Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q11131

- FUT7_MOUSE

UniProt

Q11131 - FUT7_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Alpha-(1,3)-fucosyltransferase 7

Gene

Fut7

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at transcript leveli

Functioni

May catalyze alpha-1,3 glycosidic linkages involved in the expression of sialyl Lewis X antigens.

Catalytic activityi

GDP-L-fucose + alpha-2,3-Neu-N-acetyl-1,4-beta-D-galactosyl-N-acetyl-D-glucosaminyl-R = GDP + alpha-2,3-Neu-N-acetyl-1,4-beta-D-galactosyl-(alpha-1,3-L-fucosyl)-N-acetyl-D-glucosaminyl-R.

Pathwayi

GO - Molecular functioni

  1. fucosyltransferase activity Source: InterPro

GO - Biological processi

  1. CD4-positive, CD25-positive, alpha-beta regulatory T cell differentiation Source: MGI
  2. leukocyte migration involved in immune response Source: MGI
  3. protein glycosylation Source: UniProtKB-UniPathway
Complete GO annotation...

Keywords - Molecular functioni

Glycosyltransferase, Transferase

Enzyme and pathway databases

BRENDAi2.4.1.152. 3474.
UniPathwayiUPA00378.

Protein family/group databases

CAZyiGT10. Glycosyltransferase Family 10.

Names & Taxonomyi

Protein namesi
Recommended name:
Alpha-(1,3)-fucosyltransferase 7 (EC:2.4.1.-)
Alternative name(s):
Fucosyltransferase 7
Fucosyltransferase VII
Short name:
Fuc-TVII
Short name:
FucT-VII
Galactoside 3-L-fucosyltransferase
Gene namesi
Name:Fut7
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome 2

Organism-specific databases

MGIiMGI:107692. Fut7.

Subcellular locationi

Golgi apparatusGolgi stack membrane; Single-pass type II membrane protein
Note: Membrane-bound form in trans cisternae of Golgi.

GO - Cellular componenti

  1. Golgi apparatus Source: UniProtKB-KW
  2. integral component of membrane Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Golgi apparatus, Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 389389Alpha-(1,3)-fucosyltransferase 7PRO_0000221114Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi115 ↔ 123By similarity
Glycosylationi128 – 1281N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi258 ↔ 261By similarity
Glycosylationi338 – 3381N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi365 ↔ 368By similarity

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PRIDEiQ11131.

PTM databases

PhosphoSiteiQ11131.

Expressioni

Tissue specificityi

Highly expressed in lung and bone marrow and to a much lesser extent in spleen, salivary gland and skeletal muscle.

Gene expression databases

BgeeiQ11131.
CleanExiMM_FUT7.
ExpressionAtlasiQ11131. baseline and differential.
GenevestigatoriQ11131.

Structurei

3D structure databases

ProteinModelPortaliQ11131.
ModBaseiSearch...
MobiDBiSearch...

Topological domain

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 5555CytoplasmicSequence AnalysisAdd
BLAST
Topological domaini79 – 389311LumenalSequence AnalysisAdd
BLAST

Transmembrane

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei56 – 7823Helical; Signal-anchor for type II membrane proteinSequence AnalysisAdd
BLAST

Family & Domainsi

Sequence similaritiesi

Belongs to the glycosyltransferase 10 family.Curated

Keywords - Domaini

Signal-anchor, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG252779.
GeneTreeiENSGT00680000099679.
HOGENOMiHOG000045583.
HOVERGENiHBG000274.
InParanoidiQ11131.
KOiK07635.
OMAiIWHWPFT.
PhylomeDBiQ11131.
TreeFamiTF316348.

Family and domain databases

InterProiIPR001503. Glyco_trans_10.
[Graphical view]
PANTHERiPTHR11929. PTHR11929. 1 hit.
PfamiPF00852. Glyco_transf_10. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q11131-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MPTPCPPACL STPGTHRLLP FPDWKAPSWE SRKEATCNSS SPGPWAEPTV
60 70 80 90 100
QGYHPTRRLR AWGGLAGGAT FMVIWFFWLW GSAPGSAPVP QSTLTILIWH
110 120 130 140 150
WPFTNRPPEL PGDTCTRYGM ASCRLSANRS LLASADAVVF HHRELQTRQS
160 170 180 190 200
LLPLDQRPHG QPWVWASMES PSNTHGLHRF RGIFNWVLSY RRDSDIFVPY
210 220 230 240 250
GRLEPLSGPT SPLPAKSRMA AWVISNFQER QQRAKLYRQL APHLQVDVFG
260 270 280 290 300
RASGRPLCAN CLLPTLARYR FYLAFENSQH RDYITEKFWR NALAAGAVPV
310 320 330 340 350
ALGPPRATYE AFVPPDAFVH VDDFSSAREL AVFLVSMNES RYRGFFAWRD
360 370 380
RLRVRLLGDW RERFCTICAR YPYLPRSQVY EDLESWFQA
Length:389
Mass (Da):44,495
Last modified:October 1, 1996 - v1
Checksum:i118FC6B2378B99C6
GO
Isoform 2 (identifier: Q11131-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-51: MPTPCPPACLSTPGTHRLLPFPDWKAPSWESRKEATCNSSSPGPWAEPTVQ → MNCI

Show »
Length:342
Mass (Da):39,426
Checksum:iA8BB0D124A3780EB
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 5151MPTPC…EPTVQ → MNCI in isoform 2. CuratedVSP_001781Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U45980 Genomic DNA. Translation: AAC52484.1.
U45980 Genomic DNA. Translation: AAC52485.1.
BC105670 mRNA. Translation: AAI05671.1.
CCDSiCCDS15772.1. [Q11131-2]
CCDS50530.1. [Q11131-1]
RefSeqiNP_001170837.1. NM_001177366.1. [Q11131-1]
NP_001170838.1. NM_001177367.1. [Q11131-2]
NP_001276382.1. NM_001289453.1. [Q11131-2]
NP_001276383.1. NM_001289454.1. [Q11131-2]
NP_001276384.1. NM_001289455.1. [Q11131-2]
NP_001276385.1. NM_001289456.1. [Q11131-2]
NP_038552.1. NM_013524.3. [Q11131-2]
XP_006497767.1. XM_006497704.1. [Q11131-1]
UniGeneiMm.1203.

Genome annotation databases

EnsembliENSMUST00000041654; ENSMUSP00000039985; ENSMUSG00000036587. [Q11131-2]
ENSMUST00000100320; ENSMUSP00000097895; ENSMUSG00000036587. [Q11131-1]
ENSMUST00000114278; ENSMUSP00000109917; ENSMUSG00000036587. [Q11131-2]
GeneIDi14347.
KEGGimmu:14347.
UCSCiuc012bry.1. mouse. [Q11131-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Web resourcesi

Functional Glycomics Gateway - GTase

Fucosyltransferase 7

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U45980 Genomic DNA. Translation: AAC52484.1 .
U45980 Genomic DNA. Translation: AAC52485.1 .
BC105670 mRNA. Translation: AAI05671.1 .
CCDSi CCDS15772.1. [Q11131-2 ]
CCDS50530.1. [Q11131-1 ]
RefSeqi NP_001170837.1. NM_001177366.1. [Q11131-1 ]
NP_001170838.1. NM_001177367.1. [Q11131-2 ]
NP_001276382.1. NM_001289453.1. [Q11131-2 ]
NP_001276383.1. NM_001289454.1. [Q11131-2 ]
NP_001276384.1. NM_001289455.1. [Q11131-2 ]
NP_001276385.1. NM_001289456.1. [Q11131-2 ]
NP_038552.1. NM_013524.3. [Q11131-2 ]
XP_006497767.1. XM_006497704.1. [Q11131-1 ]
UniGenei Mm.1203.

3D structure databases

ProteinModelPortali Q11131.
ModBasei Search...
MobiDBi Search...

Protein family/group databases

CAZyi GT10. Glycosyltransferase Family 10.

PTM databases

PhosphoSitei Q11131.

Proteomic databases

PRIDEi Q11131.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSMUST00000041654 ; ENSMUSP00000039985 ; ENSMUSG00000036587 . [Q11131-2 ]
ENSMUST00000100320 ; ENSMUSP00000097895 ; ENSMUSG00000036587 . [Q11131-1 ]
ENSMUST00000114278 ; ENSMUSP00000109917 ; ENSMUSG00000036587 . [Q11131-2 ]
GeneIDi 14347.
KEGGi mmu:14347.
UCSCi uc012bry.1. mouse. [Q11131-1 ]

Organism-specific databases

CTDi 2529.
MGIi MGI:107692. Fut7.

Phylogenomic databases

eggNOGi NOG252779.
GeneTreei ENSGT00680000099679.
HOGENOMi HOG000045583.
HOVERGENi HBG000274.
InParanoidi Q11131.
KOi K07635.
OMAi IWHWPFT.
PhylomeDBi Q11131.
TreeFami TF316348.

Enzyme and pathway databases

UniPathwayi UPA00378 .
BRENDAi 2.4.1.152. 3474.

Miscellaneous databases

NextBioi 285795.
PROi Q11131.
SOURCEi Search...

Gene expression databases

Bgeei Q11131.
CleanExi MM_FUT7.
ExpressionAtlasi Q11131. baseline and differential.
Genevestigatori Q11131.

Family and domain databases

InterProi IPR001503. Glyco_trans_10.
[Graphical view ]
PANTHERi PTHR11929. PTHR11929. 1 hit.
Pfami PF00852. Glyco_transf_10. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Expression of the alpha(1,3)fucosyltransferase Fuc-TVII in lymphoid aggregate high endothelial venules correlates with expression of L-selectin ligands."
    Smith P.L., Gersten K.M., Petryniak B., Kelly R.J., Rogers C., Natsuka Y., Alford J.A. III, Scheidegger E.P., Natsuka S., Lowe J.B.
    J. Biol. Chem. 271:8250-8259(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORMS 1 AND 2).
    Strain: NIH Swiss.
  2. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).

Entry informationi

Entry nameiFUT7_MOUSE
AccessioniPrimary (citable) accession number: Q11131
Secondary accession number(s): Q0VGH5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 1, 1996
Last sequence update: October 1, 1996
Last modified: October 29, 2014
This is version 118 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3