Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase

Gene

ST3GAL3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Catalyzes the formation of the NeuAc-alpha-2,3-Gal-beta-1,4-GlcNAc-, NeuAc-alpha-2,3-Gal-beta-1,3-GlcNAc- or NeuAc-alpha-2,3-Gal-beta-1,3-GalNAc- sequences found in terminal carbohydrate groups of glycoproteins and glycolipids. The highest activity is toward Gal-beta-1,3-GlcNAc and the lowest toward Gal-beta-1,3-GalNAc (By similarity).By similarity

Catalytic activityi

CMP-N-acetylneuraminate + beta-D-galactosyl-(1->4)-N-acetyl-D-glucosaminyl-glycoprotein = CMP + alpha-N-acetylneuraminyl-(2->3)-beta-D-galactosyl-(1->4)-N-acetyl-D-glucosaminyl-glycoprotein.

Pathwayi: protein glycosylation

This protein is involved in the pathway protein glycosylation, which is part of Protein modification.
View all proteins of this organism that are known to be involved in the pathway protein glycosylation and in Protein modification.

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Glycosyltransferase, Transferase

Enzyme and pathway databases

BioCyciMetaCyc:HS04994-MONOMER.
ZFISH:HS04994-MONOMER.
BRENDAi2.4.99.6. 2681.
ReactomeiR-HSA-1912420. Pre-NOTCH Processing in Golgi.
R-HSA-2022854. Keratan sulfate biosynthesis.
R-HSA-4085001. Sialic acid metabolism.
R-HSA-977068. Termination of O-glycan biosynthesis.
UniPathwayiUPA00378.

Protein family/group databases

CAZyiGT29. Glycosyltransferase Family 29.

Names & Taxonomyi

Protein namesi
Recommended name:
CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase (EC:2.4.99.6)
Alternative name(s):
Beta-galactoside alpha-2,3-sialyltransferase 3
Short name:
Alpha 2,3-ST 3
Gal beta-1,3(4) GlcNAc alpha-2,3 sialyltransferase
N-acetyllactosaminide alpha-2,3-sialyltransferase
ST3Gal III
Short name:
ST3GalIII
ST3N
Sialyltransferase 6
Gene namesi
Name:ST3GAL3
Synonyms:SIAT6
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

HGNCiHGNC:10866. ST3GAL3.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 8CytoplasmicSequence analysis8
Transmembranei9 – 28Helical; Signal-anchor for type II membrane proteinSequence analysisAdd BLAST20
Topological domaini29 – 375LumenalSequence analysisAdd BLAST347

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Golgi apparatus, Membrane, Secreted

Pathology & Biotechi

Involvement in diseasei

Mental retardation, autosomal recessive 12 (MRT12)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA disorder characterized by significantly below average general intellectual functioning associated with impairments in adaptive behavior and manifested during the developmental period.
See also OMIM:611090
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_06659413A → D in MRT12; most of the mutant protein is improperly localized to the endoplasmic reticulum preventing the protein from interacting with its substrates in the Golgi and resulting in a loss-of-function. 1 PublicationCorresponds to variant rs387906943dbSNPEnsembl.1
Natural variantiVAR_066595370D → Y in MRT12; the mutant protein is improperly localized to the endoplasmic reticulum preventing the protein from interacting with its substrates in the Golgi and resulting in a loss-of-function; shows a complete lack of enzyme activity; secretion of the mutant protein is dramatically reduced compared to wild-type. 1 Publication1
Epileptic encephalopathy, early infantile, 15 (EIEE15)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA form of epilepsy that manifests in the neonatal or the early infantile period as severely impaired cognitive and motor development, due to recurrent clinical seizures or prominent interictal epileptiform discharges. Patients develop infantile spasms, mainly of the flexor type, between 3 and 7 months of age, which are accompanied by hypsarrhythmia on EEG. Other features include poor eye contact, hypotonia, primitive reflexes, and irritability. Seizures evolve clinically to Lennox-Gastaut syndrome.
See also OMIM:615006
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_069319320A → P in EIEE15. 1 Publication1

Keywords - Diseasei

Disease mutation, Epilepsy, Mental retardation

Organism-specific databases

DisGeNETi6487.
MalaCardsiST3GAL3.
MIMi611090. phenotype.
615006. phenotype.
OpenTargetsiENSG00000126091.
Orphaneti88616. Autosomal recessive non-syndromic intellectual disability.
3451. West syndrome.
PharmGKBiPA35768.

Chemistry databases

ChEMBLiCHEMBL3596076.

Polymorphism and mutation databases

BioMutaiST3GAL3.
DMDMi1705561.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001492661 – 375CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferaseAdd BLAST375

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi80N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi160 ↔ 314By similarity
Glycosylationi171N-linked (GlcNAc...)Sequence analysis1

Post-translational modificationi

The soluble form derives from the membrane form by proteolytic processing.

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PeptideAtlasiQ11203.
PRIDEiQ11203.

PTM databases

iPTMnetiQ11203.
PhosphoSitePlusiQ11203.

Expressioni

Tissue specificityi

Highly expressed in adult skeletal muscle and in all fetal tissues examined and to a much lesser extent in placenta, lung and liver.

Gene expression databases

BgeeiENSG00000126091.
ExpressionAtlasiQ11203. baseline and differential.
GenevisibleiQ11203. HS.

