Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q0VDD8

- DYH14_HUMAN

UniProt

Q0VDD8 - DYH14_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Dynein heavy chain 14, axonemal

Gene

DNAH14

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at transcript leveli

Functioni

Force generating protein of respiratory cilia. Produces force towards the minus ends of microtubules. Dynein has ATPase activity; the force-producing power stroke is thought to occur on release of ADP. Involved in sperm motility; implicated in sperm flagellar assembly (By similarity).By similarity

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Nucleotide bindingi1164 – 11718ATPSequence Analysis
Nucleotide bindingi1427 – 14348ATPSequence Analysis

GO - Molecular functioni

  1. ATP binding Source: UniProtKB-KW
  2. microtubule motor activity Source: InterPro

GO - Biological processi

  1. microtubule-based movement Source: InterPro
Complete GO annotation...

Keywords - Molecular functioni

Motor protein

Keywords - Ligandi

ATP-binding, Nucleotide-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Dynein heavy chain 14, axonemal
Alternative name(s):
Axonemal beta dynein heavy chain 14
Ciliary dynein heavy chain 14
Gene namesi
Name:DNAH14
Synonyms:C1orf67
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 1

Organism-specific databases

HGNCiHGNC:2945. DNAH14.

Subcellular locationi

GO - Cellular componenti

  1. cilium Source: UniProtKB-KW
  2. cytoplasm Source: UniProtKB-KW
  3. dynein complex Source: UniProtKB-KW
  4. microtubule Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Cell projection, Cilium, Cytoplasm, Cytoskeleton, Dynein, Microtubule

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA27399.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 35073507Dynein heavy chain 14, axonemalPRO_0000286560Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi1818 – 18181N-linked (GlcNAc...)Sequence Analysis

Keywords - PTMi

Glycoprotein

Proteomic databases

MaxQBiQ0VDD8.
PaxDbiQ0VDD8.
PRIDEiQ0VDD8.

PTM databases

PhosphoSiteiQ0VDD8.

Expressioni

Gene expression databases

BgeeiQ0VDD8.
ExpressionAtlasiQ0VDD8. baseline and differential.
GenevestigatoriQ0VDD8.

Organism-specific databases

HPAiHPA027718.

Interactioni

Subunit structurei

Consists of at least two heavy chains and a number of intermediate and light chains.

Protein-protein interaction databases

BioGridi126070. 6 interactions.

Structurei

3D structure databases

ProteinModelPortaliQ0VDD8.
SMRiQ0VDD8. Positions 1149-1634, 1887-2918.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi1164 – 11718GPAGTGKT motifBy similarity

Domaini

Dynein heavy chains probably consist of an N-terminal stem (which binds cargo and interacts with other dynein components), and the head or motor domain. The motor contains six tandemly-linked AAA domains in the head, which form a ring. A stalk-like structure (formed by two of the coiled coil domains) protrudes between AAA 4 and AAA 5 and terminates in a microtubule-binding site. A seventh domain may also contribute to this ring; it is not clear whether the N-terminus or the C-terminus forms this extra domain. There are four well-conserved and two non-conserved ATPase sites, one per AAA domain. Probably only one of these (within AAA 1) actually hydrolyzes ATP, the others may serve a regulatory function (By similarity).By similarity

Sequence similaritiesi

Belongs to the dynein heavy chain family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiCOG5245.
GeneTreeiENSGT00390000000412.
InParanoidiQ0VDD8.
OMAiHLQYKWN.
OrthoDBiEOG7KWSGN.
PhylomeDBiQ0VDD8.
TreeFamiTF342240.

Family and domain databases

Gene3Di3.40.50.300. 7 hits.
InterProiIPR026983. DHC_fam.
IPR024743. Dynein_HC_stalk.
IPR024317. Dynein_heavy_chain_D4_dom.
IPR004273. Dynein_heavy_dom.
IPR027417. P-loop_NTPase.
[Graphical view]
PANTHERiPTHR10676. PTHR10676. 1 hit.
PfamiPF12780. AAA_8. 1 hit.
PF03028. Dynein_heavy. 3 hits.
PF12777. MT. 1 hit.
[Graphical view]
SUPFAMiSSF52540. SSF52540. 6 hits.

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q0VDD8-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGRRSQWIWA MRCQMLVPVL SLHIGLARAL GCGCIASKIE CLIRCNAPFP
60 70 80 90 100
LLDAVGSVAS QELQSLTGTV GVTSGAAAYP RWNLARARAP PHLPGTQDPL
110 120 130 140 150
RRVRDPTPIV ASSPGRRRGS WSGGYGQEAS EPGVVGLCCA VLPIHPSLAL
160 170 180 190 200
AGVGGPDLRR FQEGPQRPSD HGAAEKHMET FIPIDLTTEN QEMDKEETKT
210 220 230 240 250
KPRLLRYEEK KYEDVKPLET QPAEIAEKET LEYKTVRTFS ESLKSEKTEE
260 270 280 290 300
PKDDDVIRNI IRLREKLGWQ TILPQHSLKY GSSKIAIQKI TLKKPLEDDG
310 320 330 340 350
EFVYCLPRKS PKSLYNPYDL QVVSAHTAKH CKEFWVITAS FISKLDSSRT
360 370 380 390 400
YSLDEFCEEQ LQQATQALKQ LEDIRNKAIS EMKSTFLKVA EKNEIKEYFE
410 420 430 440 450
SKLSEDDTTH FKLPKYRRLL ETFFKFVMLV DYIFQELIRQ LMNTAVTLLL
460 470 480 490 500
ELFNGSAGMP FSVEKKNENL IRTFKDNSFP TGKTTNDCEE LVDNSKLHAI
510 520 530 540 550
SVQKSEVKTD TDINEILNSV EVGKDLRKTY APIFEVNLCL RIPAESDSSE
560 570 580 590 600
NSKENFHESD QCPEECVMFE DEMSENKDNC VKKHSSEELL PKAKKSKEIS
610 620 630 640 650
YNLEDIISAT ITPLCQDPQL SIFIDLVSIM DLPNKTGSII HYKEQTRWPD
660 670 680 690 700
CHILFETDPA YQNIIVNLLT IIGNSMGLVN AYSHKFIKYC TMTEKAKIMS
710 720 730 740 750
MKISSMGELT SKEFEAILNR FRNYFRHIVN MAIEKRIGIF NVVVESSLQQ
760 770 780 790 800
LECDPTEIEE FLEHFIFLNA ISSKISKLEK EFLTMSQLYS VAKHHQIHIS
810 820 830 840 850
EEQIAIFQVL LLKFSQLKSS MKLSKINKDT AITKFRDNLE ACISGLHVDV
860 870 880 890 900
GNLKAKIRTP LLLCAGTQVS TAMEMIQTLS GEAASLTNKA KAYSHYQDCF
910 920 930 940 950
SDSQSHMHSV NVEEITQIVL SEISDIEGDL TLRKKLWEAQ EEWKRASWEW
960 970 980 990 1000
RNSSLQSIDV ESVQRNVSKL MHIISVLEKE IYSIFIIPSI DDISAQLEES
1010 1020 1030 1040 1050
QVILATIKGS PHIGPIKSQI MFYNDCVKSF VSSYSREKLE KVHAGLMCHL
1060 1070 1080 1090 1100
EEVADLVVLD TSNSRTKAIL GALLILYVHC RDIVINLLLK NIFNAEDFEW
1110 1120 1130 1140 1150
TRHLQYKWNE KQKLCYVSQG NASFTYGYEY LGCTSRLVIT PLTDRCWLTL
1160 1170 1180 1190 1200
MEALHLNLGG CPAGPAGTGK TETVKDLAKC ALFAFKCNTA LIKLPNSLIV
1210 1220 1230 1240 1250
LTCFGLEKTV LVMNTVMSFR FVLEGKEIRI NMSCAVFITM NPRYGGGVEL
1260 1270 1280 1290 1300
PDNLKSLFRP VAMMVPHYQM IAEIILFSFG FKSANSLSGK LTNLYELARK
1310 1320 1330 1340 1350
QLSQQDHYNF GLRSLKIVLI MAGTKKREFK CDTSDSLSEA DETLIVIEAI
1360 1370 1380 1390 1400
REASLPKCPP EDVPLFENII GDIFPEVTVL KVNQLALEKV IYTATQQLGL
1410 1420 1430 1440 1450
QNWSSQKEKI IQFYNQLQVC VGVMLVGPTG GGKTTVRRIL EKALTLLPIA
1460 1470 1480 1490 1500
DFLSVAERKS ASKISERKGK VDICVLNPKC VTLSELYGQL DPNTMEWTDG
1510 1520 1530 1540 1550
LLSATIRSYV YFNTPKNTKK DIDLRLKSRI SDLSNVFKLD SSDTTETDDN
1560 1570 1580 1590 1600
IFEEIEKVVK IPENHNFDWQ WIILDGPVDT FWVENLNSVL DDTRTLCLAN
1610 1620 1630 1640 1650
SERIALTNKI RVIFEVDNLS QASPATVSRC AMVYMDPVDL GWEPYVKSWL
1660 1670 1680 1690 1700
LKTSKIISQS GVDCLEFMIK NSVTDGLQFI RNRQKFQPYP MEDITVVITL
1710 1720 1730 1740 1750
CRILDAFFDF MGKNGGFEQS DDLNDTSSKE ANSQRESVTF KDIEKRDENT
1760 1770 1780 1790 1800
WYPEKNPDKL TKIIQKLFVF AFTWAFGGAL NREDEHRENI PFCPSLEPDS
1810 1820 1830 1840 1850
LAKVTYDFDK LVHELFGNSS QVGINLPTGE CSIFGYFVDI EQCEFIPWSD
1860 1870 1880 1890 1900
LVPNDQTLIQ RDNPTKKPEV RTNKKLLKNN DHKGVVVSTI NFSTNVTAAK
1910 1920 1930 1940 1950
TKEMILKKLI RRTKDTLGAP KNNRILIFID DMNMPVSDMY GAQPPLELIR
1960 1970 1980 1990 2000
QLLDLGGVYD TEKNTWKNIQ DLSIVAACVP VVNDISPRLL KHFSMLVLPH
2010 2020 2030 2040 2050
PSQDILCTIF QIGIDGCGKK TCATLACYLT DNKLYRVPIS HKCAYIEFKE
2060 2070 2080 2090 2100
VFKKVFIHAG LKGKPTVLMV PNLNIEQDSF LEDLNYIISS GRIPDLFENV
2110 2120 2130 2140 2150
ELDSIAMKIR YLTEQSGHMD NRQSLLSFFQ KRIYKNLHIF VIMSPEGPSF
2160 2170 2180 2190 2200
RQNCRVYPSM ISSCTIDWYE RWPEEALLIV ANSFLKEKVN FENRENLKEK
2210 2220 2230 2240 2250
LAPTCVQIHK SMKDLNRKYF EETGRFYYTT PNSYLQFMET FAHILRAREE
2260 2270 2280 2290 2300
EMQTKRDRFH MGLSTILEAT TLVTEMQEEL LILGPQVEQK TKETETLMEK
2310 2320 2330 2340 2350
LRKDSQVVEK VQMLVKQDEE IVAEEVRIVE DYAQKTANEL KSVLPAFDKA
2360 2370 2380 2390 2400
IVALNALDKA DVAELRVYTR PPFLVLTVMN AVCILLQKKP NWATAKLLLS
2410 2420 2430 2440 2450
ETGFLKKLIN LDKDSIPDKV FVKLKKIVTL PDFNPHKISL VSVACCSLCQ
2460 2470 2480 2490 2500
WVIALNNYHE VQKVVGPKQI QVAEAQNVLK IARQRLAEKQ RGLQLISRWH
2510 2520 2530 2540 2550
NQGLPHGQYS VENAILIKNG QQWPLLIDPH RQAHKWIRQM EGSRLQKLSI
2560 2570 2580 2590 2600
EDSNYTKKIE NAMKTGGSVL LQSCQASTWR KKLYLSTEID NPHFLPSVYN
2610 2620 2630 2640 2650
FVTMINFTVT FQGLQDQLLS TVVTHEVPHL EDQRSKLLES ISLDAITLEE
2660 2670 2680 2690 2700
LEEKTLNLLQ KALGSILDDD KIVDTLRKSK MTSNEISKRI EATKKAESEI
2710 2720 2730 2740 2750
QAIRKNYLPI ATRGALLYFL VADLTQINYM YQFSLDWFHQ VFVSSVVSKS
2760 2770 2780 2790 2800
KEQEHSFKRE KVSPKEVHEF ISISKEPNLE NEKNLLDKHI KSAIDMLTKS
2810 2820 2830 2840 2850
IFKVVSSALF NEDKLCFSFR LCTVIMQNNA NGNLIQDDIG FLPEEEWNIF
2860 2870 2880 2890 2900
LYSGILINIK SALSQSRLTS TFEIGESQHL QWLSDSRWRQ CQYVSTHLEP
2910 2920 2930 2940 2950
FSLLCKSLLS NVSQWDTFKN SKAVYSLIST PFSSENASLE ENTKPPEEKH
2960 2970 2980 2990 3000
TFCLLLRAIN HTGTDLGPVG RGQWLTSTAC DRHTDVCSFS FALNDGVPDV
3010 3020 3030 3040 3050
EHVQDIFYGH CVDKYHVKVL RPESLNNSVR KFITEKMGNK YLQRTGVNLK
3060 3070 3080 3090 3100
DAYKGSNART PLILIQTHGS ASIKDYIHII QSLPDDDLPE VLGIHPEAIR
3110 3120 3130 3140 3150
SCWETQGEKF IENLIAMQPK TTTANLMIRP EQSKDELVME ILSDLLKRLP
3160 3170 3180 3190 3200
LTVEKEEIAV GTPSTLKSMM SSSIWESLSK NLKDHDPLIH CVLLTFLKQE
3210 3220 3230 3240 3250
IKRFDKLLFV IHKSLKDLQL AIKGEIILTQ ELEEIFNSFL NMRVPTLWQK
3260 3270 3280 3290 3300
HAYRSCKPLS SWIDDLIQRL NFFNTWAKVA YTAIQRRYMR FVTVWKQSIP
3310 3320 3330 3340 3350
STSQKCKHPE DSENNFFEGF PSRYWLPAFF FPQAFLAAVL QDYGRSRGIA
3360 3370 3380 3390 3400
VDALTFTHHV ISNTTDKDEK FSVFMPKKLN IVRRAFKGSA SSHTGVYIFG
3410 3420 3430 3440 3450
LFIEGARWNR EQKILEDSLP LEMCCDFPDI YFLPTKISTK TPNASNQTDS
3460 3470 3480 3490 3500
ELYAFECPVY QTPERSRILA TTGLPTNFLT SVYLSTKKPP SHWITMRVAL

