Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q11131

- FUT7_MOUSE

UniProt

Q11131 - FUT7_MOUSE

Protein

Alpha-(1,3)-fucosyltransferase 7

Gene

Fut7

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 117 (01 Oct 2014)
      Sequence version 1 (01 Oct 1996)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    May catalyze alpha-1,3 glycosidic linkages involved in the expression of sialyl Lewis X antigens.

    Catalytic activityi

    GDP-L-fucose + alpha-2,3-Neu-N-acetyl-1,4-beta-D-galactosyl-N-acetyl-D-glucosaminyl-R = GDP + alpha-2,3-Neu-N-acetyl-1,4-beta-D-galactosyl-(alpha-1,3-L-fucosyl)-N-acetyl-D-glucosaminyl-R.

    Pathwayi

    GO - Molecular functioni

    1. fucosyltransferase activity Source: InterPro

    GO - Biological processi

    1. CD4-positive, CD25-positive, alpha-beta regulatory T cell differentiation Source: MGI
    2. leukocyte migration involved in immune response Source: MGI
    3. protein glycosylation Source: UniProtKB-UniPathway

    Keywords - Molecular functioni

    Glycosyltransferase, Transferase

    Enzyme and pathway databases

    BRENDAi2.4.1.152. 3474.
    UniPathwayiUPA00378.

    Protein family/group databases

    CAZyiGT10. Glycosyltransferase Family 10.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Alpha-(1,3)-fucosyltransferase 7 (EC:2.4.1.-)
    Alternative name(s):
    Fucosyltransferase 7
    Fucosyltransferase VII
    Short name:
    Fuc-TVII
    Short name:
    FucT-VII
    Galactoside 3-L-fucosyltransferase
    Gene namesi
    Name:Fut7
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Chromosome 2

    Organism-specific databases

    MGIiMGI:107692. Fut7.

    Subcellular locationi

    Golgi apparatusGolgi stack membrane; Single-pass type II membrane protein
    Note: Membrane-bound form in trans cisternae of Golgi.

    GO - Cellular componenti

    1. Golgi cisterna membrane Source: UniProtKB-SubCell
    2. integral component of membrane Source: UniProtKB-KW

    Keywords - Cellular componenti

    Golgi apparatus, Membrane

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 389389Alpha-(1,3)-fucosyltransferase 7PRO_0000221114Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Disulfide bondi115 ↔ 123By similarity
    Glycosylationi128 – 1281N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi258 ↔ 261By similarity
    Glycosylationi338 – 3381N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi365 ↔ 368By similarity

    Keywords - PTMi

    Disulfide bond, Glycoprotein

    Proteomic databases

    PRIDEiQ11131.

    PTM databases

    PhosphoSiteiQ11131.

    Expressioni

    Tissue specificityi

    Highly expressed in lung and bone marrow and to a much lesser extent in spleen, salivary gland and skeletal muscle.

    Gene expression databases

    BgeeiQ11131.
    CleanExiMM_FUT7.
    GenevestigatoriQ11131.

    Structurei

    3D structure databases

    ProteinModelPortaliQ11131.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini1 – 5555CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini79 – 389311LumenalSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei56 – 7823Helical; Signal-anchor for type II membrane proteinSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the glycosyltransferase 10 family.Curated

    Keywords - Domaini

    Signal-anchor, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG252779.
    GeneTreeiENSGT00740000115542.
    HOGENOMiHOG000045583.
    HOVERGENiHBG000274.
    InParanoidiQ0VGH5.
    KOiK07635.
    OMAiIWHWPFT.
    PhylomeDBiQ11131.
    TreeFamiTF316348.

    Family and domain databases

    InterProiIPR001503. Glyco_trans_10.
    [Graphical view]
    PANTHERiPTHR11929. PTHR11929. 1 hit.
    PfamiPF00852. Glyco_transf_10. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q11131-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MPTPCPPACL STPGTHRLLP FPDWKAPSWE SRKEATCNSS SPGPWAEPTV    50
    QGYHPTRRLR AWGGLAGGAT FMVIWFFWLW GSAPGSAPVP QSTLTILIWH 100
    WPFTNRPPEL PGDTCTRYGM ASCRLSANRS LLASADAVVF HHRELQTRQS 150
    LLPLDQRPHG QPWVWASMES PSNTHGLHRF RGIFNWVLSY RRDSDIFVPY 200
    GRLEPLSGPT SPLPAKSRMA AWVISNFQER QQRAKLYRQL APHLQVDVFG 250
    RASGRPLCAN CLLPTLARYR FYLAFENSQH RDYITEKFWR NALAAGAVPV 300
    ALGPPRATYE AFVPPDAFVH VDDFSSAREL AVFLVSMNES RYRGFFAWRD 350
    RLRVRLLGDW RERFCTICAR YPYLPRSQVY EDLESWFQA 389
    Length:389
    Mass (Da):44,495
    Last modified:October 1, 1996 - v1
    Checksum:i118FC6B2378B99C6
    GO
    Isoform 2 (identifier: Q11131-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-51: MPTPCPPACLSTPGTHRLLPFPDWKAPSWESRKEATCNSSSPGPWAEPTVQ → MNCI