Organism-specific databases

HPAiHPA051102.

Interactioni

Protein-protein interaction databases

BioGridi112379. 4 interactors.
IntActiQ11203. 5 interactors.
MINTiMINT-1397196.

Structurei

3D structure databases

ProteinModelPortaliQ11203.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the glycosyltransferase 29 family.Curated

Keywords - Domaini

Signal-anchor, Transmembrane, Transmembrane helix

Phylogenomic databases

GeneTreeiENSGT00760000119095.
HOVERGENiHBG056676.
InParanoidiQ11203.
KOiK00781.
OMAiPHEIRIL.
OrthoDBiEOG091G098L.
PhylomeDBiQ11203.
TreeFamiTF354325.

Family and domain databases

InterProiIPR001675. Glyco_trans_29.
IPR012163. Sialyl_trans.
[Graphical view]
PfamiPF00777. Glyco_transf_29. 1 hit.
[Graphical view]
PIRSFiPIRSF005557. Sialyl_trans. 1 hit.

Sequences (26)i

Sequence statusi: Complete.

This entry describes 26 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform B1 (identifier: Q11203-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGLLVFVRNL LLALCLFLVL GFLYYSAWKL HLLQWEEDSN SVVLSFDSAG
60 70 80 90 100
QTLGSEYDRL GFLLNLDSKL PAELATKYAN FSEGACKPGY ASALMTAIFP
110 120 130 140 150
RFSKPAPMFL DDSFRKWARI REFVPPFGIK GQDNLIKAIL SVTKEYRLTP
160 170 180 190 200
ALDSLRCRRC IIVGNGGVLA NKSLGSRIDD YDIVVRLNSA PVKGFEKDVG
210 220 230 240 250
SKTTLRITYP EGAMQRPEQY ERDSLFVLAG FKWQDFKWLK YIVYKERVSA
260 270 280 290 300
SDGFWKSVAT RVPKEPPEIR ILNPYFIQEA AFTLIGLPFN NGLMGRGNIP
310 320 330 340 350
TLGSVAVTMA LHGCDEVAVA GFGYDMSTPN APLHYYETVR MAAIKESWTH
360 370
NIQREKEFLR KLVKARVITD LSSGI
Length:375
Mass (Da):42,171
Last modified:October 1, 1996 - v1
Checksum:iC9B7B61AD580EC2E
GO
Isoform A1 (identifier: Q11203-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     40-40: N → SKYSHSSSPQEKPVAD

Show »
Length:390
Mass (Da):43,786
Checksum:iDCBE59B0BFF74B3A
GO
Isoform A7 (identifier: Q11203-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     40-40: N → SKYSHSSSPQEKPVAD
     133-155: DNLIKAILSVTKEYRLTPALDSL → VLDAQYPARERVSAEAGESSRHH
     156-375: Missing.

Show »
Length:170
Mass (Da):19,043
Checksum:i73BE2801C40F2F9B
GO
Isoform A8 (identifier: Q11203-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     40-40: N → SKYSHSSSPQEKPVAD
     70-70: L → LSPRTLCTVVFGLDCILESPGEPKKLLMPASHPLEILKSLSEDTAFALGFLKLPR

Show »
Length:444
Mass (Da):49,649
Checksum:iEDFBE742E527970E
GO
Isoform B1-90 (identifier: Q11203-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     249-278: Missing.

Show »
Length:345
Mass (Da):38,742
Checksum:i0AA0ED4823826782
GO
Isoform B1+32 (identifier: Q11203-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     187-189: LNS → PRL
     190-375: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:189
Mass (Da):21,204
Checksum:i73A783656B89AAF0
GO
Isoform B3 (identifier: Q11203-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     71-101: Missing.

Show »
Length:344
Mass (Da):38,912
Checksum:i9BA97BCA7FA29E8A
GO
Isoform B4 (identifier: Q11203-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     249-346: Missing.

Show »
Length:277
Mass (Da):31,587
Checksum:i7C84EE03A5D6ABCE
GO
Isoform B4+173 (identifier: Q11203-9) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     102-115: FSKPAPMFLDDSFR → EKVRTFMAWLAWYG
     116-375: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:115
Mass (Da):12,969
Checksum:i933010B3A0B41729
GO
Isoform B5+26 (identifier: Q11203-10) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     187-375: Missing.

Show »
Length:186
Mass (Da):20,837
Checksum:iE56B89AAF01B90F8
GO
Isoform B5+173 (identifier: Q11203-11) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     102-121: FSKPAPMFLDDSFRKWARIR → AKRNGAWRQKHIQAYVLRQR
     122-375: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:121
Mass (Da):13,691
Checksum:i709ABCEF09B26251
GO
Isoform B7 (identifier: Q11203-12) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     133-155: DNLIKAILSVTKEYRLTPALDSL → VLDAQYPARERVSAEAGESSRHH
     156-375: Missing.

