Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q0VDD8

- DYH14_HUMAN

UniProt

Q0VDD8 - DYH14_HUMAN

Protein

Dynein heavy chain 14, axonemal

Gene

DNAH14

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 75 (01 Oct 2014)
      Sequence version 3 (26 Feb 2008)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Force generating protein of respiratory cilia. Produces force towards the minus ends of microtubules. Dynein has ATPase activity; the force-producing power stroke is thought to occur on release of ADP. Involved in sperm motility; implicated in sperm flagellar assembly By similarity.By similarity

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Nucleotide bindingi1164 – 11718ATPSequence Analysis
    Nucleotide bindingi1427 – 14348ATPSequence Analysis

    GO - Molecular functioni

    1. ATP binding Source: UniProtKB-KW
    2. microtubule motor activity Source: InterPro

    GO - Biological processi

    1. microtubule-based movement Source: InterPro

    Keywords - Molecular functioni

    Motor protein

    Keywords - Ligandi

    ATP-binding, Nucleotide-binding

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Dynein heavy chain 14, axonemal
    Alternative name(s):
    Axonemal beta dynein heavy chain 14
    Ciliary dynein heavy chain 14
    Gene namesi
    Name:DNAH14
    Synonyms:C1orf67
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 1

    Organism-specific databases

    HGNCiHGNC:2945. DNAH14.

    Subcellular locationi

    GO - Cellular componenti

    1. cilium Source: UniProtKB-KW
    2. cytoplasm Source: UniProtKB-KW
    3. dynein complex Source: UniProtKB-KW
    4. microtubule Source: UniProtKB-KW

    Keywords - Cellular componenti

    Cell projection, Cilium, Cytoplasm, Cytoskeleton, Dynein, Microtubule

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA27399.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 35073507Dynein heavy chain 14, axonemalPRO_0000286560Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi1818 – 18181N-linked (GlcNAc...)Sequence Analysis

    Keywords - PTMi

    Glycoprotein

    Proteomic databases

    MaxQBiQ0VDD8.
    PaxDbiQ0VDD8.
    PRIDEiQ0VDD8.

    PTM databases

    PhosphoSiteiQ0VDD8.

    Expressioni

    Gene expression databases

    ArrayExpressiQ0VDD8.
    BgeeiQ0VDD8.
    GenevestigatoriQ0VDD8.

    Organism-specific databases

    HPAiHPA027718.

    Interactioni

    Subunit structurei

    Consists of at least two heavy chains and a number of intermediate and light chains.

    Protein-protein interaction databases

    BioGridi126070. 3 interactions.

    Structurei

    3D structure databases

    ProteinModelPortaliQ0VDD8.
    SMRiQ0VDD8. Positions 1149-1634, 1887-2486, 2499-2918.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Motif

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Motifi1164 – 11718GPAGTGKT motifBy similarity

    Domaini

    Dynein heavy chains probably consist of an N-terminal stem (which binds cargo and interacts with other dynein components), and the head or motor domain. The motor contains six tandemly-linked AAA domains in the head, which form a ring. A stalk-like structure (formed by two of the coiled coil domains) protrudes between AAA 4 and AAA 5 and terminates in a microtubule-binding site. A seventh domain may also contribute to this ring; it is not clear whether the N-terminus or the C-terminus forms this extra domain. There are four well-conserved and two non-conserved ATPase sites, one per AAA domain. Probably only one of these (within AAA 1) actually hydrolyzes ATP, the others may serve a regulatory function By similarity.By similarity

    Sequence similaritiesi

    Belongs to the dynein heavy chain family.Curated

    Keywords - Domaini

    Coiled coil

    Phylogenomic databases

    eggNOGiCOG5245.
    OMAiHLQYKWN.
    OrthoDBiEOG7KWSGN.
    PhylomeDBiQ0VDD8.
    TreeFamiTF342240.

    Family and domain databases

    Gene3Di3.40.50.300. 7 hits.
    InterProiIPR026983. DHC_fam.
    IPR024743. Dynein_HC_stalk.
    IPR024317. Dynein_heavy_chain_D4_dom.
    IPR004273. Dynein_heavy_dom.
    IPR027417. P-loop_NTPase.
    [Graphical view]
    PANTHERiPTHR10676. PTHR10676. 1 hit.
    PfamiPF12780. AAA_8. 1 hit.
    PF03028. Dynein_heavy. 3 hits.
    PF12777. MT. 1 hit.
    [Graphical view]
    SUPFAMiSSF52540. SSF52540. 6 hits.

    Sequences (4)i

    Sequence statusi: Complete.

    This entry describes 4 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q0VDD8-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MGRRSQWIWA MRCQMLVPVL SLHIGLARAL GCGCIASKIE CLIRCNAPFP     50
    LLDAVGSVAS QELQSLTGTV GVTSGAAAYP RWNLARARAP PHLPGTQDPL 100
    RRVRDPTPIV ASSPGRRRGS WSGGYGQEAS EPGVVGLCCA VLPIHPSLAL 150
    AGVGGPDLRR FQEGPQRPSD HGAAEKHMET FIPIDLTTEN QEMDKEETKT 200
    KPRLLRYEEK KYEDVKPLET QPAEIAEKET LEYKTVRTFS ESLKSEKTEE 250
    PKDDDVIRNI IRLREKLGWQ TILPQHSLKY GSSKIAIQKI TLKKPLEDDG 300
    EFVYCLPRKS PKSLYNPYDL QVVSAHTAKH CKEFWVITAS FISKLDSSRT 350
    YSLDEFCEEQ LQQATQALKQ LEDIRNKAIS EMKSTFLKVA EKNEIKEYFE 400
    SKLSEDDTTH FKLPKYRRLL ETFFKFVMLV DYIFQELIRQ LMNTAVTLLL 450
    ELFNGSAGMP FSVEKKNENL IRTFKDNSFP TGKTTNDCEE LVDNSKLHAI 500
    SVQKSEVKTD TDINEILNSV EVGKDLRKTY APIFEVNLCL RIPAESDSSE 550
    NSKENFHESD QCPEECVMFE DEMSENKDNC VKKHSSEELL PKAKKSKEIS 600
    YNLEDIISAT ITPLCQDPQL SIFIDLVSIM DLPNKTGSII HYKEQTRWPD 650
    CHILFETDPA YQNIIVNLLT IIGNSMGLVN AYSHKFIKYC TMTEKAKIMS 700
    MKISSMGELT SKEFEAILNR FRNYFRHIVN MAIEKRIGIF NVVVESSLQQ 750
    LECDPTEIEE FLEHFIFLNA ISSKISKLEK EFLTMSQLYS VAKHHQIHIS 800
    EEQIAIFQVL LLKFSQLKSS MKLSKINKDT AITKFRDNLE ACISGLHVDV 850
    GNLKAKIRTP LLLCAGTQVS TAMEMIQTLS GEAASLTNKA KAYSHYQDCF 900
    SDSQSHMHSV NVEEITQIVL SEISDIEGDL TLRKKLWEAQ EEWKRASWEW 950
    RNSSLQSIDV ESVQRNVSKL MHIISVLEKE IYSIFIIPSI DDISAQLEES 1000
    QVILATIKGS PHIGPIKSQI MFYNDCVKSF VSSYSREKLE KVHAGLMCHL 1050
    EEVADLVVLD TSNSRTKAIL GALLILYVHC RDIVINLLLK NIFNAEDFEW 1100
    TRHLQYKWNE KQKLCYVSQG NASFTYGYEY LGCTSRLVIT PLTDRCWLTL 1150
    MEALHLNLGG CPAGPAGTGK TETVKDLAKC ALFAFKCNTA LIKLPNSLIV 1200
    LTCFGLEKTV LVMNTVMSFR FVLEGKEIRI NMSCAVFITM NPRYGGGVEL 1250
    PDNLKSLFRP VAMMVPHYQM IAEIILFSFG FKSANSLSGK LTNLYELARK 1300
    QLSQQDHYNF GLRSLKIVLI MAGTKKREFK CDTSDSLSEA DETLIVIEAI 1350
    REASLPKCPP EDVPLFENII GDIFPEVTVL KVNQLALEKV IYTATQQLGL 1400
    QNWSSQKEKI IQFYNQLQVC VGVMLVGPTG GGKTTVRRIL EKALTLLPIA 1450
    DFLSVAERKS ASKISERKGK VDICVLNPKC VTLSELYGQL DPNTMEWTDG 1500
    LLSATIRSYV YFNTPKNTKK DIDLRLKSRI SDLSNVFKLD SSDTTETDDN 1550
    IFEEIEKVVK IPENHNFDWQ WIILDGPVDT FWVENLNSVL DDTRTLCLAN 1600
    SERIALTNKI RVIFEVDNLS QASPATVSRC AMVYMDPVDL GWEPYVKSWL 1650
    LKTSKIISQS GVDCLEFMIK NSVTDGLQFI RNRQKFQPYP MEDITVVITL 1700