    Show »
    Length:342
    Mass (Da):39,426
    Checksum:iA8BB0D124A3780EB
    GO

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 5151MPTPC…EPTVQ → MNCI in isoform 2. CuratedVSP_001781Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U45980 Genomic DNA. Translation: AAC52484.1.
    U45980 Genomic DNA. Translation: AAC52485.1.
    BC105670 mRNA. Translation: AAI05671.1.
    CCDSiCCDS15772.1. [Q11131-2]
    CCDS50530.1. [Q11131-1]
    RefSeqiNP_001170837.1. NM_001177366.1. [Q11131-1]
    NP_001170838.1. NM_001177367.1. [Q11131-2]
    NP_001276382.1. NM_001289453.1. [Q11131-2]
    NP_001276383.1. NM_001289454.1. [Q11131-2]
    NP_001276384.1. NM_001289455.1. [Q11131-2]
    NP_001276385.1. NM_001289456.1. [Q11131-2]
    NP_038552.1. NM_013524.3. [Q11131-2]
    XP_006497767.1. XM_006497704.1. [Q11131-1]
    UniGeneiMm.1203.

    Genome annotation databases

    EnsembliENSMUST00000041654; ENSMUSP00000039985; ENSMUSG00000036587. [Q11131-2]
    ENSMUST00000100320; ENSMUSP00000097895; ENSMUSG00000036587. [Q11131-1]
    ENSMUST00000114278; ENSMUSP00000109917; ENSMUSG00000036587. [Q11131-2]
    GeneIDi14347.
    KEGGimmu:14347.
    UCSCiuc012bry.1. mouse. [Q11131-1]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Web resourcesi

    Functional Glycomics Gateway - GTase

    Fucosyltransferase 7

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U45980 Genomic DNA. Translation: AAC52484.1 .
    U45980 Genomic DNA. Translation: AAC52485.1 .
    BC105670 mRNA. Translation: AAI05671.1 .
    CCDSi CCDS15772.1. [Q11131-2 ]
    CCDS50530.1. [Q11131-1 ]
    RefSeqi NP_001170837.1. NM_001177366.1. [Q11131-1 ]
    NP_001170838.1. NM_001177367.1. [Q11131-2 ]
    NP_001276382.1. NM_001289453.1. [Q11131-2 ]
    NP_001276383.1. NM_001289454.1. [Q11131-2 ]
    NP_001276384.1. NM_001289455.1. [Q11131-2 ]
    NP_001276385.1. NM_001289456.1. [Q11131-2 ]
    NP_038552.1. NM_013524.3. [Q11131-2 ]
    XP_006497767.1. XM_006497704.1. [Q11131-1 ]
    UniGenei Mm.1203.

    3D structure databases

    ProteinModelPortali Q11131.
    ModBasei Search...
    MobiDBi Search...

    Protein family/group databases

    CAZyi GT10. Glycosyltransferase Family 10.

    PTM databases

    PhosphoSitei Q11131.

    Proteomic databases

    PRIDEi Q11131.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSMUST00000041654 ; ENSMUSP00000039985 ; ENSMUSG00000036587 . [Q11131-2 ]
    ENSMUST00000100320 ; ENSMUSP00000097895 ; ENSMUSG00000036587 . [Q11131-1 ]
    ENSMUST00000114278 ; ENSMUSP00000109917 ; ENSMUSG00000036587 . [Q11131-2 ]
    GeneIDi 14347.
    KEGGi mmu:14347.
    UCSCi uc012bry.1. mouse. [Q11131-1 ]

    Organism-specific databases

    CTDi 2529.
    MGIi MGI:107692. Fut7.

    Phylogenomic databases

    eggNOGi NOG252779.
    GeneTreei ENSGT00740000115542.
    HOGENOMi HOG000045583.
    HOVERGENi HBG000274.
    InParanoidi Q0VGH5.
    KOi K07635.
    OMAi IWHWPFT.
    PhylomeDBi Q11131.
    TreeFami TF316348.

    Enzyme and pathway databases

    UniPathwayi UPA00378 .
    BRENDAi 2.4.1.152. 3474.

    Miscellaneous databases

    NextBioi 285795.
    PROi Q11131.
    SOURCEi Search...

    Gene expression databases

    Bgeei Q11131.
    CleanExi MM_FUT7.
    Genevestigatori Q11131.

    Family and domain databases

    InterProi IPR001503. Glyco_trans_10.
    [Graphical view ]
    PANTHERi PTHR11929. PTHR11929. 1 hit.
    Pfami PF00852. Glyco_transf_10. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Expression of the alpha(1,3)fucosyltransferase Fuc-TVII in lymphoid aggregate high endothelial venules correlates with expression of L-selectin ligands."
      Smith P.L., Gersten K.M., Petryniak B., Kelly R.J., Rogers C., Natsuka Y., Alford J.A. III, Scheidegger E.P., Natsuka S., Lowe J.B.
      J. Biol. Chem. 271:8250-8259(1996) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORMS 1 AND 2).
      Strain: NIH Swiss.
    2. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).

    Entry informationi

    Entry nameiFUT7_MOUSE
    AccessioniPrimary (citable) accession number: Q11131
    Secondary accession number(s): Q0VGH5
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: October 1, 1996
    Last sequence update: October 1, 1996
    Last modified: October 1, 2014
    This is version 117 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    2. PATHWAY comments
      Index of metabolic and biosynthesis pathways
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3