Show »
Length:155
Mass (Da):17,428
Checksum:iA881E409E96468F9
GO
Isoform B8 (identifier: Q11203-13) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     70-70: L → LSPRTLCTVVFGLDCILESPGEPKKLLMPASHPLEILKSLSEDTAFALGFLKLPR

Show »
Length:429
Mass (Da):48,034
Checksum:iDF45CA4E6D931B3D
GO
Isoform B10 (identifier: Q11203-14) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     133-151: DNLIKAILSVTKEYRLTPA → ECIGWLLEICGHSSAQGAP
     152-375: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:151
Mass (Da):16,834
Checksum:i8EF2DF5A045B8511
GO
Isoform C1 (identifier: Q11203-15) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     40-56: NSVVLSFDSAGQTLGSE → K

Show »
Length:359
Mass (Da):40,606
Checksum:i8A84C7FB0ABDD7C9
GO
Isoform C4 (identifier: Q11203-16) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     40-56: NSVVLSFDSAGQTLGSE → K
     249-346: Missing.

Show »
Length:261
Mass (Da):30,022
Checksum:i3DC939A6817E18B0
GO
Isoform C5 (identifier: Q11203-17) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     40-56: NSVVLSFDSAGQTLGSE → K
     186-202: RLNSAPVKGFEKDVGSK → SPGRTISSERKSFCGSW
     203-375: Missing.

Show »
Length:186
Mass (Da):20,984
Checksum:i1E7D22F363B85B30
GO
Isoform C7 (identifier: Q11203-18) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     40-56: NSVVLSFDSAGQTLGSE → K
     133-155: DNLIKAILSVTKEYRLTPALDSL → VLDAQYPARERVSAEAGESSRHH
     156-375: Missing.

Show »
Length:139
Mass (Da):15,863
Checksum:i04B51A49F74C6F42
GO
Isoform C8 (identifier: Q11203-19) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     40-56: NSVVLSFDSAGQTLGSE → K
     70-70: L → LSPRTLCTVVFGLDCILESPGEPKKLLMPASHPLEILKSLSEDTAFALGFLKLPR

Show »
Length:413
Mass (Da):46,469
Checksum:i1CD13FC0AEB4560D
GO
Isoform C9 (identifier: Q11203-20) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     40-56: NSVVLSFDSAGQTLGSE → K
     187-244: LNSAPVKGFE...DFKWLKYIVY → VHRMASGNLW...GTSLPLAVWQ
     245-375: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:228
Mass (Da):25,558
Checksum:i87D5C4311A1FE514
GO
Isoform C11 (identifier: Q11203-21) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     40-56: NSVVLSFDSAGQTLGSE → K
     71-101: Missing.
     249-346: Missing.

Show »
Length:230
Mass (Da):26,763
Checksum:i073EA4B17DC68FB0
GO
Isoform C12 (identifier: Q11203-22) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     40-56: NSVVLSFDSAGQTLGSE → K
     102-117: FSKPAPMFLDDSFRKW → PGRTISSERKSFCGSW
     118-375: Missing.

Show »
Length:101
Mass (Da):11,444
Checksum:i33196D8AF2BED686
GO
Isoform D2+26 (identifier: Q11203-23) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     40-55: NSVVLSFDSAGQTLGS → SKYSHSSSPQEKPVA
     187-375: Missing.

Show »
Length:185
Mass (Da):20,887
Checksum:iC50EA375D4F01821
GO
Isoform D5 (identifier: Q11203-24) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     40-55: NSVVLSFDSAGQTLGS → SKYSHSSSPQEKPVA
     186-202: RLNSAPVKGFEKDVGSK → SPGRTISSERKSFCGSW
     203-375: Missing.

Show »
Length:201
Mass (Da):22,598
Checksum:i14056E7DD7DD50AB
GO
Isoform E1 (identifier: Q11203-25) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     40-43: NSVV → SLLN
     44-375: Missing.