LCEKNEK

Note: No experimental confirmation available.

Length:3,507
Mass (Da):399,895
Last modified:February 26, 2008 - v3
Checksum:iCF0471356846EEA9
GO
Isoform 2 (identifier: Q0VDD8-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-177: Missing.
     249-249: E → EDYLRESIIQQHMVSPEPASLKEKGKSRRKKDQTHACPNVRKARPVSYDRT
     344-344: K → KVINIVGSVK...NNLSAICLVK
     473-3507: Missing.

Note: No experimental confirmation available.

Show »
Length:453
Mass (Da):53,464
Checksum:i4FCBD670CE50E236
GO
Isoform 3 (identifier: Q0VDD8-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-177: Missing.
     249-249: E → EDYLRESIIQQHMVSPEPASLKEKGKSRRKKDQTHACPNVRKARPVSYDRT
     345-355: LDSSRTYSLDE → RYLVICGAVYI
     356-3507: Missing.

Note: No experimental confirmation available.

Show »
Length:228
Mass (Da):26,682
Checksum:iB038A7FB9772243D
GO
Isoform 4 (identifier: Q0VDD8-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-177: Missing.
     249-249: E → EDYLRESIIQQHMVSPEPASLKEKGKSRRKKDQTHACPNVRKARPVSYDRT
     344-344: K → KVINIVGSVK...NNLSAICLVK
     609-609: A → DTEIETEFENKYMYYEFPEFPTNLFIDPNRLEFSVKIQNMLTNMEKCIT
     744-744: V → SLDYQSECLLYIDNVIHMSHTLIQSVIEKKNKNLLEVV
     979-979: K → KGLPKSDMVT...TPLPLILHHT
     1017-1017: K → KDLVNEWDQN...YIYNIILLFQ
     1180-1219: CALFAFKCNT...VLVMNTVMSF → SLGKHCVVFN...IKAAKDNYSA
     1332-1336: Missing.
     1823-1823: G → GWKHWGQSQGRRRKGNC
     1861-1861: R → RGTSLLTNLQ...ETHKTATGSS
     2011-2011: Q → QAHLGIYFSI...LSRELENCFQ
     2495-2495: L → LVEEHLLFLQ...LIKVMAQKYE
     2573-2582: SCQASTWRKK → NLLETLAPGLKAILKKDIYQKKGHYFIRVGDAEFEYNSNFR
     2949-3016: KHTFCLLLRA...FYGHCVDKYH → TELLNENKETCNPINFPWEKLTSFQRLIL
     3069-3069: G → GIDLTNILLR...VLKDDFSFSR

