.1.
    AL357079, AL451062, AL592548 Genomic DNA. Translation: CAI16787.1.
    AL357079, AL451062, AL592548 Genomic DNA. Translation: CAI16789.1.
    AL357079, AL451062, AL592548 Genomic DNA. Translation: CAI16790.1.
    AL357079, AL451062, AL592548 Genomic DNA. Translation: CAI16791.1.
    AL357079, AL451062, AL592548 Genomic DNA. Translation: CAI16792.1.
    AL357079, AL451062, AL592548 Genomic DNA. Translation: CAI16793.1.
    AL357079, AL451062, AL592548 Genomic DNA. Translation: CAI16794.1.
    AL357079, AL451062, AL592548 Genomic DNA. Translation: CAI16795.1.
    AL592548, AL357079, AL451062 Genomic DNA. Translation: CAI22181.1.
    AL592548, AL357079, AL451062 Genomic DNA. Translation: CAI22182.1.
    AL592548, AL357079, AL451062 Genomic DNA. Translation: CAI22183.1.
    AL592548, AL357079, AL451062 Genomic DNA. Translation: CAI22184.1.
    AL592548, AL357079, AL451062 Genomic DNA. Translation: CAI22186.1.
    AL592548, AL357079, AL451062 Genomic DNA. Translation: CAI22188.1.
    AL592548, AL357079, AL451062 Genomic DNA. Translation: CAI22189.1.
    AL592548, AL357079, AL451062 Genomic DNA. Translation: CAI22190.1.
    AL592548, AL357079, AL451062 Genomic DNA. Translation: CAI22191.1.
    AL592548, AL357079, AL451062 Genomic DNA. Translation: CAI22192.1.
    CH471059 Genomic DNA. Translation: EAX07082.1.
    CH471059 Genomic DNA. Translation: EAX07083.1.
    BC050380 mRNA. Translation: AAH50380.1.
    CCDSiCCDS492.1. [Q11203-1]
    CCDS493.1. [Q11203-4]
    CCDS494.1. [Q11203-2]
    CCDS495.1. [Q11203-8]
    CCDS496.1. [Q11203-13]
    CCDS497.1. [Q11203-15]
    CCDS498.1. [Q11203-19]
    CCDS499.1. [Q11203-3]
    CCDS500.1. [Q11203-12]
    CCDS53310.1. [Q11203-18]
    CCDS57988.1. [Q11203-5]
    CCDS57989.1. [Q11203-7]
    CCDS57990.1. [Q11203-16]
    CCDS57991.1. [Q11203-17]
    CCDS57992.1. [Q11203-22]
    CCDS57993.1. [Q11203-24]
    CCDS57994.1. [Q11203-23]
    PIRiJN0618.
    RefSeqiNP_001257388.1. NM_001270459.1. [Q11203-5]
    NP_001257389.1. NM_001270460.1. [Q11203-7]
    NP_001257390.1. NM_001270461.1. [Q11203-16]
    NP_001257391.1. NM_001270462.1. [Q11203-21]
    NP_001257392.1. NM_001270463.1. [Q11203-24]
    NP_001257393.1. NM_001270464.1. [Q11203-17]
    NP_001257394.1. NM_001270465.1. [Q11203-23]
    NP_001257395.1. NM_001270466.1. [Q11203-22]
    NP_006270.1. NM_006279.3. [Q11203-1]
    NP_777623.2. NM_174963.3. [Q11203-4]
    NP_777624.1. NM_174964.2. [Q11203-2]
    NP_777625.1. NM_174965.2. [Q11203-3]
    NP_777626.1. NM_174966.2. [Q11203-8]
    NP_777627.1. NM_174967.2. [Q11203-12]
    NP_777628.2. NM_174968.3. [Q11203-13]
    NP_777629.1. NM_174969.2. [Q11203-15]
    NP_777630.1. NM_174970.2. [Q11203-18]
    NP_777631.2. NM_174971.3. [Q11203-19]
    UniGeneiHs.597915.

