SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q0VDD8

- DYH14_HUMAN

UniProt

Q0VDD8 - DYH14_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Dynein heavy chain 14, axonemal
Gene
DNAH14, C1orf67
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5 - Experimental evidence at transcript leveli

Functioni

Force generating protein of respiratory cilia. Produces force towards the minus ends of microtubules. Dynein has ATPase activity; the force-producing power stroke is thought to occur on release of ADP. Involved in sperm motility; implicated in sperm flagellar assembly By similarity.

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Nucleotide bindingi1164 – 11718ATP Reviewed prediction
Nucleotide bindingi1427 – 14348ATP Reviewed prediction

GO - Molecular functioni

  1. ATP binding Source: UniProtKB-KW
  2. microtubule motor activity Source: InterPro
Complete GO annotation...

GO - Biological processi

  1. microtubule-based movement Source: InterPro
Complete GO annotation...

Keywords - Molecular functioni

Motor protein

Keywords - Ligandi

ATP-binding, Nucleotide-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Dynein heavy chain 14, axonemal
Alternative name(s):
Axonemal beta dynein heavy chain 14
Ciliary dynein heavy chain 14
Gene namesi
Name:DNAH14
Synonyms:C1orf67
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 1

Organism-specific databases

HGNCiHGNC:2945. DNAH14.

Subcellular locationi

Cytoplasmcytoskeletoncilium axoneme Reviewed prediction

GO - Cellular componenti

  1. cilium Source: UniProtKB-KW
  2. cytoplasm Source: UniProtKB-KW
  3. dynein complex Source: UniProtKB-KW
  4. microtubule Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Cell projection, Cilium, Cytoplasm, Cytoskeleton, Dynein, Microtubule

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA27399.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 35073507Dynein heavy chain 14, axonemal
PRO_0000286560Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi1818 – 18181N-linked (GlcNAc...) Reviewed prediction

Keywords - PTMi

Glycoprotein

Proteomic databases

MaxQBiQ0VDD8.
PaxDbiQ0VDD8.
PRIDEiQ0VDD8.

PTM databases

PhosphoSiteiQ0VDD8.

Expressioni

Gene expression databases

ArrayExpressiQ0VDD8.
BgeeiQ0VDD8.
GenevestigatoriQ0VDD8.

Organism-specific databases

HPAiHPA027718.

Interactioni

Subunit structurei

Consists of at least two heavy chains and a number of intermediate and light chains.

Protein-protein interaction databases

BioGridi126070. 3 interactions.

Structurei

3D structure databases

ProteinModelPortaliQ0VDD8.
SMRiQ0VDD8. Positions 1149-1634, 1887-2486, 2499-2918.

Family & Domainsi

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi1164 – 11718GPAGTGKT motif By similarity

Domaini

Dynein heavy chains probably consist of an N-terminal stem (which binds cargo and interacts with other dynein components), and the head or motor domain. The motor contains six tandemly-linked AAA domains in the head, which form a ring. A stalk-like structure (formed by two of the coiled coil domains) protrudes between AAA 4 and AAA 5 and terminates in a microtubule-binding site. A seventh domain may also contribute to this ring; it is not clear whether the N-terminus or the C-terminus forms this extra domain. There are four well-conserved and two non-conserved ATPase sites, one per AAA domain. Probably only one of these (within AAA 1) actually hydrolyzes ATP, the others may serve a regulatory function By similarity.

Sequence similaritiesi

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiCOG5245.
OMAiHLQYKWN.
OrthoDBiEOG7KWSGN.
PhylomeDBiQ0VDD8.
TreeFamiTF342240.

Family and domain databases

Gene3Di3.40.50.300. 7 hits.
InterProiIPR026983. DHC_fam.
IPR024743. Dynein_HC_stalk.
IPR024317. Dynein_heavy_chain_D4_dom.
IPR004273. Dynein_heavy_dom.
IPR027417. P-loop_NTPase.
[Graphical view]
PANTHERiPTHR10676. PTHR10676. 1 hit.
PfamiPF12780. AAA_8. 1 hit.
PF03028. Dynein_heavy. 3 hits.
PF12777. MT. 1 hit.
[Graphical view]
SUPFAMiSSF52540. SSF52540. 6 hits.

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q0VDD8-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MGRRSQWIWA MRCQMLVPVL SLHIGLARAL GCGCIASKIE CLIRCNAPFP     50
LLDAVGSVAS QELQSLTGTV GVTSGAAAYP RWNLARARAP PHLPGTQDPL 100
RRVRDPTPIV ASSPGRRRGS WSGGYGQEAS EPGVVGLCCA VLPIHPSLAL 150
AGVGGPDLRR FQEGPQRPSD HGAAEKHMET FIPIDLTTEN QEMDKEETKT 200
KPRLLRYEEK KYEDVKPLET QPAEIAEKET LEYKTVRTFS ESLKSEKTEE 250
PKDDDVIRNI IRLREKLGWQ TILPQHSLKY GSSKIAIQKI TLKKPLEDDG 300
EFVYCLPRKS PKSLYNPYDL QVVSAHTAKH CKEFWVITAS FISKLDSSRT 350
YSLDEFCEEQ LQQATQALKQ LEDIRNKAIS EMKSTFLKVA EKNEIKEYFE 400
SKLSEDDTTH FKLPKYRRLL ETFFKFVMLV DYIFQELIRQ LMNTAVTLLL 450
ELFNGSAGMP FSVEKKNENL IRTFKDNSFP TGKTTNDCEE LVDNSKLHAI 500
SVQKSEVKTD TDINEILNSV EVGKDLRKTY APIFEVNLCL RIPAESDSSE 550
NSKENFHESD QCPEECVMFE DEMSENKDNC VKKHSSEELL PKAKKSKEIS 600
YNLEDIISAT ITPLCQDPQL SIFIDLVSIM DLPNKTGSII HYKEQTRWPD 650
CHILFETDPA YQNIIVNLLT IIGNSMGLVN AYSHKFIKYC TMTEKAKIMS 700
MKISSMGELT SKEFEAILNR FRNYFRHIVN MAIEKRIGIF NVVVESSLQQ 750
LECDPTEIEE FLEHFIFLNA ISSKISKLEK EFLTMSQLYS VAKHHQIHIS 800
EEQIAIFQVL LLKFSQLKSS MKLSKINKDT AITKFRDNLE ACISGLHVDV 850
GNLKAKIRTP LLLCAGTQVS TAMEMIQTLS GEAASLTNKA KAYSHYQDCF 900
SDSQSHMHSV NVEEITQIVL SEISDIEGDL TLRKKLWEAQ EEWKRASWEW 950
RNSSLQSIDV ESVQRNVSKL MHIISVLEKE IYSIFIIPSI DDISAQLEES 1000
QVILATIKGS PHIGPIKSQI MFYNDCVKSF VSSYSREKLE KVHAGLMCHL 1050
EEVADLVVLD TSNSRTKAIL GALLILYVHC RDIVINLLLK NIFNAEDFEW 1100
TRHLQYKWNE KQKLCYVSQG NASFTYGYEY LGCTSRLVIT PLTDRCWLTL 1150
MEALHLNLGG CPAGPAGTGK TETVKDLAKC ALFAFKCNTA LIKLPNSLIV 1200
LTCFGLEKTV LVMNTVMSFR FVLEGKEIRI NMSCAVFITM NPRYGGGVEL 1250
PDNLKSLFRP VAMMVPHYQM IAEIILFSFG FKSANSLSGK LTNLYELARK 1300
QLSQQDHYNF GLRSLKIVLI MAGTKKREFK CDTSDSLSEA DETLIVIEAI 1350
REASLPKCPP EDVPLFENII GDIFPEVTVL KVNQLALEKV IYTATQQLGL 1400
QNWSSQKEKI IQFYNQLQVC VGVMLVGPTG GGKTTVRRIL EKALTLLPIA 1450
DFLSVAERKS ASKISERKGK VDICVLNPKC VTLSELYGQL DPNTMEWTDG 1500
LLSATIRSYV YFNTPKNTKK DIDLRLKSRI SDLSNVFKLD SSDTTETDDN 1550
IFEEIEKVVK IPENHNFDWQ WIILDGPVDT FWVENLNSVL DDTRTLCLAN 1600
SERIALTNKI RVIFEVDNLS QASPATVSRC AMVYMDPVDL GWEPYVKSWL 1650
LKTSKIISQS GVDCLEFMIK NSVTDGLQFI RNRQKFQPYP MEDITVVITL 1700
CRILDAFFDF MGKNGGFEQS DDLNDTSSKE ANSQRESVTF KDIEKRDENT 1750
WYPEKNPDKL TKIIQKLFVF AFTWAFGGAL NREDEHRENI PFCPSLEPDS 1800
LAKVTYDFDK LVHELFGNSS QVGINLPTGE CSIFGYFVDI EQCEFIPWSD 1850
LVPNDQTLIQ RDNPTKKPEV RTNKKLLKNN DHKGVVVSTI NFSTNVTAAK 1900
TKEMILKKLI RRTKDTLGAP KNNRILIFID DMNMPVSDMY GAQPPLELIR 1950
QLLDLGGVYD TEKNTWKNIQ DLSIVAACVP VVNDISPRLL KHFSMLVLPH 2000
PSQDILCTIF QIGIDGCGKK TCATLACYLT DNKLYRVPIS HKCAYIEFKE 2050
VFKKVFIHAG LKGKPTVLMV PNLNIEQDSF LEDLNYIISS GRIPDLFENV 2100
ELDSIAMKIR YLTEQSGHMD NRQSLLSFFQ KRIYKNLHIF VIMSPEGPSF 2150
RQNCRVYPSM ISSCTIDWYE RWPEEALLIV ANSFLKEKVN FENRENLKEK 2200
LAPTCVQIHK SMKDLNRKYF EETGRFYYTT PNSYLQFMET FAHILRAREE 2250
EMQTKRDRFH MGLSTILEAT TLVTEMQEEL LILGPQVEQK TKETETLMEK 2300
LRKDSQVVEK VQMLVKQDEE IVAEEVRIVE DYAQKTANEL KSVLPAFDKA 2350
IVALNALDKA DVAELRVYTR PPFLVLTVMN AVCILLQKKP NWATAKLLLS 2400
ETGFLKKLIN LDKDSIPDKV FVKLKKIVTL PDFNPHKISL VSVACCSLCQ 2450
WVIALNNYHE VQKVVGPKQI QVAEAQNVLK IARQRLAEKQ RGLQLISRWH 2500
NQGLPHGQYS VENAILIKNG QQWPLLIDPH RQAHKWIRQM EGSRLQKLSI 2550
EDSNYTKKIE NAMKTGGSVL LQSCQASTWR KKLYLSTEID NPHFLPSVYN 2600
FVTMINFTVT FQGLQDQLLS TVVTHEVPHL EDQRSKLLES ISLDAITLEE 2650
LEEKTLNLLQ KALGSILDDD KIVDTLRKSK MTSNEISKRI EATKKAESEI 2700
QAIRKNYLPI ATRGALLYFL VADLTQINYM YQFSLDWFHQ VFVSSVVSKS 2750
KEQEHSFKRE KVSPKEVHEF ISISKEPNLE NEKNLLDKHI KSAIDMLTKS 2800
IFKVVSSALF NEDKLCFSFR LCTVIMQNNA NGNLIQDDIG FLPEEEWNIF 2850
LYSGILINIK SALSQSRLTS TFEIGESQHL QWLSDSRWRQ CQYVSTHLEP 2900
FSLLCKSLLS NVSQWDTFKN SKAVYSLIST PFSSENASLE ENTKPPEEKH 2950
TFCLLLRAIN HTGTDLGPVG RGQWLTSTAC DRHTDVCSFS FALNDGVPDV 3000
EHVQDIFYGH CVDKYHVKVL RPESLNNSVR KFITEKMGNK YLQRTGVNLK 3050
DAYKGSNART PLILIQTHGS ASIKDYIHII QSLPDDDLPE VLGIHPEAIR 3100
SCWETQGEKF IENLIAMQPK TTTANLMIRP EQSKDELVME ILSDLLKRLP 3150
LTVEKEEIAV GTPSTLKSMM SSSIWESLSK NLKDHDPLIH CVLLTFLKQE 3200
IKRFDKLLFV IHKSLKDLQL AIKGEIILTQ ELEEIFNSFL NMRVPTLWQK 3250
HAYRSCKPLS SWIDDLIQRL NFFNTWAKVA YTAIQRRYMR FVTVWKQSIP 3300
STSQKCKHPE DSENNFFEGF PSRYWLPAFF FPQAFLAAVL QDYGRSRGIA 3350
VDALTFTHHV ISNTTDKDEK FSVFMPKKLN IVRRAFKGSA SSHTGVYIFG 3400
LFIEGARWNR EQKILEDSLP LEMCCDFPDI YFLPTKISTK TPNASNQTDS 3450
ELYAFECPVY QTPERSRILA TTGLPTNFLT SVYLSTKKPP SHWITMRVAL 3500
LCEKNEK 3507

