Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q0VDD8 (DYH14_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 72. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Dynein heavy chain 14, axonemal
Alternative name(s):
Axonemal beta dynein heavy chain 14
Ciliary dynein heavy chain 14
Gene names
Name:DNAH14
Synonyms:C1orf67
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length3507 AA.
Sequence statusComplete.
Protein existenceEvidence at transcript level

General annotation (Comments)

Function

Force generating protein of respiratory cilia. Produces force towards the minus ends of microtubules. Dynein has ATPase activity; the force-producing power stroke is thought to occur on release of ADP. Involved in sperm motility; implicated in sperm flagellar assembly By similarity.

Subunit structure

Consists of at least two heavy chains and a number of intermediate and light chains.

Subcellular location

Cytoplasmcytoskeletoncilium axoneme Potential.

Domain

Dynein heavy chains probably consist of an N-terminal stem (which binds cargo and interacts with other dynein components), and the head or motor domain. The motor contains six tandemly-linked AAA domains in the head, which form a ring. A stalk-like structure (formed by two of the coiled coil domains) protrudes between AAA 4 and AAA 5 and terminates in a microtubule-binding site. A seventh domain may also contribute to this ring; it is not clear whether the N-terminus or the C-terminus forms this extra domain. There are four well-conserved and two non-conserved ATPase sites, one per AAA domain. Probably only one of these (within AAA 1) actually hydrolyzes ATP, the others may serve a regulatory function By similarity.

Sequence similarities

Belongs to the dynein heavy chain family.

Sequence caution

The sequence AAI19717.1 differs from that shown. Reason: Erroneous initiation.

The sequence AAI19718.1 differs from that shown. Reason: Erroneous initiation.

The sequence CAI95150.2 differs from that shown. Reason: Erroneous gene model prediction.

The sequence CAI95641.1 differs from that shown. Reason: Erroneous gene model prediction.

The sequence CAI95642.2 differs from that shown. Reason: Erroneous gene model prediction.

The sequence EAW69735.1 differs from that shown. Reason: Erroneous gene model prediction.

Ontologies

Keywords
   Cellular componentCell projection
Cilium
Cytoplasm
Cytoskeleton
Dynein
Microtubule
   Coding sequence diversityAlternative splicing
Polymorphism
   DomainCoiled coil
   LigandATP-binding
Nucleotide-binding
   Molecular functionMotor protein
   PTMGlycoprotein
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processmicrotubule-based movement

Inferred from electronic annotation. Source: InterPro

   Cellular_componentcilium

Inferred from electronic annotation. Source: UniProtKB-KW

cytoplasm

Inferred from electronic annotation. Source: UniProtKB-KW

dynein complex

Inferred from electronic annotation. Source: UniProtKB-KW

microtubule

Inferred from electronic annotation. Source: UniProtKB-KW

   Molecular_functionATP binding

Inferred from electronic annotation. Source: UniProtKB-KW

microtubule motor activity

Inferred from electronic annotation. Source: InterPro

Complete GO annotation...

Alternative products

This entry describes 4 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q0VDD8-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Note: No experimental confirmation available.
Isoform 2 (identifier: Q0VDD8-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1-177: Missing.
     249-249: E → EDYLRESIIQQHMVSPEPASLKEKGKSRRKKDQTHACPNVRKARPVSYDRT
     344-344: K → KVINIVGSVK...NNLSAICLVK
     473-3507: Missing.
Note: No experimental confirmation available.
Isoform 3 (identifier: Q0VDD8-3)

The sequence of this isoform differs from the canonical sequence as follows:
     1-177: Missing.
     249-249: E → EDYLRESIIQQHMVSPEPASLKEKGKSRRKKDQTHACPNVRKARPVSYDRT
     345-355: LDSSRTYSLDE → RYLVICGAVYI
     356-3507: Missing.
Note: No experimental confirmation available.
Isoform 4 (identifier: Q0VDD8-4)

The sequence of this isoform differs from the canonical sequence as follows:
     1-177: Missing.
     249-249: E → EDYLRESIIQQHMVSPEPASLKEKGKSRRKKDQTHACPNVRKARPVSYDRT
     344-344: K → KVINIVGSVK...NNLSAICLVK
     609-609: A → DTEIETEFENKYMYYEFPEFPTNLFIDPNRLEFSVKIQNMLTNMEKCIT
     744-744: V → SLDYQSECLLYIDNVIHMSHTLIQSVIEKKNKNLLEVV
     979-979: K → KGLPKSDMVT...TPLPLILHHT
     1017-1017: K → KDLVNEWDQN...YIYNIILLFQ
     1180-1219: CALFAFKCNT...VLVMNTVMSF → SLGKHCVVFN...IKAAKDNYSA
     1332-1336: Missing.
     1823-1823: G → GWKHWGQSQGRRRKGNC
     1861-1861: R → RGTSLLTNLQ...ETHKTATGSS
     2011-2011: Q → QAHLGIYFSI...LSRELENCFQ
     2495-2495: L → LVEEHLLFLQ...LIKVMAQKYE
     2573-2582: SCQASTWRKK → NLLETLAPGLKAILKKDIYQKKGHYFIRVGDAEFEYNSNFR
     2949-3016: KHTFCLLLRA...FYGHCVDKYH → TELLNENKETCNPINFPWEKLTSFQRLIL
     3069-3069: G → GIDLTNILLR...VLKDDFSFSR

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 35073507Dynein heavy chain 14, axonemal
PRO_0000286560

Regions

Nucleotide binding1164 – 11718ATP Potential
Nucleotide binding1427 – 14348ATP Potential
Motif1164 – 11718GPAGTGKT motif By similarity

Amino acid modifications

Glycosylation18181N-linked (GlcNAc...) Potential

Natural variations

Alternative sequence1 – 177177Missing in isoform 2, isoform 3 and isoform 4.
VSP_031314
Alternative sequence2491E → EDYLRESIIQQHMVSPEPAS LKEKGKSRRKKDQTHACPNV RKARPVSYDRT in isoform 2, isoform 3 and isoform 4.
VSP_031315
Alternative sequence3441K → KVINIVGSVKEVELIPTLEW LSERRHYYLLRQFKIFSDFR MNKAFVTWKLNVKRIKTEKS RSFLYHHLFLADDLFQTCLV YIRGLCEDAINLKNYNDHEN NLSAICLVK in isoform 2 and isoform 4.
VSP_031316
Alternative sequence345 – 35511LDSSRTYSLDE → RYLVICGAVYI in isoform 3.
VSP_038241
Alternative sequence356 – 35073152Missing in isoform 3.
VSP_038242
Alternative sequence473 – 35073035Missing in isoform 2.
VSP_031317
Alternative sequence6091A → DTEIETEFENKYMYYEFPEF PTNLFIDPNRLEFSVKIQNM LTNMEKCIT in isoform 4.
VSP_038243
Alternative sequence7441V → SLDYQSECLLYIDNVIHMSH TLIQSVIEKKNKNLLEVV in isoform 4.
VSP_038244
Alternative sequence9791K → KGLPKSDMVTHLKQVVTEFK QELPIIIALGNPCLKPRHWE ALQEIIGKSVPLDKNCKVEN LLALKMFQYENEINDMSTSA TNEAALEKMLFKIIDFWNTT PLPLILHHT in isoform 4.
VSP_038245
Alternative sequence10171K → KDLVNEWDQNLTLFSYTLEE WMNCQRNWLYLEPVFHSSEI RRQLPAETELFSQVISMWKK IMSKIQNKQNALQITTSAGV LEILQNCNIHLEHIKKSLED YLEVKRLIFPRFYFLSNAEL LDILADSRNPESVQPHLVKC FENIKQLLIWKQDIGPPAVK MLISAEGEGLVLPKKIRVRS AVEQWLVNVEKSMFDVLKKE RYIYNIILLFQ in isoform 4.
VSP_038246
Alternative sequence1180 – 121940CALFA…TVMSF → SLGKHCVVFNCFEDLDYKIV RKFFFGLVQSGAWSCFDEFN LIDLEVLSVIASQILTIKAA KDNYSA in isoform 4.
VSP_038247
Alternative sequence1332 – 13365Missing in isoform 4.
VSP_038248
Alternative sequence18231G → GWKHWGQSQGRRRKGNC in isoform 4.
VSP_038249
Alternative sequence18611R → RGTSLLTNLQRSGGNFLKIT ECGECINYTATRDTTCLSFL MSLLLKNSCPVLLTGESGVG KTAAINQMLEKLEGPGAFDI KHGSILGDTLLYSEIKKSSS LKQNITILIPETHKTATGSS in isoform 4.
VSP_038250
Alternative sequence20111Q → QAHLGIYFSINNFTPEVQKS KDQIISCSLAIYHQVRQNML PTPTKCHYMFNLRDMFKLLL GLLQADRTVVNSKEMAALLF VHEATRVFHDRLIDFTDKSL FYRLLSRELENCFQ in isoform 4.
VSP_038251
Alternative sequence24951L → LVEEHLLFLQAAYKDTVAEK QLLANRKTMASRRFQCASVL LTVLEDEKTRWQETINQIDN KLEGILGDILLSAACIVYSG ILTPEFRQLIVNKWETFCIE NGISLSSKFSLIKVMAQKYE in isoform 4.
VSP_038252
Alternative sequence2573 – 258210SCQASTWRKK → NLLETLAPGLKAILKKDIYQ KKGHYFIRVGDAEFEYNSNF R in isoform 4.
VSP_038253
Alternative sequence2949 – 301668KHTFC…VDKYH → TELLNENKETCNPINFPWEK LTSFQRLIL in isoform 4.
VSP_038254
Alternative sequence30691G → GIDLTNILLRFAQELKGTTH HVTIISLGRDQAAKAEDLIL KALTKTQQWVFLQNCHLATS FMPRLCTIVESFNSPNVTID PEFRLWLSSKSYSSFPIPVL KKGLKIAVESPQGLKSNLLQ TFGCTGSGEVTEEIFENPDC GQWWKKLLFSLCFFNAVINE RKNYGILGWNIAYKFNSSDL GVAIKVLENSLRGQPSISWQ ALRYLIGEVIYGGRVIDNWD KRCLKTLLYKFCNPEVLKDD FSFSR in isoform 4.
VSP_038255
Natural variant2201T → S. Ref.3
Corresponds to variant rs41267347 [ dbSNP | Ensembl ].
VAR_032116
Natural variant2741P → L. Ref.3
Corresponds to variant rs41267349 [ dbSNP | Ensembl ].
VAR_032117
Natural variant26711K → E.
Corresponds to variant rs6667999 [ dbSNP | Ensembl ].
VAR_057764

Experimental info

Sequence conflict4241F → L in AAI19718. Ref.3

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified February 26, 2008. Version 3.
Checksum: CF0471356846EEA9

FASTA3,507399,895
        10         20         30         40         50         60 
MGRRSQWIWA MRCQMLVPVL SLHIGLARAL GCGCIASKIE CLIRCNAPFP LLDAVGSVAS 

        70         80         90        100        110        120 
QELQSLTGTV GVTSGAAAYP RWNLARARAP PHLPGTQDPL RRVRDPTPIV ASSPGRRRGS 

       130        140        150        160        170        180 
WSGGYGQEAS EPGVVGLCCA VLPIHPSLAL AGVGGPDLRR FQEGPQRPSD HGAAEKHMET 

       190        200        210        220        230        240 
FIPIDLTTEN QEMDKEETKT KPRLLRYEEK KYEDVKPLET QPAEIAEKET LEYKTVRTFS 

       250        260        270        280        290        300 
ESLKSEKTEE PKDDDVIRNI IRLREKLGWQ TILPQHSLKY GSSKIAIQKI TLKKPLEDDG 

       310        320        330        340        350        360 
EFVYCLPRKS PKSLYNPYDL QVVSAHTAKH CKEFWVITAS FISKLDSSRT YSLDEFCEEQ 

       370        380        390        400        410        420 
LQQATQALKQ LEDIRNKAIS EMKSTFLKVA EKNEIKEYFE SKLSEDDTTH FKLPKYRRLL 

       430        440        450        460        470        480 
ETFFKFVMLV DYIFQELIRQ LMNTAVTLLL ELFNGSAGMP FSVEKKNENL IRTFKDNSFP 

       490        500        510        520        530        540 
TGKTTNDCEE LVDNSKLHAI SVQKSEVKTD TDINEILNSV EVGKDLRKTY APIFEVNLCL 

       550        560        570        580        590        600 
RIPAESDSSE NSKENFHESD QCPEECVMFE DEMSENKDNC VKKHSSEELL PKAKKSKEIS 

       610        620        630        640        650        660 
YNLEDIISAT ITPLCQDPQL SIFIDLVSIM DLPNKTGSII HYKEQTRWPD CHILFETDPA 

       670        680        690        700        710        720 
YQNIIVNLLT IIGNSMGLVN AYSHKFIKYC TMTEKAKIMS MKISSMGELT SKEFEAILNR 

       730        740        750        760        770        780 
FRNYFRHIVN MAIEKRIGIF NVVVESSLQQ LECDPTEIEE FLEHFIFLNA ISSKISKLEK 