Show »
Length:4,515
Mass (Da):518,565
Checksum:iF59EF01CCCED2401
GO

Sequence cautioni

The sequence AAI19717.1 differs from that shown. Reason: Erroneous initiation. Curated
The sequence AAI19718.1 differs from that shown. Reason: Erroneous initiation. Curated
The sequence CAI95150.2 differs from that shown. Reason: Erroneous gene model prediction. Curated
The sequence CAI95641.1 differs from that shown. Reason: Erroneous gene model prediction. Curated
The sequence CAI95642.2 differs from that shown. Reason: Erroneous gene model prediction. Curated
The sequence EAW69735.1 differs from that shown. Reason: Erroneous gene model prediction. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti424 – 4241F → L in AAI19718. (PubMed:15489334)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti220 – 2201T → S.1 Publication
Corresponds to variant rs41267347 [ dbSNP | Ensembl ].
VAR_032116
Natural varianti274 – 2741P → L.1 Publication
Corresponds to variant rs41267349 [ dbSNP | Ensembl ].
VAR_032117
Natural varianti2671 – 26711K → E.
Corresponds to variant rs6667999 [ dbSNP | Ensembl ].
VAR_057764

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 177177Missing in isoform 2, isoform 3 and isoform 4. 1 PublicationVSP_031314Add
BLAST
Alternative sequencei249 – 2491E → EDYLRESIIQQHMVSPEPAS LKEKGKSRRKKDQTHACPNV RKARPVSYDRT in isoform 2, isoform 3 and isoform 4. 1 PublicationVSP_031315
Alternative sequencei344 – 3441K → KVINIVGSVKEVELIPTLEW LSERRHYYLLRQFKIFSDFR MNKAFVTWKLNVKRIKTEKS RSFLYHHLFLADDLFQTCLV YIRGLCEDAINLKNYNDHEN NLSAICLVK in isoform 2 and isoform 4. 1 PublicationVSP_031316
Alternative sequencei345 – 35511LDSSRTYSLDE → RYLVICGAVYI in isoform 3. CuratedVSP_038241Add
BLAST
Alternative sequencei356 – 35073152Missing in isoform 3. CuratedVSP_038242Add
BLAST
Alternative sequencei473 – 35073035Missing in isoform 2. 1 PublicationVSP_031317Add
BLAST
Alternative sequencei609 – 6091A → DTEIETEFENKYMYYEFPEF PTNLFIDPNRLEFSVKIQNM LTNMEKCIT in isoform 4. CuratedVSP_038243
Alternative sequencei744 – 7441V → SLDYQSECLLYIDNVIHMSH TLIQSVIEKKNKNLLEVV in isoform 4. CuratedVSP_038244
Alternative sequencei979 – 9791K → KGLPKSDMVTHLKQVVTEFK QELPIIIALGNPCLKPRHWE ALQEIIGKSVPLDKNCKVEN LLALKMFQYENEINDMSTSA TNEAALEKMLFKIIDFWNTT PLPLILHHT in isoform 4. CuratedVSP_038245
Alternative sequencei1017 – 10171K → KDLVNEWDQNLTLFSYTLEE WMNCQRNWLYLEPVFHSSEI RRQLPAETELFSQVISMWKK IMSKIQNKQNALQITTSAGV LEILQNCNIHLEHIKKSLED YLEVKRLIFPRFYFLSNAEL LDILADSRNPESVQPHLVKC FENIKQLLIWKQDIGPPAVK MLISAEGEGLVLPKKIRVRS AVEQWLVNVEKSMFDVLKKE RYIYNIILLFQ in isoform 4. CuratedVSP_038246
Alternative sequencei1180 – 121940CALFA…TVMSF → SLGKHCVVFNCFEDLDYKIV RKFFFGLVQSGAWSCFDEFN LIDLEVLSVIASQILTIKAA KDNYSA in isoform 4. CuratedVSP_038247Add
BLAST
Alternative sequencei1332 – 13365Missing in isoform 4. CuratedVSP_038248
Alternative sequencei1823 – 18231G → GWKHWGQSQGRRRKGNC in isoform 4. CuratedVSP_038249
Alternative sequencei1861 – 18611R → RGTSLLTNLQRSGGNFLKIT ECGECINYTATRDTTCLSFL MSLLLKNSCPVLLTGESGVG KTAAINQMLEKLEGPGAFDI KHGSILGDTLLYSEIKKSSS LKQNITILIPETHKTATGSS in isoform 4. CuratedVSP_038250
Alternative sequencei2011 – 20111Q → QAHLGIYFSINNFTPEVQKS KDQIISCSLAIYHQVRQNML PTPTKCHYMFNLRDMFKLLL GLLQADRTVVNSKEMAALLF VHEATRVFHDRLIDFTDKSL FYRLLSRELENCFQ in isoform 4. CuratedVSP_038251
Alternative sequencei2495 – 24951L → LVEEHLLFLQAAYKDTVAEK QLLANRKTMASRRFQCASVL LTVLEDEKTRWQETINQIDN KLEGILGDILLSAACIVYSG ILTPEFRQLIVNKWETFCIE NGISLSSKFSLIKVMAQKYE in isoform 4. CuratedVSP_038252
Alternative sequencei2573 – 258210SCQASTWRKK → NLLETLAPGLKAILKKDIYQ KKGHYFIRVGDAEFEYNSNF R in isoform 4. CuratedVSP_038253
Alternative sequencei2949 – 301668KHTFC…VDKYH → TELLNENKETCNPINFPWEK LTSFQRLIL in isoform 4. CuratedVSP_038254Add
BLAST
Alternative sequencei3069 – 30691G → GIDLTNILLRFAQELKGTTH HVTIISLGRDQAAKAEDLIL KALTKTQQWVFLQNCHLATS FMPRLCTIVESFNSPNVTID PEFRLWLSSKSYSSFPIPVL KKGLKIAVESPQGLKSNLLQ TFGCTGSGEVTEEIFENPDC GQWWKKLLFSLCFFNAVINE RKNYGILGWNIAYKFNSSDL GVAIKVLENSLRGQPSISWQ ALRYLIGEVIYGGRVIDNWD KRCLKTLLYKFCNPEVLKDD FSFSR in isoform 4. CuratedVSP_038255

