Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q11131 (FUT7_MOUSE) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 116. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (3) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Alpha-(1,3)-fucosyltransferase 7

EC=2.4.1.-
Alternative name(s):
Fucosyltransferase 7
Fucosyltransferase VII
Short name=Fuc-TVII
Short name=FucT-VII
Galactoside 3-L-fucosyltransferase
Gene names
Name:Fut7
OrganismMus musculus (Mouse) [Reference proteome]
Taxonomic identifier10090 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus

Protein attributes

Sequence length389 AA.
Sequence statusComplete.
Protein existenceEvidence at transcript level

General annotation (Comments)

Function

May catalyze alpha-1,3 glycosidic linkages involved in the expression of sialyl Lewis X antigens.

Catalytic activity

GDP-L-fucose + alpha-2,3-Neu-N-acetyl-1,4-beta-D-galactosyl-N-acetyl-D-glucosaminyl-R = GDP + alpha-2,3-Neu-N-acetyl-1,4-beta-D-galactosyl-(alpha-1,3-L-fucosyl)-N-acetyl-D-glucosaminyl-R.

Pathway

Protein modification; protein glycosylation.

Subcellular location

Golgi apparatusGolgi stack membrane; Single-pass type II membrane protein. Note: Membrane-bound form in trans cisternae of Golgi.

Tissue specificity

Highly expressed in lung and bone marrow and to a much lesser extent in spleen, salivary gland and skeletal muscle.

Sequence similarities

Belongs to the glycosyltransferase 10 family.

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q11131-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q11131-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1-51: MPTPCPPACLSTPGTHRLLPFPDWKAPSWESRKEATCNSSSPGPWAEPTVQ → MNCI

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 389389Alpha-(1,3)-fucosyltransferase 7
PRO_0000221114

Regions

Topological domain1 – 5555Cytoplasmic Potential
Transmembrane56 – 7823Helical; Signal-anchor for type II membrane protein; Potential
Topological domain79 – 389311Lumenal Potential

Amino acid modifications

Glycosylation1281N-linked (GlcNAc...) Potential
Glycosylation3381N-linked (GlcNAc...) Potential
Disulfide bond115 ↔ 123 By similarity
Disulfide bond258 ↔ 261 By similarity
Disulfide bond365 ↔ 368 By similarity

Natural variations

Alternative sequence1 – 5151MPTPC…EPTVQ → MNCI in isoform 2.
VSP_001781

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified October 1, 1996. Version 1.
Checksum: 118FC6B2378B99C6

FASTA38944,495
        10         20         30         40         50         60 
MPTPCPPACL STPGTHRLLP FPDWKAPSWE SRKEATCNSS SPGPWAEPTV QGYHPTRRLR 

        70         80         90        100        110        120 
AWGGLAGGAT FMVIWFFWLW GSAPGSAPVP QSTLTILIWH WPFTNRPPEL PGDTCTRYGM 

       130        140        150        160        170        180 
ASCRLSANRS LLASADAVVF HHRELQTRQS LLPLDQRPHG QPWVWASMES PSNTHGLHRF 

       190        200        210        220        230        240 
RGIFNWVLSY RRDSDIFVPY GRLEPLSGPT SPLPAKSRMA AWVISNFQER QQRAKLYRQL 

       250        260        270        280        290        300 
APHLQVDVFG RASGRPLCAN CLLPTLARYR FYLAFENSQH RDYITEKFWR NALAAGAVPV 

       310        320        330        340        350        360 
ALGPPRATYE AFVPPDAFVH VDDFSSAREL AVFLVSMNES RYRGFFAWRD RLRVRLLGDW 

       370        380 
RERFCTICAR YPYLPRSQVY EDLESWFQA 

« Hide

Isoform 2 [UniParc].

Checksum: A8BB0D124A3780EB
Show »

FASTA34239,426

References

« Hide 'large scale' references
[1]"Expression of the alpha(1,3)fucosyltransferase Fuc-TVII in lymphoid aggregate high endothelial venules correlates with expression of L-selectin ligands."
Smith P.L., Gersten K.M., Petryniak B., Kelly R.J., Rogers C., Natsuka Y., Alford J.A. III, Scheidegger E.P., Natsuka S., Lowe J.B.
J. Biol. Chem. 271:8250-8259(1996) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORMS 1 AND 2).
Strain: NIH Swiss.
[2]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
+Additional computationally mapped references.

Web resources

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
U45980 Genomic DNA. Translation: AAC52484.1.
U45980 Genomic DNA. Translation: AAC52485.1.
BC105670 mRNA. Translation: AAI05671.1.
CCDSCCDS15772.1. [Q11131-2]
CCDS50530.1. [Q11131-1]
RefSeqNP_001170837.1. NM_001177366.1. [Q11131-1]
NP_001170838.1. NM_001177367.1. [Q11131-2]
NP_001276382.1. NM_001289453.1. [Q11131-2]
NP_001276383.1. NM_001289454.1. [Q11131-2]
NP_001276384.1. NM_001289455.1. [Q11131-2]
NP_001276385.1. NM_001289456.1. [Q11131-2]
NP_038552.1. NM_013524.3. [Q11131-2]
XP_006497767.1. XM_006497704.1. [Q11131-1]
UniGeneMm.1203.

3D structure databases

ProteinModelPortalQ11131.
ModBaseSearch...
MobiDBSearch...

Protein family/group databases

CAZyGT10. Glycosyltransferase Family 10.

PTM databases

PhosphoSiteQ11131.

Proteomic databases

PRIDEQ11131.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENSMUST00000041654; ENSMUSP00000039985; ENSMUSG00000036587. [Q11131-2]
ENSMUST00000100320; ENSMUSP00000097895; ENSMUSG00000036587. [Q11131-1]
ENSMUST00000114278; ENSMUSP00000109917; ENSMUSG00000036587. [Q11131-2]
GeneID14347.
KEGGmmu:14347.
UCSCuc012bry.1. mouse. [Q11131-1]

Organism-specific databases

CTD2529.
MGIMGI:107692. Fut7.

Phylogenomic databases

eggNOGNOG252779.
GeneTreeENSGT00740000115542.
HOGENOMHOG000045583.
HOVERGENHBG000274.
InParanoidQ0VGH5.
KOK07635.
OMAIWHWPFT.
PhylomeDBQ11131.
TreeFamTF316348.

Enzyme and pathway databases

BRENDA2.4.1.152. 3474.
UniPathwayUPA00378.

Gene expression databases

BgeeQ11131.
CleanExMM_FUT7.
GenevestigatorQ11131.

Family and domain databases

InterProIPR001503. Glyco_trans_10.
[Graphical view]
PANTHERPTHR11929. PTHR11929. 1 hit.
PfamPF00852. Glyco_transf_10. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

NextBio285795.
PROQ11131.
SOURCESearch...

Entry information

Entry nameFUT7_MOUSE
AccessionPrimary (citable) accession number: Q11131
Secondary accession number(s): Q0VGH5
Entry history
Integrated into UniProtKB/Swiss-Prot: October 1, 1996
Last sequence update: October 1, 1996
Last modified: July 9, 2014
This is version 116 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families

PATHWAY comments

Index of metabolic and biosynthesis pathways

MGD cross-references

Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot