Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Alpha-(1,3)-fucosyltransferase 7

Gene

Fut7

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

Catalyzes alpha-1,3 glycosidic linkages involved in the expression of sialyl Lewis X antigens.By similarity

Catalytic activityi

GDP-L-fucose + alpha-2,3-Neu-N-acetyl-1,4-beta-D-galactosyl-N-acetyl-D-glucosaminyl-R = GDP + alpha-2,3-Neu-N-acetyl-1,4-beta-D-galactosyl-(alpha-1,3-L-fucosyl)-N-acetyl-D-glucosaminyl-R.By similarity

Pathwayi: protein glycosylation

This protein is involved in the pathway protein glycosylation, which is part of Protein modification.
View all proteins of this organism that are known to be involved in the pathway protein glycosylation and in Protein modification.

GO - Molecular functioni

GO - Biological processi

  • CD4-positive, CD25-positive, alpha-beta regulatory T cell differentiation Source: MGI
  • ceramide metabolic process Source: MGI
  • leukocyte migration involved in immune response Source: MGI
  • protein glycosylation Source: UniProtKB

Keywordsi

Molecular functionGlycosyltransferase, Transferase

Enzyme and pathway databases

BRENDAi2.4.1.152 3474
UniPathwayiUPA00378

Protein family/group databases

CAZyiGT10 Glycosyltransferase Family 10

Names & Taxonomyi

Protein namesi
Recommended name:
Alpha-(1,3)-fucosyltransferase 7 (EC:2.4.1.-By similarity)
Alternative name(s):
Fucosyltransferase 7
Fucosyltransferase VII
Short name:
Fuc-TVII
Short name:
FucT-VII
Galactoside 3-L-fucosyltransferase
Gene namesi
Name:Fut7
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 2

Organism-specific databases

MGIiMGI:107692 Fut7

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 55CytoplasmicSequence analysisAdd BLAST55
Transmembranei56 – 78Helical; Signal-anchor for type II membrane proteinSequence analysisAdd BLAST23
Topological domaini79 – 389LumenalSequence analysisAdd BLAST311

Keywords - Cellular componenti

Golgi apparatus, Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002211141 – 389Alpha-(1,3)-fucosyltransferase 7Add BLAST389

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi115 ↔ 123By similarity
Glycosylationi128N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi258 ↔ 261By similarity
Glycosylationi338N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi365 ↔ 368By similarity

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiQ11131
PRIDEiQ11131

PTM databases

iPTMnetiQ11131
PhosphoSitePlusiQ11131

Expressioni

Tissue specificityi

Highly expressed in lung and bone marrow and to a much lesser extent in spleen, salivary gland and skeletal muscle.1 Publication

Gene expression databases

BgeeiENSMUSG00000036587
CleanExiMM_FUT7
ExpressionAtlasiQ11131 baseline and differential
GenevisibleiQ11131 MM

Interactioni

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000097895

Structurei

3D structure databases

ProteinModelPortaliQ11131
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the glycosyltransferase 10 family.Curated

Keywords - Domaini

Signal-anchor, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG2619 Eukaryota
ENOG410ZIMX LUCA
GeneTreeiENSGT00680000099679
HOGENOMiHOG000045583
HOVERGENiHBG000274
InParanoidiQ11131
KOiK07635
OMAiVWVSLES
OrthoDBiEOG091G0846
PhylomeDBiQ11131
TreeFamiTF316348

Family and domain databases

Gene3Di3.40.50.11660, 1 hit
InterProiView protein in InterPro
IPR031481 Glyco_tran_10_N
IPR001503 Glyco_trans_10
IPR038577 GT10-like_sf
PANTHERiPTHR11929 PTHR11929, 1 hit
PfamiView protein in Pfam
PF17039 Glyco_tran_10_N, 1 hit
PF00852 Glyco_transf_10, 1 hit

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q11131-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MPTPCPPACL STPGTHRLLP FPDWKAPSWE SRKEATCNSS SPGPWAEPTV
60 70 80 90 100
QGYHPTRRLR AWGGLAGGAT FMVIWFFWLW GSAPGSAPVP QSTLTILIWH
110 120 130 140 150
WPFTNRPPEL PGDTCTRYGM ASCRLSANRS LLASADAVVF HHRELQTRQS
160 170 180 190 200
LLPLDQRPHG QPWVWASMES PSNTHGLHRF RGIFNWVLSY RRDSDIFVPY
210 220 230 240 250
GRLEPLSGPT SPLPAKSRMA AWVISNFQER QQRAKLYRQL APHLQVDVFG
260 270 280 290 300
RASGRPLCAN CLLPTLARYR FYLAFENSQH RDYITEKFWR NALAAGAVPV
310 320 330 340 350
ALGPPRATYE AFVPPDAFVH VDDFSSAREL AVFLVSMNES RYRGFFAWRD
360 370 380
RLRVRLLGDW RERFCTICAR YPYLPRSQVY EDLESWFQA
Length:389
Mass (Da):44,495
Last modified:October 1, 1996 - v1
Checksum:i118FC6B2378B99C6
GO
Isoform 2 (identifier: Q11131-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-51: MPTPCPPACLSTPGTHRLLPFPDWKAPSWESRKEATCNSSSPGPWAEPTVQ → MNCI

Show »
Length:342
Mass (Da):39,426
Checksum:iA8BB0D124A3780EB
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0017811 – 51MPTPC…EPTVQ → MNCI in isoform 2. CuratedAdd BLAST51

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U45980 Genomic DNA Translation: AAC52484.1
U45980 Genomic DNA Translation: AAC52485.1
BC105670 mRNA Translation: AAI05671.1
CCDSiCCDS15772.1 [Q11131-2]
CCDS50530.1 [Q11131-1]
RefSeqiNP_001170837.1, NM_001177366.1 [Q11131-1]
NP_001170838.1, NM_001177367.1 [Q11131-2]
NP_001276382.1, NM_001289453.1 [Q11131-2]
NP_001276383.1, NM_001289454.1 [Q11131-2]
NP_001276384.1, NM_001289455.1 [Q11131-2]
NP_001276385.1, NM_001289456.1 [Q11131-2]
NP_038552.1, NM_013524.3 [Q11131-2]
XP_006497767.1, XM_006497704.1 [Q11131-1]
UniGeneiMm.1203

Genome annotation databases

EnsembliENSMUST00000041654; ENSMUSP00000039985; ENSMUSG00000036587 [Q11131-2]
ENSMUST00000100320; ENSMUSP00000097895; ENSMUSG00000036587 [Q11131-1]
ENSMUST00000114278; ENSMUSP00000109917; ENSMUSG00000036587 [Q11131-2]
GeneIDi14347
KEGGimmu:14347
UCSCiuc012bry.1 mouse [Q11131-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiFUT7_MOUSE
AccessioniPrimary (citable) accession number: Q11131
Secondary accession number(s): Q0VGH5
Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 1, 1996
Last sequence update: October 1, 1996
Last modified: March 28, 2018
This is version 138 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  3. SIMILARITY comments
    Index of protein domains and families

Cookie policy

We would like to use anonymized google analytics cookies to gather statistics on how uniprot.org is used in aggregate. Learn more

UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health