    Genome annotation databases

    EnsembliENST00000262915; ENSP00000262915; ENSG00000126091. [Q11203-4]
    ENST00000330208; ENSP00000333494; ENSG00000126091. [Q11203-12]
    ENST00000332628; ENSP00000329755; ENSG00000126091. [Q11203-7]
    ENST00000335430; ENSP00000335633; ENSG00000126091. [Q11203-20]
    ENST00000347631; ENSP00000317192; ENSG00000126091. [Q11203-2]
    ENST00000351035; ENSP00000316999; ENSG00000126091. [Q11203-19]
    ENST00000353126; ENSP00000330463; ENSG00000126091. [Q11203-8]
    ENST00000361392; ENSP00000355341; ENSG00000126091. [Q11203-1]
    ENST00000361400; ENSP00000354748; ENSG00000126091. [Q11203-15]
    ENST00000361746; ENSP00000354657; ENSG00000126091. [Q11203-4]
    ENST00000361812; ENSP00000355201; ENSG00000126091. [Q11203-3]
    ENST00000372362; ENSP00000361437; ENSG00000126091. [Q11203-12]
    ENST00000372365; ENSP00000361440; ENSG00000126091. [Q11203-10]
    ENST00000372366; ENSP00000361441; ENSG00000126091. [Q11203-23]
    ENST00000372367; ENSP00000361442; ENSG00000126091. [Q11203-24]
    ENST00000372368; ENSP00000361443; ENSG00000126091. [Q11203-13]
    ENST00000372369; ENSP00000361444; ENSG00000126091. [Q11203-5]
    ENST00000372372; ENSP00000361447; ENSG00000126091. [Q11203-19]
    ENST00000372374; ENSP00000361449; ENSG00000126091. [Q11203-7]
    ENST00000469715; ENSP00000431700; ENSG00000126091. [Q11203-6]
    ENST00000489897; ENSP00000437206; ENSG00000126091. [Q11203-11]
    ENST00000490541; ENSP00000435018; ENSG00000126091. [Q11203-26]
    ENST00000528371; ENSP00000434876; ENSG00000126091. [Q11203-17]
    ENST00000530581; ENSP00000437293; ENSG00000126091. [Q11203-20]
    ENST00000531451; ENSP00000435603; ENSG00000126091. [Q11203-18]
    ENST00000531816; ENSP00000434378; ENSG00000126091. [Q11203-22]
    ENST00000531993; ENSP00000432682; ENSG00000126091. [Q11203-16]
    ENST00000533212; ENSP00000435621; ENSG00000126091. [Q11203-14]
    ENST00000533933; ENSP00000432965; ENSG00000126091. [Q11203-8]
    ENST00000533997; ENSP00000432071; ENSG00000126091. [Q11203-9]
    ENST00000545417; ENSP00000439634; ENSG00000126091. [Q11203-3]
    GeneIDi6487.
    KEGGihsa:6487.
    UCSCiuc001cka.4. human. [Q11203-18]
    uc001ckb.4. human. [Q11203-4]
    uc001ckc.4. human. [Q11203-1]
    uc001ckd.4. human. [Q11203-13]
    uc001cke.4. human. [Q11203-15]
    uc001ckf.4. human. [Q11203-19]
    uc001ckg.4. human. [Q11203-8]
    uc001cki.4. human. [Q11203-12]
    uc001ckk.4. human. [Q11203-7]
    uc001ckl.4. human. [Q11203-10]
    uc001ckm.4. human. [Q11203-23]
    uc001cko.4. human. [Q11203-16]
    uc001ckp.4. human. [Q11203-24]
    uc001ckq.4. human. [Q11203-17]
    uc001ckr.4. human. [Q11203-21]
    uc009vwv.4. human. [Q11203-5]
    uc009vxb.4. human. [Q11203-22]

