Q11131 (FUT7_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 106.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Alpha-(1,3)-fucosyltransferase EC=2.4.1.- Alternative name(s): Fucosyltransferase 7 Fucosyltransferase VII Short name=Fuc-TVII Short name=FucT-VII Galactoside 3-L-fucosyltransferase | ||
| Gene names |
| ||
| Organism | Mus musculus (Mouse) [Reference proteome] | ||
| Taxonomic identifier | 10090 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus![]() |
Protein attributes
| Sequence length | 389 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | May catalyze alpha-1,3 glycosidic linkages involved in the expression of sialyl Lewis X antigens. |
| Catalytic activity | GDP-L-fucose + alpha-2,3-Neu-N-acetyl-1,4-beta-D-galactosyl-N-acetyl-D-glucosaminyl-R = GDP + alpha-2,3-Neu-N-acetyl-1,4-beta-D-galactosyl-(alpha-1,3-L-fucosyl)-N-acetyl-D-glucosaminyl-R. |
| Pathway | |
| Subcellular location | Golgi apparatus › Golgi stack membrane; Single-pass type II membrane protein. Note: Membrane-bound form in trans cisternae of Golgi. |
| Tissue specificity | Highly expressed in lung and bone marrow and to a much lesser extent in spleen, salivary gland and skeletal muscle. |
| Sequence similarities | Belongs to the glycosyltransferase 10 family. |
Ontologies
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q11131-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q11131-2) The sequence of this isoform differs from the canonical sequence as follows: 1-51: MPTPCPPACLSTPGTHRLLPFPDWKAPSWESRKEATCNSSSPGPWAEPTVQ → MNCI |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 389 | 389 | Alpha-(1,3)-fucosyltransferase | PRO_0000221114 | |||||||
Regions | |||||||||||
| Topological domain | 1 – 55 | 55 | Cytoplasmic Potential | ||||||||
| Transmembrane | 56 – 78 | 23 | Helical; Signal-anchor for type II membrane protein; Potential | ||||||||
| Topological domain | 79 – 389 | 311 | Lumenal Potential | ||||||||
Amino acid modifications | |||||||||||
| Glycosylation | 128 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 338 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Disulfide bond | 115 ↔ 123 | By similarity | |||||||||
| Disulfide bond | 258 ↔ 261 | By similarity | |||||||||
| Disulfide bond | 365 ↔ 368 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 1 – 51 | 51 | MPTPC…EPTVQ → MNCI in isoform 2. | VSP_001781 | |||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Expression of the alpha(1,3)fucosyltransferase Fuc-TVII in lymphoid aggregate high endothelial venules correlates with expression of L-selectin ligands." Smith P.L., Gersten K.M., Petryniak B., Kelly R.J., Rogers C., Natsuka Y., Alford J.A. III, Scheidegger E.P., Natsuka S., Lowe J.B. J. Biol. Chem. 271:8250-8259(1996) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORMS 1 AND 2). Strain: NIH Swiss. |
| [2] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| + | Additional computationally mapped references. |
Web resources
| Functional Glycomics Gateway - GTase Fucosyltransferase 7 |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | U45980 Genomic DNA. Translation: AAC52484.1. U45980 Genomic DNA. Translation: AAC52485.1. BC105670 mRNA. Translation: AAI05671.1. |
| IPI | IPI00131018. IPI00222475. |
| RefSeq | NP_001170837.1. NM_001177366.1. NP_001170838.1. NM_001177367.1. NP_038552.1. NM_013524.3. |
| UniGene | Mm.1203. |
3D structure databases | |
| ProteinModelPortal | Q11131. |
| ModBase | Search... |
Protein family/group databases | |
| CAZy | GT10. Glycosyltransferase Family 10. |
PTM databases | |
| PhosphoSite | Q11131. |
Proteomic databases | |
| PRIDE | Q11131. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSMUST00000041654; ENSMUSP00000039985; ENSMUSG00000036587. ENSMUST00000100320; ENSMUSP00000097895; ENSMUSG00000036587. ENSMUST00000114278; ENSMUSP00000109917; ENSMUSG00000036587. |
| GeneID | 14347. |
| KEGG | mmu:14347. |
| UCSC | uc012bry.1. mouse. |
Organism-specific databases | |
| CTD | 2529. |
| MGI | MGI:107692. Fut7. |
Phylogenomic databases | |
| eggNOG | NOG252779. |
| GeneTree | ENSGT00680000099679. |
| HOGENOM | HOG000045583. |
| HOVERGEN | HBG000274. |
| InParanoid | Q0VGH5. |
| KO | K07635. |
| OMA | HHRELQT. |
| OrthoDB | EOG4R7VBK. |
Enzyme and pathway databases | |
| BRENDA | 2.4.1.152. 3474. |
| UniPathway | UPA00378. |
Gene expression databases | |
| ArrayExpress | Q11131. |
| Bgee | Q11131. |
| CleanEx | MM_FUT7. |
| Genevestigator | Q11131. |
| GermOnline | ENSMUSG00000036587. Mus musculus. |
Family and domain databases | |
| InterPro | IPR001503. Glyco_trans_10. [Graphical view] |
| PANTHER | PTHR11929. PTHR11929. 1 hit. |
| Pfam | PF00852. Glyco_transf_10. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 285795. |
| SOURCE | Search... |
Entry information
| Entry name | FUT7_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q11131 Secondary accession number(s): Q0VGH5 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| PATHWAY comments Index of metabolic and biosynthesis pathways |
| SIMILARITY comments Index of protein domains and families |

Clusters with