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC093560 Genomic DNA. No translation available.
AL590547 Genomic DNA. No translation available.
AL596134 Genomic DNA. No translation available.
AL645769 Genomic DNA. No translation available.
AL357912 Genomic DNA. Translation: CAI95150.2. Sequence problems.
AL162738 Genomic DNA. Translation: CAI95641.1. Sequence problems.
AL162738, AC092811 Genomic DNA. Translation: CAI95642.2. Sequence problems.
CH471098 Genomic DNA. Translation: EAW69735.1. Sequence problems.
BC119716 mRNA. Translation: AAI19717.1. Different initiation.
BC119717 mRNA. Translation: AAI19718.1. Different initiation.
CCDSiCCDS41472.1. [Q0VDD8-3]
CCDS44322.1. [Q0VDD8-2]
RefSeqiNP_001138626.1. NM_001145154.1. [Q0VDD8-2]
NP_001364.1. NM_001373.1. [Q0VDD8-4]
NP_659426.2. NM_144989.2. [Q0VDD8-3]
UniGeneiHs.133977.

Genome annotation databases

EnsembliENST00000366848; ENSP00000355813; ENSG00000185842. [Q0VDD8-3]
ENST00000366850; ENSP00000355815; ENSG00000185842. [Q0VDD8-3]
ENST00000400952; ENSP00000383737; ENSG00000185842. [Q0VDD8-2]
ENST00000430092; ENSP00000414402; ENSG00000185842. [Q0VDD8-4]
ENST00000439375; ENSP00000392061; ENSG00000185842. [Q0VDD8-4]
ENST00000445597; ENSP00000409472; ENSG00000185842. [Q0VDD8-1]
GeneIDi127602.
KEGGihsa:127602.
UCSCiuc001hot.4. human. [Q0VDD8-2]
uc001hov.4. human. [Q0VDD8-3]
uc001how.2. human. [Q0VDD8-4]