Note: No experimental confirmation available.

Length:3,507
Mass (Da):399,895
Last modified:February 26, 2008 - v3
Checksum:iCF0471356846EEA9
GO
Isoform 2 (identifier: Q0VDD8-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-177: Missing.
     249-249: E → EDYLRESIIQQHMVSPEPASLKEKGKSRRKKDQTHACPNVRKARPVSYDRT
     344-344: K → KVINIVGSVK...NNLSAICLVK
     473-3507: Missing.

Note: No experimental confirmation available.

Show »
Length:453
Mass (Da):53,464
Checksum:i4FCBD670CE50E236
GO
Isoform 3 (identifier: Q0VDD8-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-177: Missing.
     249-249: E → EDYLRESIIQQHMVSPEPASLKEKGKSRRKKDQTHACPNVRKARPVSYDRT
     345-355: LDSSRTYSLDE → RYLVICGAVYI
     356-3507: Missing.

Note: No experimental confirmation available.

Show »
Length:228
Mass (Da):26,682
Checksum:iB038A7FB9772243D
GO
Isoform 4 (identifier: Q0VDD8-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-177: Missing.
     249-249: E → EDYLRESIIQQHMVSPEPASLKEKGKSRRKKDQTHACPNVRKARPVSYDRT
     344-344: K → KVINIVGSVK...NNLSAICLVK
     609-609: A → DTEIETEFENKYMYYEFPEFPTNLFIDPNRLEFSVKIQNMLTNMEKCIT
     744-744: V → SLDYQSECLLYIDNVIHMSHTLIQSVIEKKNKNLLEVV
     979-979: K → KGLPKSDMVT...TPLPLILHHT
     1017-1017: K → KDLVNEWDQN...YIYNIILLFQ
     1180-1219: CALFAFKCNT...VLVMNTVMSF → SLGKHCVVFN...IKAAKDNYSA
     1332-1336: Missing.
     1823-1823: G → GWKHWGQSQGRRRKGNC
     1861-1861: R → RGTSLLTNLQ...ETHKTATGSS
     2011-2011: Q → QAHLGIYFSI...LSRELENCFQ
     2495-2495: L → LVEEHLLFLQ...LIKVMAQKYE
     2573-2582: SCQASTWRKK → NLLETLAPGLKAILKKDIYQKKGHYFIRVGDAEFEYNSNFR
     2949-3016: KHTFCLLLRA...FYGHCVDKYH → TELLNENKETCNPINFPWEKLTSFQRLIL
     3069-3069: G → GIDLTNILLR...VLKDDFSFSR

Show »
Length:4,515
Mass (Da):518,565
Checksum:iF59EF01CCCED2401
GO

Sequence cautioni

The sequence AAI19717.1 differs from that shown. Reason: Erroneous initiation.
The sequence AAI19718.1 differs from that shown. Reason: Erroneous initiation.
The sequence CAI95150.2 differs from that shown. Reason: Erroneous gene model prediction.
The sequence CAI95641.1 differs from that shown. Reason: Erroneous gene model prediction.
The sequence CAI95642.2 differs from that shown. Reason: Erroneous gene model prediction.
The sequence EAW69735.1 differs from that shown. Reason: Erroneous gene model prediction.