    CRILDAFFDF MGKNGGFEQS DDLNDTSSKE ANSQRESVTF KDIEKRDENT 1750
    WYPEKNPDKL TKIIQKLFVF AFTWAFGGAL NREDEHRENI PFCPSLEPDS 1800
    LAKVTYDFDK LVHELFGNSS QVGINLPTGE CSIFGYFVDI EQCEFIPWSD 1850
    LVPNDQTLIQ RDNPTKKPEV RTNKKLLKNN DHKGVVVSTI NFSTNVTAAK 1900
    TKEMILKKLI RRTKDTLGAP KNNRILIFID DMNMPVSDMY GAQPPLELIR 1950
    QLLDLGGVYD TEKNTWKNIQ DLSIVAACVP VVNDISPRLL KHFSMLVLPH 2000
    PSQDILCTIF QIGIDGCGKK TCATLACYLT DNKLYRVPIS HKCAYIEFKE 2050
    VFKKVFIHAG LKGKPTVLMV PNLNIEQDSF LEDLNYIISS GRIPDLFENV 2100
    ELDSIAMKIR YLTEQSGHMD NRQSLLSFFQ KRIYKNLHIF VIMSPEGPSF 2150
    RQNCRVYPSM ISSCTIDWYE RWPEEALLIV ANSFLKEKVN FENRENLKEK 2200
    LAPTCVQIHK SMKDLNRKYF EETGRFYYTT PNSYLQFMET FAHILRAREE 2250
    EMQTKRDRFH MGLSTILEAT TLVTEMQEEL LILGPQVEQK TKETETLMEK 2300
    LRKDSQVVEK VQMLVKQDEE IVAEEVRIVE DYAQKTANEL KSVLPAFDKA 2350
    IVALNALDKA DVAELRVYTR PPFLVLTVMN AVCILLQKKP NWATAKLLLS 2400
    ETGFLKKLIN LDKDSIPDKV FVKLKKIVTL PDFNPHKISL VSVACCSLCQ 2450
    WVIALNNYHE VQKVVGPKQI QVAEAQNVLK IARQRLAEKQ RGLQLISRWH 2500
    NQGLPHGQYS VENAILIKNG QQWPLLIDPH RQAHKWIRQM EGSRLQKLSI 2550
    EDSNYTKKIE NAMKTGGSVL LQSCQASTWR KKLYLSTEID NPHFLPSVYN 2600
    FVTMINFTVT FQGLQDQLLS TVVTHEVPHL EDQRSKLLES ISLDAITLEE 2650
    LEEKTLNLLQ KALGSILDDD KIVDTLRKSK MTSNEISKRI EATKKAESEI 2700
    QAIRKNYLPI ATRGALLYFL VADLTQINYM YQFSLDWFHQ VFVSSVVSKS 2750
    KEQEHSFKRE KVSPKEVHEF ISISKEPNLE NEKNLLDKHI KSAIDMLTKS 2800
    IFKVVSSALF NEDKLCFSFR LCTVIMQNNA NGNLIQDDIG FLPEEEWNIF 2850
    LYSGILINIK SALSQSRLTS TFEIGESQHL QWLSDSRWRQ CQYVSTHLEP 2900
    FSLLCKSLLS NVSQWDTFKN SKAVYSLIST PFSSENASLE ENTKPPEEKH 2950
    TFCLLLRAIN HTGTDLGPVG RGQWLTSTAC DRHTDVCSFS FALNDGVPDV 3000
    EHVQDIFYGH CVDKYHVKVL RPESLNNSVR KFITEKMGNK YLQRTGVNLK 3050
    DAYKGSNART PLILIQTHGS ASIKDYIHII QSLPDDDLPE VLGIHPEAIR 3100
    SCWETQGEKF IENLIAMQPK TTTANLMIRP EQSKDELVME ILSDLLKRLP 3150
    LTVEKEEIAV GTPSTLKSMM SSSIWESLSK NLKDHDPLIH CVLLTFLKQE 3200
    IKRFDKLLFV IHKSLKDLQL AIKGEIILTQ ELEEIFNSFL NMRVPTLWQK 3250
    HAYRSCKPLS SWIDDLIQRL NFFNTWAKVA YTAIQRRYMR FVTVWKQSIP 3300
    STSQKCKHPE DSENNFFEGF PSRYWLPAFF FPQAFLAAVL QDYGRSRGIA 3350
    VDALTFTHHV ISNTTDKDEK FSVFMPKKLN IVRRAFKGSA SSHTGVYIFG 3400
    LFIEGARWNR EQKILEDSLP LEMCCDFPDI YFLPTKISTK TPNASNQTDS 3450
    ELYAFECPVY QTPERSRILA TTGLPTNFLT SVYLSTKKPP SHWITMRVAL 3500
    LCEKNEK 3507

    Note: No experimental confirmation available.

    Length:3,507
    Mass (Da):399,895
    Last modified:February 26, 2008 - v3
    Checksum:iCF0471356846EEA9
    GO
    Isoform 2 (identifier: Q0VDD8-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-177: Missing.
         249-249: E → EDYLRESIIQQHMVSPEPASLKEKGKSRRKKDQTHACPNVRKARPVSYDRT
         344-344: K → KVINIVGSVK...NNLSAICLVK
         473-3507: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:453
    Mass (Da):53,464
    Checksum:i4FCBD670CE50E236
    GO
    Isoform 3 (identifier: Q0VDD8-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-177: Missing.
         249-249: E → EDYLRESIIQQHMVSPEPASLKEKGKSRRKKDQTHACPNVRKARPVSYDRT
         345-355: LDSSRTYSLDE → RYLVICGAVYI
         356-3507: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:228
    Mass (Da):26,682
    Checksum:iB038A7FB9772243D
    GO
    Isoform 4 (identifier: Q0VDD8-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-177: Missing.
         249-249: E → EDYLRESIIQQHMVSPEPASLKEKGKSRRKKDQTHACPNVRKARPVSYDRT
         344-344: K → KVINIVGSVK...NNLSAICLVK
         609-609: A → DTEIETEFENKYMYYEFPEFPTNLFIDPNRLEFSVKIQNMLTNMEKCIT
         744-744: V → SLDYQSECLLYIDNVIHMSHTLIQSVIEKKNKNLLEVV
         979-979: K → KGLPKSDMVT...TPLPLILHHT
         1017-1017: K → KDLVNEWDQN...YIYNIILLFQ
         1180-1219: CALFAFKCNT...VLVMNTVMSF → SLGKHCVVFN...IKAAKDNYSA
         1332-1336: Missing.
         1823-1823: G → GWKHWGQSQGRRRKGNC
         1861-1861: R → RGTSLLTNLQ...ETHKTATGSS
         2011-2011: Q → QAHLGIYFSI...LSRELENCFQ
         2495-2495: L → LVEEHLLFLQ...LIKVMAQKYE
         2573-2582: SCQASTWRKK → NLLETLAPGLKAILKKDIYQKKGHYFIRVGDAEFEYNSNFR
         2949-3016: KHTFCLLLRA...FYGHCVDKYH → TELLNENKETCNPINFPWEKLTSFQRLIL
         3069-3069: G → GIDLTNILLR...VLKDDFSFSR

    Show »
    Length:4,515
    Mass (Da):518,565
    Checksum:iF59EF01CCCED2401
    GO

    Sequence cautioni

    The sequence AAI19717.1 differs from that shown. Reason: Erroneous initiation.
    The sequence AAI19718.1 differs from that shown. Reason: Erroneous initiation.
    The sequence CAI95150.2 differs from that shown. Reason: Erroneous gene model prediction.
    The sequence CAI95641.1 differs from that shown. Reason: Erroneous gene model prediction.
    The sequence CAI95642.2 differs from that shown. Reason: Erroneous gene model prediction.
    The sequence EAW69735.1 differs from that shown. Reason: Erroneous gene model prediction.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti424 – 4241F → L in AAI19718. (PubMed:15489334)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti220 – 2201T → S.1 Publication
    Corresponds to variant rs41267347 [ dbSNP | Ensembl ].
    VAR_032116
    Natural varianti274 – 2741P → L.1 Publication
    Corresponds to variant rs41267349 [ dbSNP | Ensembl ].
    VAR_032117
    Natural varianti2671 – 26711K → E.
    Corresponds to variant rs6667999 [ dbSNP | Ensembl ].
    VAR_057764

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 177177Missing in isoform 2, isoform 3 and isoform 4. 1 PublicationVSP_031314Add
    BLAST
    Alternative sequencei249 – 2491E → EDYLRESIIQQHMVSPEPAS LKEKGKSRRKKDQTHACPNV RKARPVSYDRT in isoform 2, isoform 3 and isoform 4. 1 PublicationVSP_031315
    Alternative sequencei344 – 3441K → KVINIVGSVKEVELIPTLEW LSERRHYYLLRQFKIFSDFR MNKAFVTWKLNVKRIKTEKS RSFLYHHLFLADDLFQTCLV YIRGLCEDAINLKNYNDHEN NLSAICLVK in isoform 2 and isoform 4. 1 PublicationVSP_031316
    Alternative sequencei345 – 35511LDSSRTYSLDE → RYLVICGAVYI in isoform 3. CuratedVSP_038241Add
    BLAST
    Alternative sequencei356 – 35073152Missing in isoform 3. CuratedVSP_038242Add
    BLAST
    Alternative sequencei473 – 35073035Missing in isoform 2. 1 PublicationVSP_031317Add
    BLAST
    Alternative sequencei609 – 6091A → DTEIETEFENKYMYYEFPEF PTNLFIDPNRLEFSVKIQNM LTNMEKCIT in isoform 4. CuratedVSP_038243
    Alternative sequencei744 – 7441V → SLDYQSECLLYIDNVIHMSH TLIQSVIEKKNKNLLEVV in isoform 4. CuratedVSP_038244
    Alternative sequencei979 – 9791K → KGLPKSDMVTHLKQVVTEFK QELPIIIALGNPCLKPRHWE ALQEIIGKSVPLDKNCKVEN LLALKMFQYENEINDMSTSA TNEAALEKMLFKIIDFWNTT PLPLILHHT in isoform 4. CuratedVSP_038245
    Alternative sequencei1017 – 10171K → KDLVNEWDQNLTLFSYTLEE WMNCQRNWLYLEPVFHSSEI RRQLPAETELFSQVISMWKK IMSKIQNKQNALQITTSAGV LEILQNCNIHLEHIKKSLED YLEVKRLIFPRFYFLSNAEL LDILADSRNPESVQPHLVKC FENIKQLLIWKQDIGPPAVK MLISAEGEGLVLPKKIRVRS AVEQWLVNVEKSMFDVLKKE RYIYNIILLFQ in isoform 4. CuratedVSP_038246
    Alternative sequencei1180 – 121940CALFA…TVMSF → SLGKHCVVFNCFEDLDYKIV RKFFFGLVQSGAWSCFDEFN LIDLEVLSVIASQILTIKAA KDNYSA in isoform 4. CuratedVSP_038247Add
    BLAST
    Alternative sequencei1332 – 13365Missing in isoform 4. CuratedVSP_038248
    Alternative sequencei1823 – 18231G → GWKHWGQSQGRRRKGNC in isoform 4. CuratedVSP_038249
    Alternative sequencei1861 – 18611R → RGTSLLTNLQRSGGNFLKIT ECGECINYTATRDTTCLSFL MSLLLKNSCPVLLTGESGVG KTAAINQMLEKLEGPGAFDI KHGSILGDTLLYSEIKKSSS LKQNITILIPETHKTATGSS in isoform 4. CuratedVSP_038250
    Alternative sequencei2011 – 20111Q → QAHLGIYFSINNFTPEVQKS KDQIISCSLAIYHQVRQNML PTPTKCHYMFNLRDMFKLLL GLLQADRTVVNSKEMAALLF VHEATRVFHDRLIDFTDKSL FYRLLSRELENCFQ in isoform 4. CuratedVSP_038251
    Alternative sequencei2495 – 24951L → LVEEHLLFLQAAYKDTVAEK QLLANRKTMASRRFQCASVL LTVLEDEKTRWQETINQIDN KLEGILGDILLSAACIVYSG ILTPEFRQLIVNKWETFCIE NGISLSSKFSLIKVMAQKYE in isoform 4. CuratedVSP_038252
    Alternative sequencei2573 – 258210SCQASTWRKK → NLLETLAPGLKAILKKDIYQ KKGHYFIRVGDAEFEYNSNF R in isoform 4. CuratedVSP_038253
    Alternative sequencei2949 – 301668KHTFC…VDKYH → TELLNENKETCNPINFPWEK LTSFQRLIL in isoform 4. CuratedVSP_038254Add
    BLAST
    Alternative sequencei3069 – 30691G → GIDLTNILLRFAQELKGTTH HVTIISLGRDQAAKAEDLIL KALTKTQQWVFLQNCHLATS FMPRLCTIVESFNSPNVTID PEFRLWLSSKSYSSFPIPVL KKGLKIAVESPQGLKSNLLQ TFGCTGSGEVTEEIFENPDC GQWWKKLLFSLCFFNAVINE RKNYGILGWNIAYKFNSSDL GVAIKVLENSLRGQPSISWQ ALRYLIGEVIYGGRVIDNWD KRCLKTLLYKFCNPEVLKDD FSFSR in isoform 4. CuratedVSP_038255

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AC093560 Genomic DNA. No translation available.
    AL590547 Genomic DNA. No translation available.
    AL596134 Genomic DNA. No translation available.
    AL645769 Genomic DNA. No translation available.
    AL357912 Genomic DNA. Translation: CAI95150.2. Sequence problems.
    AL162738 Genomic DNA. Translation: CAI95641.1. Sequence problems.
    AL162738, AC092811 Genomic DNA. Translation: CAI95642.2. Sequence problems.
    CH471098 Genomic DNA. Translation: EAW69735.1. Sequence problems.
    BC119716 mRNA. Translation: AAI19717.1. Different initiation.
    BC119717 mRNA. Translation: AAI19718.1. Different initiation.
    CCDSiCCDS41472.1. [Q0VDD8-3]
    CCDS44322.1. [Q0VDD8-2]
    RefSeqiNP_001138626.1. NM_001145154.1. [Q0VDD8-2]
    NP_001364.1. NM_001373.1. [Q0VDD8-4]
    NP_659426.2. NM_144989.2. [Q0VDD8-3]
    UniGeneiHs.133977.

    Genome annotation databases

    EnsembliENST00000366848; ENSP00000355813; ENSG00000185842. [Q0VDD8-3]
    ENST00000366850; ENSP00000355815; ENSG00000185842. [Q0VDD8-3]
    ENST00000400952; ENSP00000383737; ENSG00000185842. [Q0VDD8-2]
    ENST00000430092; ENSP00000414402; ENSG00000185842. [Q0VDD8-4]
    ENST00000439375; ENSP00000392061; ENSG00000185842. [Q0VDD8-4]
    ENST00000445597; ENSP00000409472; ENSG00000185842. [Q0VDD8-1]
    GeneIDi127602.
    KEGGihsa:127602.
    UCSCiuc001hot.4. human. [Q0VDD8-2]
    uc001hov.4. human. [Q0VDD8-3]
    uc001how.2. human. [Q0VDD8-4]

    Polymorphism databases

    DMDMi172046085.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AC093560 Genomic DNA. No translation available.
    AL590547 Genomic DNA. No translation available.
    AL596134 Genomic DNA. No translation available.
    AL645769 Genomic DNA. No translation available.
    AL357912 Genomic DNA. Translation: CAI95150.2 . Sequence problems.
    AL162738 Genomic DNA. Translation: CAI95641.1 . Sequence problems.
    AL162738 , AC092811 Genomic DNA. Translation: CAI95642.2 . Sequence problems.
    CH471098 Genomic DNA. Translation: EAW69735.1 . Sequence problems.
    BC119716 mRNA. Translation: AAI19717.1 . Different initiation.
    BC119717 mRNA. Translation: AAI19718.1 . Different initiation.
    CCDSi CCDS41472.1. [Q0VDD8-3 ]
    CCDS44322.1. [Q0VDD8-2 ]
    RefSeqi NP_001138626.1. NM_001145154.1. [Q0VDD8-2 ]
    NP_001364.1. NM_001373.1. [Q0VDD8-4 ]
    NP_659426.2. NM_144989.2. [Q0VDD8-3 ]
    UniGenei Hs.133977.

    3D structure databases

    ProteinModelPortali Q0VDD8.
    SMRi Q0VDD8. Positions 1149-1634, 1887-2486, 2499-2918.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 126070. 3 interactions.

    PTM databases

    PhosphoSitei Q0VDD8.

    Polymorphism databases

    DMDMi 172046085.

    Proteomic databases

    MaxQBi Q0VDD8.
    PaxDbi Q0VDD8.
    PRIDEi Q0VDD8.

    Protocols and materials databases

    DNASUi 127602.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000366848 ; ENSP00000355813 ; ENSG00000185842 . [Q0VDD8-3 ]
    ENST00000366850 ; ENSP00000355815 ; ENSG00000185842 . [Q0VDD8-3 ]
    ENST00000400952 ; ENSP00000383737 ; ENSG00000185842 . [Q0VDD8-2 ]
    ENST00000430092 ; ENSP00000414402 ; ENSG00000185842 . [Q0VDD8-4 ]
    ENST00000439375 ; ENSP00000392061 ; ENSG00000185842 . [Q0VDD8-4 ]
    ENST00000445597 ; ENSP00000409472 ; ENSG00000185842 . [Q0VDD8-1 ]
    GeneIDi 127602.
    KEGGi hsa:127602.
    UCSCi uc001hot.4. human. [Q0VDD8-2 ]
    uc001hov.4. human. [Q0VDD8-3 ]
    uc001how.2. human. [Q0VDD8-4 ]

    Organism-specific databases

    CTDi 127602.
    GeneCardsi GC01P225083.
    HGNCi HGNC:2945. DNAH14.
    HPAi HPA027718.
    MIMi 603341. gene.
    neXtProti NX_Q0VDD8.
    PharmGKBi PA27399.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG5245.
    OMAi HLQYKWN.
    OrthoDBi EOG7KWSGN.
    PhylomeDBi Q0VDD8.
    TreeFami TF342240.

    Miscellaneous databases

    GenomeRNAii 127602.
    NextBioi 82137.
    PROi Q0VDD8.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q0VDD8.
    Bgeei Q0VDD8.
    Genevestigatori Q0VDD8.

    Family and domain databases

    Gene3Di 3.40.50.300. 7 hits.
    InterProi IPR026983. DHC_fam.
    IPR024743. Dynein_HC_stalk.
    IPR024317. Dynein_heavy_chain_D4_dom.
    IPR004273. Dynein_heavy_dom.
    IPR027417. P-loop_NTPase.
    [Graphical view ]
    PANTHERi PTHR10676. PTHR10676. 1 hit.
    Pfami PF12780. AAA_8. 1 hit.
    PF03028. Dynein_heavy. 3 hits.
    PF12777. MT. 1 hit.
    [Graphical view ]
    SUPFAMi SSF52540. SSF52540. 6 hits.
    ProtoNeti Search...

    Publicationsi

    1. "The DNA sequence and biological annotation of human chromosome 1."
      Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
      , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
      Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANTS SER-220 AND LEU-274.

    Entry informationi

    Entry nameiDYH14_HUMAN
    AccessioniPrimary (citable) accession number: Q0VDD8
    Secondary accession number(s): A6NG62
    , A6NNL2, Q0VDD9, Q4VXC7, Q4VXG4, Q4VXG5, Q5VU33, Q5VU34
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: May 15, 2007
    Last sequence update: February 26, 2008
    Last modified: October 1, 2014
    This is version 75 of the entry and version 3 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 1
      Human chromosome 1: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3