Polymorphism databases

DMDMi172046085.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC093560 Genomic DNA. No translation available.
AL590547 Genomic DNA. No translation available.
AL596134 Genomic DNA. No translation available.
AL645769 Genomic DNA. No translation available.
AL357912 Genomic DNA. Translation: CAI95150.2 . Sequence problems.
AL162738 Genomic DNA. Translation: CAI95641.1 . Sequence problems.
AL162738 , AC092811 Genomic DNA. Translation: CAI95642.2 . Sequence problems.
CH471098 Genomic DNA. Translation: EAW69735.1 . Sequence problems.
BC119716 mRNA. Translation: AAI19717.1 . Different initiation.
BC119717 mRNA. Translation: AAI19718.1 . Different initiation.
CCDSi CCDS41472.1. [Q0VDD8-3 ]
CCDS44322.1. [Q0VDD8-2 ]
RefSeqi NP_001138626.1. NM_001145154.1. [Q0VDD8-2 ]
NP_001364.1. NM_001373.1. [Q0VDD8-4 ]
NP_659426.2. NM_144989.2. [Q0VDD8-3 ]
UniGenei Hs.133977.

3D structure databases

ProteinModelPortali Q0VDD8.
SMRi Q0VDD8. Positions 1149-1634, 1887-2918.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 126070. 6 interactions.

PTM databases

PhosphoSitei Q0VDD8.

Polymorphism databases

DMDMi 172046085.

Proteomic databases

MaxQBi Q0VDD8.
PaxDbi Q0VDD8.
PRIDEi Q0VDD8.

Protocols and materials databases

DNASUi 127602.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000366848 ; ENSP00000355813 ; ENSG00000185842 . [Q0VDD8-3 ]
ENST00000366850 ; ENSP00000355815 ; ENSG00000185842 . [Q0VDD8-3 ]
ENST00000400952 ; ENSP00000383737 ; ENSG00000185842 . [Q0VDD8-2 ]
ENST00000430092 ; ENSP00000414402 ; ENSG00000185842 . [Q0VDD8-4 ]
ENST00000439375 ; ENSP00000392061 ; ENSG00000185842 . [Q0VDD8-4 ]
ENST00000445597 ; ENSP00000409472 ; ENSG00000185842 . [Q0VDD8-1 ]
GeneIDi 127602.
KEGGi hsa:127602.
UCSCi uc001hot.4. human. [Q0VDD8-2 ]
uc001hov.4. human. [Q0VDD8-3 ]
uc001how.2. human. [Q0VDD8-4 ]

Organism-specific databases

CTDi 127602.
GeneCardsi GC01P225083.
HGNCi HGNC:2945. DNAH14.
HPAi HPA027718.
MIMi 603341. gene.
neXtProti NX_Q0VDD8.
PharmGKBi PA27399.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG5245.
GeneTreei ENSGT00390000000412.
InParanoidi Q0VDD8.
OMAi HLQYKWN.
OrthoDBi EOG7KWSGN.
PhylomeDBi Q0VDD8.
TreeFami TF342240.

Miscellaneous databases

ChiTaRSi DNAH14. human.
GenomeRNAii 127602.
NextBioi 82137.
PROi Q0VDD8.
SOURCEi Search...

Gene expression databases

Bgeei Q0VDD8.
ExpressionAtlasi Q0VDD8. baseline and differential.
Genevestigatori Q0VDD8.

Family and domain databases

Gene3Di 3.40.50.300. 7 hits.
InterProi IPR026983. DHC_fam.
IPR024743. Dynein_HC_stalk.
IPR024317. Dynein_heavy_chain_D4_dom.
IPR004273. Dynein_heavy_dom.
IPR027417. P-loop_NTPase.
[Graphical view ]
PANTHERi PTHR10676. PTHR10676. 1 hit.
Pfami PF12780. AAA_8. 1 hit.
PF03028. Dynein_heavy. 3 hits.
PF12777. MT. 1 hit.
[Graphical view ]
SUPFAMi SSF52540. SSF52540. 6 hits.
ProtoNeti Search...

Publicationsi

  1. "The DNA sequence and biological annotation of human chromosome 1."
    Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
    , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
    Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANTS SER-220 AND LEU-274.

Entry informationi

Entry nameiDYH14_HUMAN
AccessioniPrimary (citable) accession number: Q0VDD8
Secondary accession number(s): A6NG62
, A6NNL2, Q0VDD9, Q4VXC7, Q4VXG4, Q4VXG5, Q5VU33, Q5VU34
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 15, 2007
Last sequence update: February 26, 2008
Last modified: November 26, 2014
This is version 77 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3