Show »
Length:43
Mass (Da):5,056
Checksum:i9E7CF581E6CD3813
GO
Isoform E3+32 (identifier: Q11203-26) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     40-73: NSVVLSFDSAGQTLGSEYDRLGFLLNLDSKLPAE → SSPSQHPCSWMTPFASGLESGSSCRLLGSKVKTI
     74-375: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:73
Mass (Da):8,178
Checksum:iDE5BE566E4BDF07D
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti38D → N in AAO38806 (Ref. 3) Curated1
Sequence conflicti94L → S in AAO38810 (Ref. 3) Curated1
Sequence conflicti123F → L in AAO38810 (Ref. 3) Curated1
Sequence conflicti351N → S in AAO38811 (Ref. 3) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_06659413A → D in MRT12; most of the mutant protein is improperly localized to the endoplasmic reticulum preventing the protein from interacting with its substrates in the Golgi and resulting in a loss-of-function. 1 PublicationCorresponds to variant rs387906943dbSNPEnsembl.1
Natural variantiVAR_069319320A → P in EIEE15. 1 Publication1
Natural variantiVAR_066595370D → Y in MRT12; the mutant protein is improperly localized to the endoplasmic reticulum preventing the protein from interacting with its substrates in the Golgi and resulting in a loss-of-function; shows a complete lack of enzyme activity; secretion of the mutant protein is dramatically reduced compared to wild-type. 1 Publication1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_01059540 – 73NSVVL…KLPAE → SSPSQHPCSWMTPFASGLES GSSCRLLGSKVKTI in isoform E3+32. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_01059440 – 56NSVVL…TLGSE → K in isoform C1, isoform C4, isoform C5, isoform C7, isoform C8, isoform C9, isoform C11 and isoform C12. 2 PublicationsAdd BLAST17
Alternative sequenceiVSP_01059340 – 55NSVVL…QTLGS → SKYSHSSSPQEKPVA in isoform D5 and isoform D2+26. 2 PublicationsAdd BLAST16
Alternative sequenceiVSP_01059240 – 43NSVV → SLLN in isoform E1. 1 Publication4
Alternative sequenceiVSP_01059140N → SKYSHSSSPQEKPVAD in isoform A1, isoform A7 and isoform A8. 1 Publication1
Alternative sequenceiVSP_01059644 – 375Missing in isoform E1. 1 PublicationAdd BLAST332
Alternative sequenceiVSP_01059770L → LSPRTLCTVVFGLDCILESP GEPKKLLMPASHPLEILKSL SEDTAFALGFLKLPR in isoform A8, isoform B8 and isoform C8. 1 Publication1
Alternative sequenceiVSP_01059871 – 101Missing in isoform B3 and isoform C11. 2 PublicationsAdd BLAST31
Alternative sequenceiVSP_01059974 – 375Missing in isoform E3+32. 1 PublicationAdd BLAST302
Alternative sequenceiVSP_010602102 – 121FSKPA…WARIR → AKRNGAWRQKHIQAYVLRQR in isoform B5+173. 1 PublicationAdd BLAST20
Alternative sequenceiVSP_010601102 – 117FSKPA…SFRKW → PGRTISSERKSFCGSW in isoform C12. 1 PublicationAdd BLAST16
Alternative sequenceiVSP_010600102 – 115FSKPA…DDSFR → EKVRTFMAWLAWYG in isoform B4+173. 1 PublicationAdd BLAST14
Alternative sequenceiVSP_010603116 – 375Missing in isoform B4+173. 1 PublicationAdd BLAST260
Alternative sequenceiVSP_010604118 – 375Missing in isoform C12. 1 PublicationAdd BLAST258
Alternative sequenceiVSP_010605122 – 375Missing in isoform B5+173. 1 PublicationAdd BLAST254
Alternative sequenceiVSP_010607133 – 155DNLIK…ALDSL → VLDAQYPARERVSAEAGESS RHH in isoform A7, isoform B7 and isoform C7. 1 PublicationAdd BLAST23
Alternative sequenceiVSP_010606133 – 151DNLIK…RLTPA → ECIGWLLEICGHSSAQGAP in isoform B10. 1 PublicationAdd BLAST19
Alternative sequenceiVSP_010608152 – 375Missing in isoform B10. 1 PublicationAdd BLAST224
Alternative sequenceiVSP_010609156 – 375Missing in isoform A7, isoform B7 and isoform C7. 1 PublicationAdd BLAST220
Alternative sequenceiVSP_010610186 – 202RLNSA…DVGSK → SPGRTISSERKSFCGSW in isoform C5 and isoform D5. 1 PublicationAdd BLAST17
Alternative sequenceiVSP_010613187 – 375Missing in isoform B5+26 and isoform D2+26. 1 PublicationAdd BLAST189
Alternative sequenceiVSP_010612187 – 244LNSAP…KYIVY → VHRMASGNLWPLECPRSPLR FESSTHISSRRPPSPSLACP STMASWAGGTSLPLAVWQ in isoform C9. 1 PublicationAdd BLAST58
Alternative sequenceiVSP_010611187 – 189LNS → PRL in isoform B1+32. 1 Publication3
Alternative sequenceiVSP_010614190 – 375Missing in isoform B1+32. 1 PublicationAdd BLAST186
Alternative sequenceiVSP_010615203 – 375Missing in isoform C5 and isoform D5. 1 PublicationAdd BLAST173
Alternative sequenceiVSP_010616245 – 375Missing in isoform C9. 1 PublicationAdd BLAST131
Alternative sequenceiVSP_010618249 – 346Missing in isoform B4, isoform C4 and isoform C11. 2 PublicationsAdd BLAST98
Alternative sequenceiVSP_010617249 – 278Missing in isoform B1-90. 1 PublicationAdd BLAST30

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L23768 mRNA. Translation: AAA35778.1.
AF425851 mRNA. Translation: AAO13859.1.
AF425852 mRNA. Translation: AAO13860.1.
AF425853 mRNA. Translation: AAO13861.1.
AF425854 mRNA. Translation: AAO13862.1.
AF425855 mRNA. Translation: AAO13863.1.
AF425856 mRNA. Translation: AAO13864.1.
AF425857 mRNA. Translation: AAO13865.1.
AF425858 mRNA. Translation: AAO13866.1.
AF425859 mRNA. Translation: AAO13867.1.
AF425860 mRNA. Translation: AAO13868.1.
AF425861 mRNA. Translation: AAO13869.1.
AF425862 mRNA. Translation: AAO13870.1.
AF425863 mRNA. Translation: AAO13871.1.
AF425864 mRNA. Translation: AAO13872.1.
AF425865 mRNA. Translation: AAO13873.1.
AF425866 mRNA. Translation: AAO13874.1.
AF425867 mRNA. Translation: AAO13875.1.
AF425868 mRNA. Translation: AAO13876.1.
AF425869 mRNA. Translation: AAO13877.1.
AY167992 mRNA. Translation: AAO38806.1.
AY167993 mRNA. Translation: AAO38807.1.
AY167994 mRNA. Translation: AAO38808.1.
AY167995 mRNA. Translation: AAO38809.1.
AY167996 mRNA. Translation: AAO38810.1.
AY167997 mRNA. Translation: AAO38811.1.
AY167998 mRNA. Translation: AAO38812.1.
AL451062, AL357079, AL592548 Genomic DNA. Translation: CAH71022.1.
AL451062, AL357079, AL592548 Genomic DNA. Translation: CAH71023.1.
AL451062, AL357079, AL592548 Genomic DNA. Translation: CAH71024.1.
AL451062, AL357079, AL592548 Genomic DNA. Translation: CAH71025.1.
AL451062, AL357079, AL592548 Genomic DNA. Translation: CAH71027.1.
AL451062, AL357079, AL592548 Genomic DNA. Translation: CAH71028.1.
AL451062, AL357079, AL592548 Genomic DNA. Translation: CAH71029.1.
AL451062, AL357079, AL592548 Genomic DNA. Translation: CAH71031.1.
AL451062, AL357079, AL592548 Genomic DNA. Translation: CAH71032.1.
AL451062, AL357079, AL592548 Genomic DNA. Translation: CAH71033.1.
AL357079, AL451062, AL592548 Genomic DNA. Translation: CAI16785.1.
AL357079, AL451062, AL592548 Genomic DNA. Translation: CAI16786.1.
AL357079, AL451062, AL592548 Genomic DNA. Translation: CAI16787.1.
AL357079, AL451062, AL592548 Genomic DNA. Translation: CAI16789.1.
AL357079, AL451062, AL592548 Genomic DNA. Translation: CAI16790.1.
AL357079, AL451062, AL592548 Genomic DNA. Translation: CAI16791.1.
AL357079, AL451062, AL592548 Genomic DNA. Translation: CAI16792.1.
AL357079, AL451062, AL592548 Genomic DNA. Translation: CAI16793.1.
AL357079, AL451062, AL592548 Genomic DNA. Translation: CAI16794.1.
AL357079, AL451062, AL592548 Genomic DNA. Translation: CAI16795.1.
AL592548, AL357079, AL451062 Genomic DNA. Translation: CAI22181.1.
AL592548, AL357079, AL451062 Genomic DNA. Translation: CAI22182.1.
AL592548, AL357079, AL451062 Genomic DNA. Translation: CAI22183.1.
AL592548, AL357079, AL451062 Genomic DNA. Translation: CAI22184.1.
AL592548, AL357079, AL451062 Genomic DNA. Translation: CAI22186.1.
AL592548, AL357079, AL451062 Genomic DNA. Translation: CAI22188.1.
AL592548, AL357079, AL451062 Genomic DNA. Translation: CAI22189.1.
AL592548, AL357079, AL451062 Genomic DNA. Translation: CAI22190.1.
AL592548, AL357079, AL451062 Genomic DNA. Translation: CAI22191.1.
AL592548, AL357079, AL451062 Genomic DNA. Translation: CAI22192.1.
CH471059 Genomic DNA. Translation: EAX07082.1.
CH471059 Genomic DNA. Translation: EAX07083.1.
BC050380 mRNA. Translation: AAH50380.1.
CCDSiCCDS492.1. [Q11203-1]
CCDS493.1. [Q11203-4]
CCDS494.1. [Q11203-2]
CCDS495.1. [Q11203-8]
CCDS496.1. [Q11203-13]
CCDS497.1. [Q11203-15]
CCDS498.1. [Q11203-19]
CCDS499.1. [Q11203-3]
CCDS500.1. [Q11203-12]
CCDS53310.1. [Q11203-18]
CCDS57988.1. [Q11203-5]
CCDS57989.1. [Q11203-7]
CCDS57990.1. [Q11203-16]
CCDS57991.1. [Q11203-17]
CCDS57992.1. [Q11203-22]
CCDS57993.1. [Q11203-24]
CCDS57994.1. [Q11203-23]
PIRiJN0618.
RefSeqiNP_001257388.1. NM_001270459.1. [Q11203-5]
NP_001257389.1. NM_001270460.1. [Q11203-7]
NP_001257390.1. NM_001270461.1. [Q11203-16]
NP_001257391.1. NM_001270462.1. [Q11203-21]
NP_001257392.1. NM_001270463.1. [Q11203-24]
NP_001257393.1. NM_001270464.1. [Q11203-17]
NP_001257394.1. NM_001270465.1. [Q11203-23]
NP_001257395.1. NM_001270466.1. [Q11203-22]
NP_006270.1. NM_006279.3. [Q11203-1]
NP_777623.2. NM_174963.3. [Q11203-4]
NP_777624.1. NM_174964.2. [Q11203-2]
NP_777625.1. NM_174965.2. [Q11203-3]
NP_777626.1. NM_174966.2. [Q11203-8]
NP_777627.1. NM_174967.2. [Q11203-12]
NP_777628.2. NM_174968.3. [Q11203-13]
NP_777629.1. NM_174969.2. [Q11203-15]
NP_777630.1. NM_174970.2. [Q11203-18]
NP_777631.2. NM_174971.3. [Q11203-19]
XP_016857602.1. XM_017002113.1. [Q11203-1]
UniGeneiHs.597915.