       790        800        810        820        830        840 
EFLTMSQLYS VAKHHQIHIS EEQIAIFQVL LLKFSQLKSS MKLSKINKDT AITKFRDNLE 

       850        860        870        880        890        900 
ACISGLHVDV GNLKAKIRTP LLLCAGTQVS TAMEMIQTLS GEAASLTNKA KAYSHYQDCF 

       910        920        930        940        950        960 
SDSQSHMHSV NVEEITQIVL SEISDIEGDL TLRKKLWEAQ EEWKRASWEW RNSSLQSIDV 

       970        980        990       1000       1010       1020 
ESVQRNVSKL MHIISVLEKE IYSIFIIPSI DDISAQLEES QVILATIKGS PHIGPIKSQI 

      1030       1040       1050       1060       1070       1080 
MFYNDCVKSF VSSYSREKLE KVHAGLMCHL EEVADLVVLD TSNSRTKAIL GALLILYVHC 

      1090       1100       1110       1120       1130       1140 
RDIVINLLLK NIFNAEDFEW TRHLQYKWNE KQKLCYVSQG NASFTYGYEY LGCTSRLVIT 

      1150       1160       1170       1180       1190       1200 
PLTDRCWLTL MEALHLNLGG CPAGPAGTGK TETVKDLAKC ALFAFKCNTA LIKLPNSLIV 

      1210       1220       1230       1240       1250       1260 
LTCFGLEKTV LVMNTVMSFR FVLEGKEIRI NMSCAVFITM NPRYGGGVEL PDNLKSLFRP 

      1270       1280       1290       1300       1310       1320 
VAMMVPHYQM IAEIILFSFG FKSANSLSGK LTNLYELARK QLSQQDHYNF GLRSLKIVLI 

      1330       1340       1350       1360       1370       1380 
MAGTKKREFK CDTSDSLSEA DETLIVIEAI REASLPKCPP EDVPLFENII GDIFPEVTVL 

      1390       1400       1410       1420       1430       1440 
KVNQLALEKV IYTATQQLGL QNWSSQKEKI IQFYNQLQVC VGVMLVGPTG GGKTTVRRIL 

      1450       1460       1470       1480       1490       1500 
EKALTLLPIA DFLSVAERKS ASKISERKGK VDICVLNPKC VTLSELYGQL DPNTMEWTDG 

      1510       1520       1530       1540       1550       1560 
LLSATIRSYV YFNTPKNTKK DIDLRLKSRI SDLSNVFKLD SSDTTETDDN IFEEIEKVVK 

      1570       1580       1590       1600       1610       1620 
IPENHNFDWQ WIILDGPVDT FWVENLNSVL DDTRTLCLAN SERIALTNKI RVIFEVDNLS 

      1630       1640       1650       1660       1670       1680 
QASPATVSRC AMVYMDPVDL GWEPYVKSWL LKTSKIISQS GVDCLEFMIK NSVTDGLQFI 

      1690       1700       1710       1720       1730       1740 
RNRQKFQPYP MEDITVVITL CRILDAFFDF MGKNGGFEQS DDLNDTSSKE ANSQRESVTF 

      1750       1760       1770       1780       1790       1800 
KDIEKRDENT WYPEKNPDKL TKIIQKLFVF AFTWAFGGAL NREDEHRENI PFCPSLEPDS 

      1810       1820       1830       1840       1850       1860 
LAKVTYDFDK LVHELFGNSS QVGINLPTGE CSIFGYFVDI EQCEFIPWSD LVPNDQTLIQ 

      1870       1880       1890       1900       1910       1920 
RDNPTKKPEV RTNKKLLKNN DHKGVVVSTI NFSTNVTAAK TKEMILKKLI RRTKDTLGAP 

      1930       1940       1950       1960       1970       1980 
KNNRILIFID DMNMPVSDMY GAQPPLELIR QLLDLGGVYD TEKNTWKNIQ DLSIVAACVP 

      1990       2000       2010       2020       2030       2040 
VVNDISPRLL KHFSMLVLPH PSQDILCTIF QIGIDGCGKK TCATLACYLT DNKLYRVPIS 

      2050       2060       2070       2080       2090       2100 
HKCAYIEFKE VFKKVFIHAG LKGKPTVLMV PNLNIEQDSF LEDLNYIISS GRIPDLFENV 

      2110       2120       2130       2140       2150       2160 
ELDSIAMKIR YLTEQSGHMD NRQSLLSFFQ KRIYKNLHIF VIMSPEGPSF RQNCRVYPSM 

      2170       2180       2190       2200       2210       2220 
ISSCTIDWYE RWPEEALLIV ANSFLKEKVN FENRENLKEK LAPTCVQIHK SMKDLNRKYF 

      2230       2240       2250       2260       2270       2280 
EETGRFYYTT PNSYLQFMET FAHILRAREE EMQTKRDRFH MGLSTILEAT TLVTEMQEEL 

      2290       2300       2310       2320       2330       2340 
LILGPQVEQK TKETETLMEK LRKDSQVVEK VQMLVKQDEE IVAEEVRIVE DYAQKTANEL 

      2350       2360       2370       2380       2390       2400 
KSVLPAFDKA IVALNALDKA DVAELRVYTR PPFLVLTVMN AVCILLQKKP NWATAKLLLS 

      2410       2420       2430       2440       2450       2460 
ETGFLKKLIN LDKDSIPDKV FVKLKKIVTL PDFNPHKISL VSVACCSLCQ WVIALNNYHE 

      2470       2480       2490       2500       2510       2520 
VQKVVGPKQI QVAEAQNVLK IARQRLAEKQ RGLQLISRWH NQGLPHGQYS VENAILIKNG 

      2530       2540       2550       2560       2570       2580 
QQWPLLIDPH RQAHKWIRQM EGSRLQKLSI EDSNYTKKIE NAMKTGGSVL LQSCQASTWR 

      2590       2600       2610       2620       2630       2640 
KKLYLSTEID NPHFLPSVYN FVTMINFTVT FQGLQDQLLS TVVTHEVPHL EDQRSKLLES 

      2650       2660       2670       2680       2690       2700 
ISLDAITLEE LEEKTLNLLQ KALGSILDDD KIVDTLRKSK MTSNEISKRI EATKKAESEI 

      2710       2720       2730       2740       2750       2760 
QAIRKNYLPI ATRGALLYFL VADLTQINYM YQFSLDWFHQ VFVSSVVSKS KEQEHSFKRE 

      2770       2780       2790       2800       2810       2820 
KVSPKEVHEF ISISKEPNLE NEKNLLDKHI KSAIDMLTKS IFKVVSSALF NEDKLCFSFR 

      2830       2840       2850       2860       2870       2880 
LCTVIMQNNA NGNLIQDDIG FLPEEEWNIF LYSGILINIK SALSQSRLTS TFEIGESQHL 

      2890       2900       2910       2920       2930       2940 
QWLSDSRWRQ CQYVSTHLEP FSLLCKSLLS NVSQWDTFKN SKAVYSLIST PFSSENASLE 

      2950       2960       2970       2980       2990       3000 
ENTKPPEEKH TFCLLLRAIN HTGTDLGPVG RGQWLTSTAC DRHTDVCSFS FALNDGVPDV 

      3010       3020       3030       3040       3050       3060 
EHVQDIFYGH CVDKYHVKVL RPESLNNSVR KFITEKMGNK YLQRTGVNLK DAYKGSNART 

      3070       3080       3090       3100       3110       3120 
PLILIQTHGS ASIKDYIHII QSLPDDDLPE VLGIHPEAIR SCWETQGEKF IENLIAMQPK 

      3130       3140       3150       3160       3170       3180 
TTTANLMIRP EQSKDELVME ILSDLLKRLP LTVEKEEIAV GTPSTLKSMM SSSIWESLSK 

      3190       3200       3210       3220       3230       3240 
NLKDHDPLIH CVLLTFLKQE IKRFDKLLFV IHKSLKDLQL AIKGEIILTQ ELEEIFNSFL 

      3250       3260       3270       3280       3290       3300 
NMRVPTLWQK HAYRSCKPLS SWIDDLIQRL NFFNTWAKVA YTAIQRRYMR FVTVWKQSIP 

      3310       3320       3330       3340       3350       3360 
STSQKCKHPE DSENNFFEGF PSRYWLPAFF FPQAFLAAVL QDYGRSRGIA VDALTFTHHV 

      3370       3380       3390       3400       3410       3420 
ISNTTDKDEK FSVFMPKKLN IVRRAFKGSA SSHTGVYIFG LFIEGARWNR EQKILEDSLP 

      3430       3440       3450       3460       3470       3480 
LEMCCDFPDI YFLPTKISTK TPNASNQTDS ELYAFECPVY QTPERSRILA TTGLPTNFLT 

      3490       3500 
SVYLSTKKPP SHWITMRVAL LCEKNEK 

« Hide

Isoform 2 [UniParc].

Checksum: 4FCBD670CE50E236
Show »

FASTA45353,464
Isoform 3 [UniParc].

Checksum: B038A7FB9772243D
Show »

FASTA22826,682
Isoform 4 [UniParc].

Checksum: F59EF01CCCED2401
Show »

FASTA4,515518,565

References

[1]"The DNA sequence and biological annotation of human chromosome 1."
Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. expand/collapse author list , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[2]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[3]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANTS SER-220 AND LEU-274.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AC093560 Genomic DNA. No translation available.
AL590547 Genomic DNA. No translation available.
AL596134 Genomic DNA. No translation available.
AL645769 Genomic DNA. No translation available.
AL357912 Genomic DNA. Translation: CAI95150.2. Sequence problems.
AL162738 Genomic DNA. Translation: CAI95641.1. Sequence problems.
AL162738, AC092811 Genomic DNA. Translation: CAI95642.2. Sequence problems.
CH471098 Genomic DNA. Translation: EAW69735.1. Sequence problems.
BC119716 mRNA. Translation: AAI19717.1. Different initiation.
BC119717 mRNA. Translation: AAI19718.1. Different initiation.
RefSeqNP_001138626.1. NM_001145154.1.
NP_001364.1. NM_001373.1.
NP_659426.2. NM_144989.2.
UniGeneHs.133977.

3D structure databases

ProteinModelPortalQ0VDD8.
SMRQ0VDD8. Positions 1149-1634, 1887-2486, 2499-2918.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid126070. 3 interactions.

PTM databases

PhosphoSiteQ0VDD8.

Polymorphism databases

DMDM172046085.

Proteomic databases

PaxDbQ0VDD8.
PRIDEQ0VDD8.

Protocols and materials databases

DNASU127602.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000366848; ENSP00000355813; ENSG00000185842. [Q0VDD8-3]
ENST00000366850; ENSP00000355815; ENSG00000185842. [Q0VDD8-3]
ENST00000400952; ENSP00000383737; ENSG00000185842. [Q0VDD8-2]
ENST00000430092; ENSP00000414402; ENSG00000185842. [Q0VDD8-4]
ENST00000439375; ENSP00000392061; ENSG00000185842. [Q0VDD8-4]
ENST00000445597; ENSP00000409472; ENSG00000185842. [Q0VDD8-1]
GeneID127602.
KEGGhsa:127602.
UCSCuc001hot.4. human. [Q0VDD8-2]
uc001hov.4. human. [Q0VDD8-3]
uc001how.2. human. [Q0VDD8-4]

Organism-specific databases

CTD127602.
GeneCardsGC01P225083.
HGNCHGNC:2945. DNAH14.
HPAHPA027718.
MIM603341. gene.
neXtProtNX_Q0VDD8.
PharmGKBPA27399.
GenAtlasSearch...

Phylogenomic databases

eggNOGCOG5245.
OMATRHLQYK.
OrthoDBEOG7KWSGN.
PhylomeDBQ0VDD8.
TreeFamTF342240.

Gene expression databases

ArrayExpressQ0VDD8.
BgeeQ0VDD8.
GenevestigatorQ0VDD8.

Family and domain databases

Gene3D3.40.50.300. 7 hits.
InterProIPR026983. DHC_fam.
IPR024743. Dynein_HC_stalk.
IPR024317. Dynein_heavy_chain_D4_dom.
IPR004273. Dynein_heavy_dom.
IPR027417. P-loop_NTPase.
[Graphical view]
PANTHERPTHR10676. PTHR10676. 1 hit.
PfamPF12780. AAA_8. 1 hit.
PF03028. Dynein_heavy. 3 hits.
PF12777. MT. 1 hit.
[Graphical view]
SUPFAMSSF52540. SSF52540. 6 hits.
ProtoNetSearch...

Other

GenomeRNAi127602.
NextBio82137.
PROQ0VDD8.
SOURCESearch...

Entry information

Entry nameDYH14_HUMAN
AccessionPrimary (citable) accession number: Q0VDD8
Secondary accession number(s): A6NG62 expand/collapse secondary AC list , A6NNL2, Q0VDD9, Q4VXC7, Q4VXG4, Q4VXG5, Q5VU33, Q5VU34
Entry history
Integrated into UniProtKB/Swiss-Prot: May 15, 2007
Last sequence update: February 26, 2008
Last modified: April 16, 2014
This is version 72 of the entry and version 3 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 1

Human chromosome 1: entries, gene names and cross-references to MIM