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti220 – 2201T → S.1 Publication
Corresponds to variant rs41267347 [ dbSNP | Ensembl ].
VAR_032116
Natural varianti274 – 2741P → L.1 Publication
Corresponds to variant rs41267349 [ dbSNP | Ensembl ].
VAR_032117
Natural varianti2671 – 26711K → E.
Corresponds to variant rs6667999 [ dbSNP | Ensembl ].
VAR_057764

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 177177Missing in isoform 2, isoform 3 and isoform 4.
VSP_031314Add
BLAST
Alternative sequencei249 – 2491E → EDYLRESIIQQHMVSPEPAS LKEKGKSRRKKDQTHACPNV RKARPVSYDRT in isoform 2, isoform 3 and isoform 4.
VSP_031315
Alternative sequencei344 – 3441K → KVINIVGSVKEVELIPTLEW LSERRHYYLLRQFKIFSDFR MNKAFVTWKLNVKRIKTEKS RSFLYHHLFLADDLFQTCLV YIRGLCEDAINLKNYNDHEN NLSAICLVK in isoform 2 and isoform 4.
VSP_031316
Alternative sequencei345 – 35511LDSSRTYSLDE → RYLVICGAVYI in isoform 3.
VSP_038241Add
BLAST
Alternative sequencei356 – 35073152Missing in isoform 3.
VSP_038242Add
BLAST
Alternative sequencei473 – 35073035Missing in isoform 2.
VSP_031317Add
BLAST
Alternative sequencei609 – 6091A → DTEIETEFENKYMYYEFPEF PTNLFIDPNRLEFSVKIQNM LTNMEKCIT in isoform 4.
VSP_038243
Alternative sequencei744 – 7441V → SLDYQSECLLYIDNVIHMSH TLIQSVIEKKNKNLLEVV in isoform 4.
VSP_038244
Alternative sequencei979 – 9791K → KGLPKSDMVTHLKQVVTEFK QELPIIIALGNPCLKPRHWE ALQEIIGKSVPLDKNCKVEN LLALKMFQYENEINDMSTSA TNEAALEKMLFKIIDFWNTT PLPLILHHT in isoform 4.
VSP_038245
Alternative sequencei1017 – 10171K → KDLVNEWDQNLTLFSYTLEE WMNCQRNWLYLEPVFHSSEI RRQLPAETELFSQVISMWKK IMSKIQNKQNALQITTSAGV LEILQNCNIHLEHIKKSLED YLEVKRLIFPRFYFLSNAEL LDILADSRNPESVQPHLVKC FENIKQLLIWKQDIGPPAVK MLISAEGEGLVLPKKIRVRS AVEQWLVNVEKSMFDVLKKE RYIYNIILLFQ in isoform 4.
VSP_038246
Alternative sequencei1180 – 121940CALFA…TVMSF → SLGKHCVVFNCFEDLDYKIV RKFFFGLVQSGAWSCFDEFN LIDLEVLSVIASQILTIKAA KDNYSA in isoform 4.
VSP_038247Add
BLAST
Alternative sequencei1332 – 13365Missing in isoform 4.
VSP_038248
Alternative sequencei1823 – 18231G → GWKHWGQSQGRRRKGNC in isoform 4.
VSP_038249
Alternative sequencei1861 – 18611R → RGTSLLTNLQRSGGNFLKIT ECGECINYTATRDTTCLSFL MSLLLKNSCPVLLTGESGVG KTAAINQMLEKLEGPGAFDI KHGSILGDTLLYSEIKKSSS LKQNITILIPETHKTATGSS in isoform 4.
VSP_038250
Alternative sequencei2011 – 20111Q → QAHLGIYFSINNFTPEVQKS KDQIISCSLAIYHQVRQNML PTPTKCHYMFNLRDMFKLLL GLLQADRTVVNSKEMAALLF VHEATRVFHDRLIDFTDKSL FYRLLSRELENCFQ in isoform 4.
VSP_038251
Alternative sequencei2495 – 24951L → LVEEHLLFLQAAYKDTVAEK QLLANRKTMASRRFQCASVL LTVLEDEKTRWQETINQIDN KLEGILGDILLSAACIVYSG ILTPEFRQLIVNKWETFCIE NGISLSSKFSLIKVMAQKYE in isoform 4.
VSP_038252
Alternative sequencei2573 – 258210SCQASTWRKK → NLLETLAPGLKAILKKDIYQ KKGHYFIRVGDAEFEYNSNF R in isoform 4.
VSP_038253
Alternative sequencei2949 – 301668KHTFC…VDKYH → TELLNENKETCNPINFPWEK LTSFQRLIL in isoform 4.
VSP_038254Add
BLAST
Alternative sequencei3069 – 30691G → GIDLTNILLRFAQELKGTTH HVTIISLGRDQAAKAEDLIL KALTKTQQWVFLQNCHLATS FMPRLCTIVESFNSPNVTID PEFRLWLSSKSYSSFPIPVL KKGLKIAVESPQGLKSNLLQ TFGCTGSGEVTEEIFENPDC GQWWKKLLFSLCFFNAVINE RKNYGILGWNIAYKFNSSDL GVAIKVLENSLRGQPSISWQ ALRYLIGEVIYGGRVIDNWD KRCLKTLLYKFCNPEVLKDD FSFSR in isoform 4.
VSP_038255

