Q10711 (ECE2_BOVIN) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 99.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Endothelin-converting enzyme 2 Short name=ECE-2 | ||
| Gene names |
| ||
| Organism | Bos taurus (Bovine) [Reference proteome] | ||
| Taxonomic identifier | 9913 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Laurasiatheria › Cetartiodactyla › Ruminantia › Pecora › Bovidae › Bovinae › Bos![]() |
Protein attributes
| Sequence length | 883 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Converts big endothelin-1 to endothelin-1. Also involved in the processing of various neuroendocrine peptides, including neurotensin, angiotensin I, substance P, proenkephalin-derived peptides, and prodynorphin-derived peptides. May limit beta-amyloid peptide accumulation in brain. May also have methyltransferase activity. |
| Catalytic activity | Hydrolysis of the 21-Trp-|-Val-22 bond in big endothelin to form endothelin 1. |
| Cofactor | Binds 1 zinc ion per subunit By similarity. |
| Enzyme regulation | Inhibited by phosphoramidon. |
| Subunit structure | Homodimer. |
| Subcellular location | Golgi apparatus membrane; Single-pass type II membrane protein. Cytoplasmic granule membrane; Single-pass type II membrane protein Ref.1. |
| Tissue specificity | Isoform 1 and isoform 2 are expressed in liver, kidney, adrenal gland, testis and endothelial cells. Isoform 3 and isoform 4 are expressed in brain and adrenal gland. Ref.1 |
| Sequence similarities | In the N-terminal section; belongs to the methyltransferase superfamily. In the C-terminal section; belongs to the peptidase M13 family. |
| Biophysicochemical properties | pH dependence: Optimum pH is 5.5. Inactive at neutral pH. |
| Sequence caution | The sequence AAA82927.1 differs from that shown. Reason: Frameshift at position 78. The sequence AAO72360.1 differs from that shown. Reason: Frameshift at position 78. The sequence AAO72361.1 differs from that shown. Reason: Frameshift at position 78. |
Ontologies
Alternative products
| This entry describes 5 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q10711-1) Also known as: ECE-2a-1; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q10711-2) Also known as: ECE-2a-2; The sequence of this isoform differs from the canonical sequence as follows: 161-161: A → MVEYKRATLRDEDAPETPVEGGASPDAVEA | ||||||
| Isoform 3 (identifier: Q10711-3) Also known as: ECE-2b-1; The sequence of this isoform differs from the canonical sequence as follows: 1-160: MACLGPSAQV...VHTVDQVLNE → MRVALQELGGGGN | ||||||
| Isoform 4 (identifier: Q10711-4) Also known as: ECE-2b-2; The sequence of this isoform differs from the canonical sequence as follows: 1-160: MACLGPSAQV...VHTVDQVLNE → MRVALQELGGGGN 161-161: A → MVEYKRATLRDEDAPETPVEGGASPDAVEA | ||||||
| Isoform 5 (identifier: Q10711-5) The sequence of this isoform differs from the canonical sequence as follows: 161-255: AGFRKRTSRL...WIRRNPLPDG → VSRVLVPAGR...HEDFLSAIQL 256-883: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 883 | 883 | Endothelin-converting enzyme 2 | PRO_0000078222 | |||||
Regions | |||||||||
| Topological domain | 1 – 178 | 178 | Cytoplasmic Potential | ||||||
| Transmembrane | 179 – 199 | 21 | Helical; Signal-anchor for type II membrane protein; Potential | ||||||
| Topological domain | 200 – 883 | 684 | Lumenal Potential | ||||||
| Region | 1 – 160 | 160 | Methyltransferase-like region | ||||||
| Region | 88 – 89 | 2 | S-adenosyl-L-homocysteine binding By similarity | ||||||
| Region | 113 – 114 | 2 | S-adenosyl-L-homocysteine binding By similarity | ||||||
| Region | 200 – 883 | 684 | Endothelin-converting enzyme 2 region | ||||||
Sites | |||||||||
| Active site | 721 | 1 | By similarity | ||||||
| Active site | 784 | 1 | Proton donor By similarity | ||||||
| Metal binding | 720 | 1 | Zinc; catalytic By similarity | ||||||
| Metal binding | 724 | 1 | Zinc; catalytic By similarity | ||||||
| Metal binding | 780 | 1 | Zinc; catalytic By similarity | ||||||
| Binding site | 30 | 1 | S-adenosyl-L-homocysteine By similarity | ||||||
| Binding site | 41 | 1 | S-adenosyl-L-homocysteine; via amide nitrogen By similarity | ||||||
| Binding site | 66 | 1 | S-adenosyl-L-homocysteine; via carbonyl oxygen By similarity | ||||||
| Binding site | 130 | 1 | S-adenosyl-L-homocysteine By similarity | ||||||
Amino acid modifications | |||||||||
| Modified residue | 39 | 1 | Phosphotyrosine By similarity | ||||||
| Glycosylation | 283 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 324 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 384 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 429 | 1 | N-linked (GlcNAc...) Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 160 | 160 | MACLG…QVLNE → MRVALQELGGGGN in isoform 3 and isoform 4. | VSP_029329 | |||||
| Alternative sequence | 161 – 255 | 95 | AGFRK…PLPDG → VSRVLVPAGRFISLTSAAPH FRTRHYAQAHYGWSLRHATY GNGFQFHFYLMQKGKELSVA QLAVGAQILSPPRPPTPSCF LQDSDHEDFLSAIQL in isoform 5. | VSP_029330 | |||||
| Alternative sequence | 161 | 1 | A → MVEYKRATLRDEDAPETPVE GGASPDAVEA in isoform 2 and isoform 4. | VSP_029331 | |||||
| Alternative sequence | 256 – 883 | 628 | Missing in isoform 5. | VSP_029332 | |||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Molecular isolation and characterization of novel four subisoforms of ECE-2." Ikeda S., Emoto N., Alimsardjono H., Yokoyama M., Matsuo M. Biochem. Biophys. Res. Commun. 293:421-426(2002) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 3 AND 4), NUCLEOTIDE SEQUENCE [MRNA] OF 59-883 (ISOFORMS 1 AND 2), TISSUE SPECIFICITY, SUBCELLULAR LOCATION. |
| [2] | NIH - Mammalian Gene Collection (MGC) project Submitted (JUN-2007) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 5). Strain: Hereford. Tissue: Thymus. |
| [3] | "Endothelin-converting enzyme-2 is a membrane-bound, phosphoramidon-sensitive metalloprotease with acidic pH optimum." Emoto N., Yanagisawa M. J. Biol. Chem. 270:15262-15268(1995) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 59-883 (ISOFORM 1). |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF489573 mRNA. Translation: AAO72360.1. Frameshift. AF489574 mRNA. Translation: AAO72361.1. Frameshift. BC142117 mRNA. Translation: AAI42118.1. U27341 mRNA. Translation: AAA82927.1. Frameshift. |
| IPI | IPI00691881. IPI00696952. IPI00711229. IPI00854347. IPI01017646. |
| RefSeq | NP_776471.2. NM_174046.3. NP_808871.2. NM_177956.2. |
| UniGene | Bt.4840. |
3D structure databases | |
| ProteinModelPortal | Q10711. |
| SMR | Q10711. Positions 19-160. |
| ModBase | Search... |
Protein family/group databases | |
| MEROPS | M13.003. |
Proteomic databases | |
| PRIDE | Q10711. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| GeneID | 281134. |
| KEGG | bta:281134. |
Organism-specific databases | |
| CTD | 9718. |
Phylogenomic databases | |
| eggNOG | COG3590. |
| HOGENOM | HOG000245574. |
| HOVERGEN | HBG005554. |
| KO | K01415. |
Family and domain databases | |
| Gene3D | 3.40.390.10. 2 hits. |
| InterPro | IPR024079. MetalloPept_cat_dom. IPR013216. Methyltransf_11. IPR000718. Peptidase_M13. IPR018497. Peptidase_M13_C. IPR008753. Peptidase_M13_N. [Graphical view] |
| PANTHER | PTHR11733. PTHR11733. 1 hit. |
| Pfam | PF08241. Methyltransf_11. 1 hit. PF01431. Peptidase_M13. 1 hit. PF05649. Peptidase_M13_N. 1 hit. [Graphical view] |
| PRINTS | PR00786. NEPRILYSIN. |
| PROSITE | PS00142. ZINC_PROTEASE. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChEMBL | CHEMBL3850. |
| NextBio | 20805201. |
Entry information
| Entry name | ECE2_BOVIN | ||||||||
| Accession | Primary (citable) accession number: Q10711 Secondary accession number(s): A5PJH8, Q547G8, Q865C4 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| Peptidase families Classification of peptidase families and list of entries |
| SIMILARITY comments Index of protein domains and families |

Clusters with
