Q0VG06 (FP100_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 63.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Fanconi anemia-associated protein of 100 kDa | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 881 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Plays a role in Fanconi anemia-associated DNA damage response network. Regulates FANCD2 monoubiquitination and the stability of the FA core complex. Induces chromosomal instability as well as hypersensitivity to DNA cross-linking agents, when repressed. Ref.6 |
| Subunit structure | Belongs to the multisubunit FA complex composed of FANCA, FANCB, FANCC, FANCE, FANCF, FANCG, FANCL/PHF9, FANCM, FAAP24 and FAAP100. Forms a subcomplex with FANCB and FANCL. Ref.6 |
| Subcellular location | |
| Sequence caution | The sequence AAH21968.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. The sequence BAB15251.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. The sequence CAD39037.2 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. |
Ontologies
| Keywords | |
|---|---|
| Biological process | DNA damage DNA repair |
| Cellular component | Nucleus |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Ligand | DNA-binding |
| PTM | Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | DNA repair Traceable author statement. Source: Reactome |
| Cellular_component | cytoplasm Inferred from direct assay. Source: HPA intermediate filament cytoskeletonInferred from direct assay. Source: HPA nucleoplasmTraceable author statement. Source: Reactome |
| Molecular_function | DNA binding Inferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q0VG06-1) Also known as: b; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q0VG06-2) The sequence of this isoform differs from the canonical sequence as follows: 1-628: Missing. 629-665: SDVLPEQEGVCLPLSRHTVDMLQCLRFPGLAPPHTRA → MPASFPMLRCARSPCWTVCWSPWCRALPDGRCSCLSS | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q0VG06-3) Also known as: a; The sequence of this isoform differs from the canonical sequence as follows: 1-151: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 881 | 881 | Fanconi anemia-associated protein of 100 kDa | PRO_0000289130 | |||||
Amino acid modifications | |||||||||
| Modified residue | 667 | 1 | Phosphoserine Ref.7 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 628 | 628 | Missing in isoform 2. | VSP_025922 | |||||
| Alternative sequence | 1 – 151 | 151 | Missing in isoform 3. | VSP_038262 | |||||
| Alternative sequence | 629 – 665 | 37 | SDVLP…PHTRA → MPASFPMLRCARSPCWTVCW SPWCRALPDGRCSCLSS in isoform 2. | VSP_025923 | |||||
| Natural variant | 660 | 1 | P → L. Ref.1 Ref.3 Corresponds to variant rs11552304 [ dbSNP | Ensembl ]. | VAR_032582 | |||||
| Natural variant | 817 | 1 | T → A. Ref.1 Ref.3 Corresponds to variant rs14422 [ dbSNP | Ensembl ]. | VAR_032583 | |||||
Experimental info | |||||||||
| Sequence conflict | 654 | 1 | R → C in BC008883. Ref.3 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 557-881 (ISOFORMS 1/3), VARIANTS LEU-660 AND ALA-817. |
| [2] | "DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage." Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L. Nusbaum C.Nature 440:1045-1049(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3), VARIANTS LEU-660 AND ALA-817. Tissue: Brain. |
| [4] | "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)." Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. Submitted (JUN-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-150 (ISOFORM 1). Tissue: T-cell. |
| [5] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 482-881 (ISOFORMS 1/3). Tissue: Melanoma. |
| [6] | "FAAP100 is essential for activation of the Fanconi anemia-associated DNA damage response pathway." Ling C., Ishiai M., Ali A.M., Medhurst A.L., Neveling K., Kalb R., Yan Z., Xue Y., Oostra A.B., Auerbach A.D., Hoatlin M.E., Schindler D., Joenje H., de Winter J.P., Takata M., Meetei A.R., Wang W. EMBO J. 26:2104-2114(2007) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION, IDENTIFICATION IN THE FA CORE COMPLEX. |
| [7] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-667, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AK024644 mRNA. Translation: BAB14944.1. AK025828 mRNA. Translation: BAB15251.1. Different initiation. AC137896 Genomic DNA. No translation available. CR978826 mRNA. No translation available. BC001724 mRNA. Translation: AAH01724.1. BC008883 mRNA. No translation available. BC021968 mRNA. Translation: AAH21968.1. Different initiation. BC117139 mRNA. Translation: AAI17140.1. BC117141 mRNA. Translation: AAI17142.1. AL834374 mRNA. Translation: CAD39037.2. Different initiation. |
| IPI | IPI00477994. IPI00783034. IPI00869161. |
| RefSeq | NP_079437.5. NM_025161.5. |
| UniGene | Hs.313905. |
3D structure databases | |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q0VG06. 1 interaction. |
| MINT | MINT-4789080. |
| STRING | 9606.ENSP00000333283. |
PTM databases | |
| PhosphoSite | Q0VG06. |
Polymorphism databases | |
| DMDM | 150403945. |
Proteomic databases | |
| PaxDb | Q0VG06. |
| PRIDE | Q0VG06. |
Protocols and materials databases | |
| DNASU | 80233. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000327787; ENSP00000333283; ENSG00000185504. ENST00000537152; ENSP00000440151; ENSG00000185504. |
| GeneID | 80233. |
| KEGG | hsa:80233. |
| UCSC | uc002kap.3. human. |
Organism-specific databases | |
| CTD | 80233. |
| GeneCards | GC17M079506. |
| HGNC | HGNC:26171. C17orf70. |
| HPA | HPA023954. HPA024626. HPA026532. |
| MIM | 611301. gene. |
| neXtProt | NX_Q0VG06. |
| PharmGKB | PA142672253. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG40999. |
| HOGENOM | HOG000112640. |
| HOVERGEN | HBG107926. |
| InParanoid | Q0VG06. |
| KO | K10993. |
| OMA | PVLCCVS. |
| OrthoDB | EOG498V03. |
Enzyme and pathway databases | |
| Reactome | REACT_216. DNA Repair. |
Gene expression databases | |
| ArrayExpress | Q0VG06. |
| Bgee | Q0VG06. |
| CleanEx | HS_C17orf70. |
| Genevestigator | Q0VG06. |
Family and domain databases | |
| ProtoNet | Search... |
Other | |
| ChiTaRS | C17orf70. human. |
| GenomeRNAi | 80233. |
| NextBio | 70677. |
| SOURCE | Search... |
Entry information
| Entry name | FP100_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q0VG06 Secondary accession number(s): A6NNM1 Q9H7E8 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 17 Human chromosome 17: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |

Clusters with