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti424 – 4241F → L in AAI19718. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AC093560 Genomic DNA. No translation available.
AL590547 Genomic DNA. No translation available.
AL596134 Genomic DNA. No translation available.
AL645769 Genomic DNA. No translation available.
AL357912 Genomic DNA. Translation: CAI95150.2. Sequence problems.
AL162738 Genomic DNA. Translation: CAI95641.1. Sequence problems.
AL162738, AC092811 Genomic DNA. Translation: CAI95642.2. Sequence problems.
CH471098 Genomic DNA. Translation: EAW69735.1. Sequence problems.
BC119716 mRNA. Translation: AAI19717.1. Different initiation.
BC119717 mRNA. Translation: AAI19718.1. Different initiation.
CCDSiCCDS41472.1. [Q0VDD8-3]
CCDS44322.1. [Q0VDD8-2]
RefSeqiNP_001138626.1. NM_001145154.1. [Q0VDD8-2]
NP_001364.1. NM_001373.1. [Q0VDD8-4]
NP_659426.2. NM_144989.2. [Q0VDD8-3]
UniGeneiHs.133977.

Genome annotation databases

EnsembliENST00000366848; ENSP00000355813; ENSG00000185842. [Q0VDD8-3]
ENST00000366850; ENSP00000355815; ENSG00000185842. [Q0VDD8-3]
ENST00000400952; ENSP00000383737; ENSG00000185842. [Q0VDD8-2]
ENST00000430092; ENSP00000414402; ENSG00000185842. [Q0VDD8-4]
ENST00000439375; ENSP00000392061; ENSG00000185842. [Q0VDD8-4]
ENST00000445597; ENSP00000409472; ENSG00000185842. [Q0VDD8-1]
GeneIDi127602.
KEGGihsa:127602.
UCSCiuc001hot.4. human. [Q0VDD8-2]
uc001hov.4. human. [Q0VDD8-3]
uc001how.2. human. [Q0VDD8-4]