    Polymorphism databases

    DMDMi1705561.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Web resourcesi

    GGDB

    GlycoGene database

    Functional Glycomics Gateway - GTase

    ST3Gal III

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    L23768 mRNA. Translation: AAA35778.1 .
    AF425851 mRNA. Translation: AAO13859.1 .
    AF425852 mRNA. Translation: AAO13860.1 .
    AF425853 mRNA. Translation: AAO13861.1 .
    AF425854 mRNA. Translation: AAO13862.1 .
    AF425855 mRNA. Translation: AAO13863.1 .
    AF425856 mRNA. Translation: AAO13864.1 .
    AF425857 mRNA. Translation: AAO13865.1 .
    AF425858 mRNA. Translation: AAO13866.1 .
    AF425859 mRNA. Translation: AAO13867.1 .
    AF425860 mRNA. Translation: AAO13868.1 .
    AF425861 mRNA. Translation: AAO13869.1 .
    AF425862 mRNA. Translation: AAO13870.1 .
    AF425863 mRNA. Translation: AAO13871.1 .
    AF425864 mRNA. Translation: AAO13872.1 .
    AF425865 mRNA. Translation: AAO13873.1 .
    AF425866 mRNA. Translation: AAO13874.1 .
    AF425867 mRNA. Translation: AAO13875.1 .
    AF425868 mRNA. Translation: AAO13876.1 .
    AF425869 mRNA. Translation: AAO13877.1 .
    AY167992 mRNA. Translation: AAO38806.1 .
    AY167993 mRNA. Translation: AAO38807.1 .
    AY167994 mRNA. Translation: AAO38808.1 .
    AY167995 mRNA. Translation: AAO38809.1 .
    AY167996 mRNA. Translation: AAO38810.1 .
    AY167997 mRNA. Translation: AAO38811.1 .
    AY167998 mRNA. Translation: AAO38812.1 .
    AL451062 , AL357079 , AL592548 Genomic DNA. Translation: CAH71022.1 .
    AL451062 , AL357079 , AL592548 Genomic DNA. Translation: CAH71023.1 .
    AL451062 , AL357079 , AL592548 Genomic DNA. Translation: CAH71024.1 .
    AL451062 , AL357079 , AL592548 Genomic DNA. Translation: CAH71025.1 .
    AL451062 , AL357079 , AL592548 Genomic DNA. Translation: CAH71027.1 .
    AL451062 , AL357079 , AL592548 Genomic DNA. Translation: CAH71028.1 .
    AL451062 , AL357079 , AL592548 Genomic DNA. Translation: CAH71029.1 .
    AL451062 , AL357079 , AL592548 Genomic DNA. Translation: CAH71031.1 .
    AL451062 , AL357079 , AL592548 Genomic DNA. Translation: CAH71032.1 .
    AL451062 , AL357079 , AL592548 Genomic DNA. Translation: CAH71033.1 .
    AL357079 , AL451062 , AL592548 Genomic DNA. Translation: CAI16785.1 .
    AL357079 , AL451062 , AL592548 Genomic DNA. Translation: CAI16786.1 .
    AL357079 , AL451062 , AL592548 Genomic DNA. Translation: CAI16787.1 .
    AL357079 , AL451062 , AL592548 Genomic DNA. Translation: CAI16789.1 .
    AL357079 , AL451062 , AL592548 Genomic DNA. Translation: CAI16790.1 .
    AL357079 , AL451062 , AL592548 Genomic DNA. Translation: CAI16791.1 .
    AL357079 , AL451062 , AL592548 Genomic DNA. Translation: CAI16792.1 .
    AL357079 , AL451062 , AL592548 Genomic DNA. Translation: CAI16793.1 .
    AL357079 , AL451062 , AL592548 Genomic DNA. Translation: CAI16794.1 .
    AL357079 , AL451062 , AL592548 Genomic DNA. Translation: CAI16795.1 .
    AL592548 , AL357079 , AL451062 Genomic DNA. Translation: CAI22181.1 .
    AL592548 , AL357079 , AL451062 Genomic DNA. Translation: CAI22182.1 .
    AL592548 , AL357079 , AL451062 Genomic DNA. Translation: CAI22183.1 .
    AL592548 , AL357079 , AL451062 Genomic DNA. Translation: CAI22184.1 .
    AL592548 , AL357079 , AL451062 Genomic DNA. Translation: CAI22186.1 .
    AL592548 , AL357079 , AL451062 Genomic DNA. Translation: CAI22188.1 .
    AL592548 , AL357079 , AL451062 Genomic DNA. Translation: CAI22189.1 .
    AL592548 , AL357079 , AL451062 Genomic DNA. Translation: CAI22190.1 .
    AL592548 , AL357079 , AL451062 Genomic DNA. Translation: CAI22191.1 .
    AL592548 , AL357079 , AL451062 Genomic DNA. Translation: CAI22192.1 .
    CH471059 Genomic DNA. Translation: EAX07082.1 .
    CH471059 Genomic DNA. Translation: EAX07083.1 .
    BC050380 mRNA. Translation: AAH50380.1 .
    CCDSi CCDS492.1. [Q11203-1 ]
    CCDS493.1. [Q11203-4 ]
    CCDS494.1. [Q11203-2 ]
    CCDS495.1. [Q11203-8 ]
    CCDS496.1. [Q11203-13 ]
    CCDS497.1. [Q11203-15 ]
    CCDS498.1. [Q11203-19 ]
    CCDS499.1. [Q11203-3 ]
    CCDS500.1. [Q11203-12 ]
    CCDS53310.1. [Q11203-18 ]
    CCDS57988.1. [Q11203-5 ]
    CCDS57989.1. [Q11203-7 ]
    CCDS57990.1. [Q11203-16 ]
    CCDS57991.1. [Q11203-17 ]
    CCDS57992.1. [Q11203-22 ]
    CCDS57993.1. [Q11203-24 ]
    CCDS57994.1. [Q11203-23 ]
    PIRi JN0618.
    RefSeqi NP_001257388.1. NM_001270459.1. [Q11203-5 ]
    NP_001257389.1. NM_001270460.1. [Q11203-7 ]
    NP_001257390.1. NM_001270461.1. [Q11203-16 ]
    NP_001257391.1. NM_001270462.1. [Q11203-21 ]
    NP_001257392.1. NM_001270463.1. [Q11203-24 ]
    NP_001257393.1. NM_001270464.1. [Q11203-17 ]
    NP_001257394.1. NM_001270465.1. [Q11203-23 ]
    NP_001257395.1. NM_001270466.1. [Q11203-22 ]
    NP_006270.1. NM_006279.3. [Q11203-1 ]
    NP_777623.2. NM_174963.3. [Q11203-4 ]
    NP_777624.1. NM_174964.2. [Q11203-2 ]
    NP_777625.1. NM_174965.2. [Q11203-3 ]
    NP_777626.1. NM_174966.2. [Q11203-8 ]
    NP_777627.1. NM_174967.2. [Q11203-12 ]
    NP_777628.2. NM_174968.3. [Q11203-13 ]
    NP_777629.1. NM_174969.2. [Q11203-15 ]
    NP_777630.1. NM_174970.2. [Q11203-18 ]
    NP_777631.2. NM_174971.3. [Q11203-19 ]
    UniGenei Hs.597915.

    3D structure databases

    ProteinModelPortali Q11203.
    SMRi Q11203. Positions 111-339.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 112379. 4 interactions.
    IntActi Q11203. 5 interactions.
    MINTi MINT-1397196.

    Protein family/group databases

    CAZyi GT29. Glycosyltransferase Family 29.

    PTM databases

    PhosphoSitei Q11203.

    Polymorphism databases

    DMDMi 1705561.

    Proteomic databases

    PaxDbi Q11203.
    PRIDEi Q11203.

    Protocols and materials databases

    DNASUi 6487.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000262915 ; ENSP00000262915 ; ENSG00000126091 . [Q11203-4 ]
    ENST00000330208 ; ENSP00000333494 ; ENSG00000126091 . [Q11203-12 ]
    ENST00000332628 ; ENSP00000329755 ; ENSG00000126091 . [Q11203-7 ]
    ENST00000335430 ; ENSP00000335633 ; ENSG00000126091 . [Q11203-20 ]
    ENST00000347631 ; ENSP00000317192 ; ENSG00000126091 . [Q11203-2 ]
    ENST00000351035 ; ENSP00000316999 ; ENSG00000126091 . [Q11203-19 ]
    ENST00000353126 ; ENSP00000330463 ; ENSG00000126091 . [Q11203-8 ]
    ENST00000361392 ; ENSP00000355341 ; ENSG00000126091 . [Q11203-1 ]
    ENST00000361400 ; ENSP00000354748 ; ENSG00000126091 . [Q11203-15 ]
    ENST00000361746 ; ENSP00000354657 ; ENSG00000126091 . [Q11203-4 ]
    ENST00000361812 ; ENSP00000355201 ; ENSG00000126091 . [Q11203-3 ]
    ENST00000372362 ; ENSP00000361437 ; ENSG00000126091 . [Q11203-12 ]
    ENST00000372365 ; ENSP00000361440 ; ENSG00000126091 . [Q11203-10 ]
    ENST00000372366 ; ENSP00000361441 ; ENSG00000126091 . [Q11203-23 ]
    ENST00000372367 ; ENSP00000361442 ; ENSG00000126091 . [Q11203-24 ]
    ENST00000372368 ; ENSP00000361443 ; ENSG00000126091 . [Q11203-13 ]
    ENST00000372369 ; ENSP00000361444 ; ENSG00000126091 . [Q11203-5 ]
    ENST00000372372 ; ENSP00000361447 ; ENSG00000126091 . [Q11203-19 ]
    ENST00000372374 ; ENSP00000361449 ; ENSG00000126091 . [Q11203-7 ]
    ENST00000469715 ; ENSP00000431700 ; ENSG00000126091 . [Q11203-6 ]
    ENST00000489897 ; ENSP00000437206 ; ENSG00000126091 . [Q11203-11 ]
    ENST00000490541 ; ENSP00000435018 ; ENSG00000126091 . [Q11203-26 ]
    ENST00000528371 ; ENSP00000434876 ; ENSG00000126091 . [Q11203-17 ]
    ENST00000530581 ; ENSP00000437293 ; ENSG00000126091 . [Q11203-20 ]
    ENST00000531451 ; ENSP00000435603 ; ENSG00000126091 . [Q11203-18 ]
    ENST00000531816 ; ENSP00000434378 ; ENSG00000126091 . [Q11203-22 ]
    ENST00000531993 ; ENSP00000432682 ; ENSG00000126091 . [Q11203-16 ]
    ENST00000533212 ; ENSP00000435621 ; ENSG00000126091 . [Q11203-14 ]
    ENST00000533933 ; ENSP00000432965 ; ENSG00000126091 . [Q11203-8 ]
    ENST00000533997 ; ENSP00000432071 ; ENSG00000126091 . [Q11203-9 ]
    ENST00000545417 ; ENSP00000439634 ; ENSG00000126091 . [Q11203-3 ]
    GeneIDi 6487.
    KEGGi hsa:6487.
    UCSCi uc001cka.4. human. [Q11203-18 ]
    uc001ckb.4. human. [Q11203-4 ]
    uc001ckc.4. human. [Q11203-1 ]
    uc001ckd.4. human. [Q11203-13 ]
    uc001cke.4. human. [Q11203-15 ]
    uc001ckf.4. human. [Q11203-19 ]
    uc001ckg.4. human. [Q11203-8 ]
    uc001cki.4. human. [Q11203-12 ]
    uc001ckk.4. human. [Q11203-7 ]
    uc001ckl.4. human. [Q11203-10 ]
    uc001ckm.4. human. [Q11203-23 ]
    uc001cko.4. human. [Q11203-16 ]
    uc001ckp.4. human. [Q11203-24 ]
    uc001ckq.4. human. [Q11203-17 ]
    uc001ckr.4. human. [Q11203-21 ]
    uc009vwv.4. human. [Q11203-5 ]
    uc009vxb.4. human. [Q11203-22 ]

    Organism-specific databases

    CTDi 6487.
    GeneCardsi GC01P044173.
    HGNCi HGNC:10866. ST3GAL3.
    HPAi HPA051102.
    MIMi 606494. gene.
    611090. phenotype.
    615006. phenotype.
    neXtProti NX_Q11203.
    Orphaneti 88616. Autosomal recessive nonsyndromic intellectual disability.
    3451. West syndrome.
    PharmGKBi PA35768.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG257001.
    HOVERGENi HBG056676.
    KOi K00781.
    OMAi PRAKRNG.
    PhylomeDBi Q11203.
    TreeFami TF354325.

    Enzyme and pathway databases

    UniPathwayi UPA00378 .
    BioCyci MetaCyc:HS04994-MONOMER.
    Reactomei REACT_115835. Termination of O-glycan biosynthesis.
    REACT_118798. Pre-NOTCH Processing in Golgi.
    REACT_121120. Keratan sulfate biosynthesis.
    REACT_200874. Sialic acid metabolism.

    Miscellaneous databases

    ChiTaRSi ST3GAL3. human.
    GeneWikii ST3GAL3.
    GenomeRNAii 6487.
    NextBioi 25195.
    PROi Q11203.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q11203.
    Bgeei Q11203.
    Genevestigatori Q11203.

    Family and domain databases

    InterProi IPR001675. Glyco_trans_29.
    IPR012163. Sialyl_trans.
    [Graphical view ]
    Pfami PF00777. Glyco_transf_29. 1 hit.
    [Graphical view ]
    PIRSFi PIRSF005557. Sialyl_trans. 1 hit.
    ProtoNeti Search...

    Publicationsi

    1. "Cloning and expression of human Gal beta 1,3(4)GlcNAc alpha 2,3-sialyltransferase."
      Kitagawa H., Paulson J.C.
      Biochem. Biophys. Res. Commun. 194:375-382(1993) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM B1).
      Tissue: Placenta.
    2. "Structural variations of the alpha 2,3-sialyltransferase III, ST3GalIII, transcripts in human peripheral white blood cells."
      Grahn A., Larson G.
      Submitted (SEP-2001) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS A1; A7; A8; B1; B1-90; B1+32; B3; B4; B4+173; B5+26; B5+173; B7; B8; C1; C7; C8; D2+26; E1 AND E3+32).
    3. "Structural variations of the alpha 2,3-sialyltransferase III, ST3GalIII, transcripts in human fetal brain."
      Grahn A., Larson G.
      Submitted (OCT-2002) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS B10; C4; C5; C9; C11; C12 AND D5).
      Tissue: Fetal brain.
    4. "The DNA sequence and biological annotation of human chromosome 1."
      Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
      , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
      Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM B1).
      Tissue: Brain.
    7. Cited for: VARIANTS MRT12 ASP-13 AND TYR-370, CHARACTERIZATION OF VARIANTS MRT12 ASP-13 AND TYR-370.
    8. Cited for: VARIANT EIEE15 PRO-320, CHARACTERIZATION OF VARIANT EIEE15 PRO-320.

    Entry informationi

    Entry nameiSIAT6_HUMAN
    AccessioniPrimary (citable) accession number: Q11203
    Secondary accession number(s): A9Z1W2
    , D3DPX8, Q5T4W9, Q5T4X0, Q5T4X7, Q5T4X8, Q5T4X9, Q5T4Y0, Q5T4Y2, Q5T4Y3, Q5T4Y4, Q86UR6, Q86UR7, Q86UR8, Q86UR9, Q86US0, Q86US1, Q86US2, Q8IX41, Q8IX42, Q8IX43, Q8IX44, Q8IX45, Q8IX46, Q8IX47, Q8IX48, Q8IX49, Q8IX50, Q8IX51, Q8IX52, Q8IX53, Q8IX54, Q8IX55, Q8IX56, Q8IX57, Q8IX58
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: October 1, 1996
    Last sequence update: October 1, 1996
    Last modified: October 1, 2014
    This is version 138 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 1
      Human chromosome 1: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. PATHWAY comments
      Index of metabolic and biosynthesis pathways
    6. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3