Genome annotation databases

EnsembliENST00000262915; ENSP00000262915; ENSG00000126091. [Q11203-4]
ENST00000330208; ENSP00000333494; ENSG00000126091. [Q11203-22]
ENST00000332628; ENSP00000329755; ENSG00000126091. [Q11203-7]
ENST00000335430; ENSP00000335633; ENSG00000126091. [Q11203-23]
ENST00000347631; ENSP00000317192; ENSG00000126091. [Q11203-2]
ENST00000351035; ENSP00000316999; ENSG00000126091. [Q11203-19]
ENST00000353126; ENSP00000330463; ENSG00000126091. [Q11203-8]
ENST00000361392; ENSP00000355341; ENSG00000126091. [Q11203-1]
ENST00000361400; ENSP00000354748; ENSG00000126091. [Q11203-15]
ENST00000361746; ENSP00000354657; ENSG00000126091. [Q11203-4]
ENST00000361812; ENSP00000355201; ENSG00000126091. [Q11203-3]
ENST00000372362; ENSP00000361437; ENSG00000126091. [Q11203-12]
ENST00000372365; ENSP00000361440; ENSG00000126091. [Q11203-10]
ENST00000372366; ENSP00000361441; ENSG00000126091. [Q11203-23]
ENST00000372367; ENSP00000361442; ENSG00000126091. [Q11203-24]
ENST00000372368; ENSP00000361443; ENSG00000126091. [Q11203-13]
ENST00000372369; ENSP00000361444; ENSG00000126091. [Q11203-5]
ENST00000372372; ENSP00000361447; ENSG00000126091. [Q11203-19]
ENST00000372374; ENSP00000361449; ENSG00000126091. [Q11203-7]
ENST00000469715; ENSP00000431700; ENSG00000126091. [Q11203-6]
ENST00000489897; ENSP00000437206; ENSG00000126091. [Q11203-11]
ENST00000490541; ENSP00000435018; ENSG00000126091. [Q11203-26]
ENST00000528371; ENSP00000434876; ENSG00000126091. [Q11203-17]
ENST00000530581; ENSP00000437293; ENSG00000126091. [Q11203-20]
ENST00000531451; ENSP00000435603; ENSG00000126091. [Q11203-18]
ENST00000531816; ENSP00000434378; ENSG00000126091. [Q11203-22]
ENST00000531993; ENSP00000432682; ENSG00000126091. [Q11203-16]
ENST00000533212; ENSP00000435621; ENSG00000126091. [Q11203-14]
ENST00000533933; ENSP00000432965; ENSG00000126091. [Q11203-8]
ENST00000533997; ENSP00000432071; ENSG00000126091. [Q11203-9]
ENST00000545417; ENSP00000439634; ENSG00000126091. [Q11203-3]
GeneIDi6487.
KEGGihsa:6487.
UCSCiuc001cjz.5. human. [Q11203-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Web resourcesi

Functional Glycomics Gateway - GTase

ST3Gal III

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L23768 mRNA. Translation: AAA35778.1.
AF425851 mRNA. Translation: AAO13859.1.
AF425852 mRNA. Translation: AAO13860.1.
AF425853 mRNA. Translation: AAO13861.1.
AF425854 mRNA. Translation: AAO13862.1.
AF425855 mRNA. Translation: AAO13863.1.
AF425856 mRNA. Translation: AAO13864.1.
AF425857 mRNA. Translation: AAO13865.1.
AF425858 mRNA. Translation: AAO13866.1.
AF425859 mRNA. Translation: AAO13867.1.
AF425860 mRNA. Translation: AAO13868.1.
AF425861 mRNA. Translation: AAO13869.1.
AF425862 mRNA. Translation: AAO13870.1.
AF425863 mRNA. Translation: AAO13871.1.
AF425864 mRNA. Translation: AAO13872.1.
AF425865 mRNA. Translation: AAO13873.1.
AF425866 mRNA. Translation: AAO13874.1.
AF425867 mRNA. Translation: AAO13875.1.
AF425868 mRNA. Translation: AAO13876.1.
AF425869 mRNA. Translation: AAO13877.1.
AY167992 mRNA. Translation: AAO38806.1.
AY167993 mRNA. Translation: AAO38807.1.
AY167994 mRNA. Translation: AAO38808.1.
AY167995 mRNA. Translation: AAO38809.1.
AY167996 mRNA. Translation: AAO38810.1.
AY167997 mRNA. Translation: AAO38811.1.
AY167998 mRNA. Translation: AAO38812.1.
AL451062, AL357079, AL592548 Genomic DNA. Translation: CAH71022.1.
AL451062, AL357079, AL592548 Genomic DNA. Translation: CAH71023.1.
AL451062, AL357079, AL592548 Genomic DNA. Translation: CAH71024.1.
AL451062, AL357079, AL592548 Genomic DNA. Translation: CAH71025.1.
AL451062, AL357079, AL592548 Genomic DNA. Translation: CAH71027.1.
AL451062, AL357079, AL592548 Genomic DNA. Translation: CAH71028.1.
AL451062, AL357079, AL592548 Genomic DNA. Translation: CAH71029.1.
AL451062, AL357079, AL592548 Genomic DNA. Translation: CAH71031.1.
AL451062, AL357079, AL592548 Genomic DNA. Translation: CAH71032.1.
AL451062, AL357079, AL592548 Genomic DNA. Translation: CAH71033.1.
AL357079, AL451062, AL592548 Genomic DNA. Translation: CAI16785.1.
AL357079, AL451062, AL592548 Genomic DNA. Translation: CAI16786.1.
AL357079, AL451062, AL592548 Genomic DNA. Translation: CAI16787.1.
AL357079, AL451062, AL592548 Genomic DNA. Translation: CAI16789.1.
AL357079, AL451062, AL592548 Genomic DNA. Translation: CAI16790.1.
AL357079, AL451062, AL592548 Genomic DNA. Translation: CAI16791.1.
AL357079, AL451062, AL592548 Genomic DNA. Translation: CAI16792.1.
AL357079, AL451062, AL592548 Genomic DNA. Translation: CAI16793.1.
AL357079, AL451062, AL592548 Genomic DNA. Translation: CAI16794.1.
AL357079, AL451062, AL592548 Genomic DNA. Translation: CAI16795.1.
AL592548, AL357079, AL451062 Genomic DNA. Translation: CAI22181.1.
AL592548, AL357079, AL451062 Genomic DNA. Translation: CAI22182.1.
AL592548, AL357079, AL451062 Genomic DNA. Translation: CAI22183.1.
AL592548, AL357079, AL451062 Genomic DNA. Translation: CAI22184.1.
AL592548, AL357079, AL451062 Genomic DNA. Translation: CAI22186.1.
AL592548, AL357079, AL451062 Genomic DNA. Translation: CAI22188.1.
AL592548, AL357079, AL451062 Genomic DNA. Translation: CAI22189.1.
AL592548, AL357079, AL451062 Genomic DNA. Translation: CAI22190.1.
AL592548, AL357079, AL451062 Genomic DNA. Translation: CAI22191.1.
AL592548, AL357079, AL451062 Genomic DNA. Translation: CAI22192.1.
CH471059 Genomic DNA. Translation: EAX07082.1.
CH471059 Genomic DNA. Translation: EAX07083.1.
BC050380 mRNA. Translation: AAH50380.1.
CCDSiCCDS492.1. [Q11203-1]
CCDS493.1. [Q11203-4]
CCDS494.1. [Q11203-2]
CCDS495.1. [Q11203-8]
CCDS496.1. [Q11203-13]
CCDS497.1. [Q11203-15]
CCDS498.1. [Q11203-19]
CCDS499.1. [Q11203-3]
CCDS500.1. [Q11203-12]
CCDS53310.1. [Q11203-18]
CCDS57988.1. [Q11203-5]
CCDS57989.1. [Q11203-7]
CCDS57990.1. [Q11203-16]
CCDS57991.1. [Q11203-17]
CCDS57992.1. [Q11203-22]
CCDS57993.1. [Q11203-24]
CCDS57994.1. [Q11203-23]
PIRiJN0618.
RefSeqiNP_001257388.1. NM_001270459.1. [Q11203-5]
NP_001257389.1. NM_001270460.1. [Q11203-7]
NP_001257390.1. NM_001270461.1. [Q11203-16]
NP_001257391.1. NM_001270462.1. [Q11203-21]
NP_001257392.1. NM_001270463.1. [Q11203-24]
NP_001257393.1. NM_001270464.1. [Q11203-17]
NP_001257394.1. NM_001270465.1. [Q11203-23]
NP_001257395.1. NM_001270466.1. [Q11203-22]
NP_006270.1. NM_006279.3. [Q11203-1]
NP_777623.2. NM_174963.3. [Q11203-4]
NP_777624.1. NM_174964.2. [Q11203-2]
NP_777625.1. NM_174965.2. [Q11203-3]
NP_777626.1. NM_174966.2. [Q11203-8]
NP_777627.1. NM_174967.2. [Q11203-12]
NP_777628.2. NM_174968.3. [Q11203-13]
NP_777629.1. NM_174969.2. [Q11203-15]
NP_777630.1. NM_174970.2. [Q11203-18]
NP_777631.2. NM_174971.3. [Q11203-19]
XP_016857602.1. XM_017002113.1. [Q11203-1]
UniGeneiHs.597915.

3D structure databases

ProteinModelPortaliQ11203.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi112379. 4 interactors.
IntActiQ11203. 5 interactors.
MINTiMINT-1397196.

Chemistry databases

ChEMBLiCHEMBL3596076.

Protein family/group databases

CAZyiGT29. Glycosyltransferase Family 29.

PTM databases

iPTMnetiQ11203.
PhosphoSitePlusiQ11203.

Polymorphism and mutation databases

BioMutaiST3GAL3.
DMDMi1705561.

Proteomic databases

PeptideAtlasiQ11203.
PRIDEiQ11203.

Protocols and materials databases

DNASUi6487.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000262915; ENSP00000262915; ENSG00000126091. [Q11203-4]
ENST00000330208; ENSP00000333494; ENSG00000126091. [Q11203-22]
ENST00000332628; ENSP00000329755; ENSG00000126091. [Q11203-7]
ENST00000335430; ENSP00000335633; ENSG00000126091. [Q11203-23]
ENST00000347631; ENSP00000317192; ENSG00000126091. [Q11203-2]
ENST00000351035; ENSP00000316999; ENSG00000126091. [Q11203-19]
ENST00000353126; ENSP00000330463; ENSG00000126091. [Q11203-8]
ENST00000361392; ENSP00000355341; ENSG00000126091. [Q11203-1]
ENST00000361400; ENSP00000354748; ENSG00000126091. [Q11203-15]
ENST00000361746; ENSP00000354657; ENSG00000126091. [Q11203-4]
ENST00000361812; ENSP00000355201; ENSG00000126091. [Q11203-3]
ENST00000372362; ENSP00000361437; ENSG00000126091. [Q11203-12]
ENST00000372365; ENSP00000361440; ENSG00000126091. [Q11203-10]
ENST00000372366; ENSP00000361441; ENSG00000126091. [Q11203-23]
ENST00000372367; ENSP00000361442; ENSG00000126091. [Q11203-24]
ENST00000372368; ENSP00000361443; ENSG00000126091. [Q11203-13]
ENST00000372369; ENSP00000361444; ENSG00000126091. [Q11203-5]
ENST00000372372; ENSP00000361447; ENSG00000126091. [Q11203-19]
ENST00000372374; ENSP00000361449; ENSG00000126091. [Q11203-7]
ENST00000469715; ENSP00000431700; ENSG00000126091. [Q11203-6]
ENST00000489897; ENSP00000437206; ENSG00000126091. [Q11203-11]
ENST00000490541; ENSP00000435018; ENSG00000126091. [Q11203-26]
ENST00000528371; ENSP00000434876; ENSG00000126091. [Q11203-17]
ENST00000530581; ENSP00000437293; ENSG00000126091. [Q11203-20]
ENST00000531451; ENSP00000435603; ENSG00000126091. [Q11203-18]
ENST00000531816; ENSP00000434378; ENSG00000126091. [Q11203-22]
ENST00000531993; ENSP00000432682; ENSG00000126091. [Q11203-16]
ENST00000533212; ENSP00000435621; ENSG00000126091. [Q11203-14]
ENST00000533933; ENSP00000432965; ENSG00000126091. [Q11203-8]
ENST00000533997; ENSP00000432071; ENSG00000126091. [Q11203-9]
ENST00000545417; ENSP00000439634; ENSG00000126091. [Q11203-3]
GeneIDi6487.
KEGGihsa:6487.
UCSCiuc001cjz.5. human. [Q11203-1]

Organism-specific databases

CTDi6487.
DisGeNETi6487.
GeneCardsiST3GAL3.
HGNCiHGNC:10866. ST3GAL3.
HPAiHPA051102.
MalaCardsiST3GAL3.
MIMi606494. gene.
611090. phenotype.
615006. phenotype.
neXtProtiNX_Q11203.
OpenTargetsiENSG00000126091.
Orphaneti88616. Autosomal recessive non-syndromic intellectual disability.
3451. West syndrome.
PharmGKBiPA35768.
GenAtlasiSearch...

Phylogenomic databases

GeneTreeiENSGT00760000119095.
HOVERGENiHBG056676.
InParanoidiQ11203.
KOiK00781.
OMAiPHEIRIL.
OrthoDBiEOG091G098L.
PhylomeDBiQ11203.
TreeFamiTF354325.

Enzyme and pathway databases

UniPathwayiUPA00378.
BioCyciMetaCyc:HS04994-MONOMER.
ZFISH:HS04994-MONOMER.
BRENDAi2.4.99.6. 2681.
ReactomeiR-HSA-1912420. Pre-NOTCH Processing in Golgi.
R-HSA-2022854. Keratan sulfate biosynthesis.
R-HSA-4085001. Sialic acid metabolism.
R-HSA-977068. Termination of O-glycan biosynthesis.

Miscellaneous databases

ChiTaRSiST3GAL3. human.
GeneWikiiST3GAL3.
GenomeRNAii6487.
PROiQ11203.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000126091.
ExpressionAtlasiQ11203. baseline and differential.
GenevisibleiQ11203. HS.

Family and domain databases

InterProiIPR001675. Glyco_trans_29.
IPR012163. Sialyl_trans.
[Graphical view]
PfamiPF00777. Glyco_transf_29. 1 hit.
[Graphical view]
PIRSFiPIRSF005557. Sialyl_trans. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiSIAT6_HUMAN
AccessioniPrimary (citable) accession number: Q11203
Secondary accession number(s): A9Z1W2
, D3DPX8, Q5T4W9, Q5T4X0, Q5T4X7, Q5T4X8, Q5T4X9, Q5T4Y0, Q5T4Y2, Q5T4Y3, Q5T4Y4, Q86UR6, Q86UR7, Q86UR8, Q86UR9, Q86US0, Q86US1, Q86US2, Q8IX41, Q8IX42, Q8IX43, Q8IX44, Q8IX45, Q8IX46, Q8IX47, Q8IX48, Q8IX49, Q8IX50, Q8IX51, Q8IX52, Q8IX53, Q8IX54, Q8IX55, Q8IX56, Q8IX57, Q8IX58
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 1, 1996
Last sequence update: October 1, 1996
Last modified: November 30, 2016
This is version 160 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.