Polymorphism databases

DMDMi172046085.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AC093560 Genomic DNA. No translation available.
AL590547 Genomic DNA. No translation available.
AL596134 Genomic DNA. No translation available.
AL645769 Genomic DNA. No translation available.
AL357912 Genomic DNA. Translation: CAI95150.2 . Sequence problems.
AL162738 Genomic DNA. Translation: CAI95641.1 . Sequence problems.
AL162738 , AC092811 Genomic DNA. Translation: CAI95642.2 . Sequence problems.
CH471098 Genomic DNA. Translation: EAW69735.1 . Sequence problems.
BC119716 mRNA. Translation: AAI19717.1 . Different initiation.
BC119717 mRNA. Translation: AAI19718.1 . Different initiation.
CCDSi CCDS41472.1. [Q0VDD8-3 ]
CCDS44322.1. [Q0VDD8-2 ]
RefSeqi NP_001138626.1. NM_001145154.1. [Q0VDD8-2 ]
NP_001364.1. NM_001373.1. [Q0VDD8-4 ]
NP_659426.2. NM_144989.2. [Q0VDD8-3 ]
UniGenei Hs.133977.

3D structure databases

ProteinModelPortali Q0VDD8.
SMRi Q0VDD8. Positions 1149-1634, 1887-2486, 2499-2918.
ModBasei Search...

Protein-protein interaction databases

BioGridi 126070. 3 interactions.

PTM databases

PhosphoSitei Q0VDD8.

Polymorphism databases

DMDMi 172046085.

Proteomic databases

MaxQBi Q0VDD8.
PaxDbi Q0VDD8.
PRIDEi Q0VDD8.

Protocols and materials databases

DNASUi 127602.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000366848 ; ENSP00000355813 ; ENSG00000185842 . [Q0VDD8-3 ]
ENST00000366850 ; ENSP00000355815 ; ENSG00000185842 . [Q0VDD8-3 ]
ENST00000400952 ; ENSP00000383737 ; ENSG00000185842 . [Q0VDD8-2 ]
ENST00000430092 ; ENSP00000414402 ; ENSG00000185842 . [Q0VDD8-4 ]
ENST00000439375 ; ENSP00000392061 ; ENSG00000185842 . [Q0VDD8-4 ]
ENST00000445597 ; ENSP00000409472 ; ENSG00000185842 . [Q0VDD8-1 ]
GeneIDi 127602.
KEGGi hsa:127602.
UCSCi uc001hot.4. human. [Q0VDD8-2 ]
uc001hov.4. human. [Q0VDD8-3 ]
uc001how.2. human. [Q0VDD8-4 ]

Organism-specific databases

CTDi 127602.
GeneCardsi GC01P225083.
HGNCi HGNC:2945. DNAH14.
HPAi HPA027718.
MIMi 603341. gene.
neXtProti NX_Q0VDD8.
PharmGKBi PA27399.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG5245.
OMAi HLQYKWN.
OrthoDBi EOG7KWSGN.
PhylomeDBi Q0VDD8.
TreeFami TF342240.

Miscellaneous databases

GenomeRNAii 127602.
NextBioi 82137.
PROi Q0VDD8.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q0VDD8.
Bgeei Q0VDD8.
Genevestigatori Q0VDD8.

Family and domain databases

Gene3Di 3.40.50.300. 7 hits.
InterProi IPR026983. DHC_fam.
IPR024743. Dynein_HC_stalk.
IPR024317. Dynein_heavy_chain_D4_dom.
IPR004273. Dynein_heavy_dom.
IPR027417. P-loop_NTPase.
[Graphical view ]
PANTHERi PTHR10676. PTHR10676. 1 hit.
Pfami PF12780. AAA_8. 1 hit.
PF03028. Dynein_heavy. 3 hits.
PF12777. MT. 1 hit.
[Graphical view ]
SUPFAMi SSF52540. SSF52540. 6 hits.
ProtoNeti Search...

Publicationsi

  1. "The DNA sequence and biological annotation of human chromosome 1."
    Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
    , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
    Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANTS SER-220 AND LEU-274.

Entry informationi

Entry nameiDYH14_HUMAN
AccessioniPrimary (citable) accession number: Q0VDD8
Secondary accession number(s): A6NG62
, A6NNL2, Q0VDD9, Q4VXC7, Q4VXG4, Q4VXG5, Q5VU33, Q5VU34
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 15, 2007
Last sequence update: February 26, 2008
Last modified: July 9, 2014
This is version 74 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi