Q0VD83 (APOBR_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 47.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Apolipoprotein B receptor Alternative name(s): Apolipoprotein B-100 receptor Apolipoprotein B-48 receptor Short name=Apolipoprotein B48 receptor Short name=apoB-48R | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 1088 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Macrophage receptor that binds to the apolipoprotein B48 (APOB) of dietary triglyceride (TG)-rich lipoproteins (TRL) or to a like domain of APOB in hypertriglyceridemic very low density lipoprotein (HTG-VLDL). Binds and internalizes TRL when out of the context of the macrophage. May provide essential lipids to reticuloendothelial cells. Could also be involved in foam cell formation with elevated TRL and remnant lipoprotein (RLP). Mediates the rapid high-affinity uptake of chylomicrons (CM), HTG-VLDL, and trypsinized (tryp) VLDL devoid of APOE in vitro in macrophages. Ref.1 Ref.6 Ref.8 |
| Subunit structure | Homodimer. |
| Subcellular location | Cell membrane; Peripheral membrane protein. Note: Binds monocyte-macrophage membrane. Thought to be anchored in the membrane through an interaction with an integral membrane protein. Ref.4 Ref.5 |
| Tissue specificity | Expressed in peripheral blood leukocytes > bone marrow = spleen > lymph node, and only faintly visible in appendix and thymus. Expressed in the brain, heart, kidney, liver, lung, pancreas, and placenta. Expressed primarily by reticuloendothelial cells: monocytes, macrophages, and endothelial cells. Expressed in atherosclerotic lesion foam cells. Ref.1 Ref.4 |
| Induction | Suppressed significantly by PPARA and PPARG in THP-1 and blood-borne monocyte-macrophages. Decreased after pitavastatin treatment in peripheral blood macrophages and remnant lipoprotein (RLP)-induced foam cell formation. Ref.7 Ref.8 |
| Post-translational modification | There are 2 forms in macrophages, the membrane-binding proteins 200 kDa (MBP 200) and 235 kDa (MBP 235), that can be reduced into a single active ligand-binding species with intermediate mobility (MBP 200R). |
Ontologies
| Keywords | |
|---|---|
| Biological process | Cholesterol metabolism Lipid metabolism Lipid transport Steroid metabolism Transport |
| Cellular component | Cell membrane Chylomicron LDL Membrane VLDL |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Disease | Atherosclerosis |
| Molecular function | Receptor |
| PTM | Phosphoprotein |
| Technical term | Complete proteome Direct protein sequencing Reference proteome |
| Gene Ontology (GO) | |
| Biological process | cholesterol metabolic process Inferred from electronic annotation. Source: UniProtKB-KW lipid transportInferred from electronic annotation. Source: UniProtKB-KW |
| Cellular component | chylomicron Inferred from electronic annotation. Source: UniProtKB-KW low-density lipoprotein particleInferred from electronic annotation. Source: UniProtKB-KW plasma membraneInferred from electronic annotation. Source: UniProtKB-SubCell very-low-density lipoprotein particleInferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q0VD83-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q0VD83-2) The sequence of this isoform differs from the canonical sequence as follows: 1-462: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q0VD83-3) The sequence of this isoform differs from the canonical sequence as follows: 1047-1088: SPLRHDGTPVPARRRPLGHGFGLAHPGMMQELQARLGRPKPQ → RWEDRLRPGVRDQPGQHSKIPIF | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1088 | 1088 | Apolipoprotein B receptor | PRO_0000327263 | |||||
Regions | |||||||||
| Compositional bias | 158 – 961 | 804 | Glu-rich | ||||||
Amino acid modifications | |||||||||
| Modified residue | 585 | 1 | Phosphoserine By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 462 | 462 | Missing in isoform 2. | VSP_032733 | |||||
| Alternative sequence | 1047 – 1088 | 42 | SPLRH…RPKPQ → RWEDRLRPGVRDQPGQHSKI PIF in isoform 3. | VSP_032734 | |||||
| Natural variant | 419 | 1 | A → P. Ref.9 Corresponds to variant rs180743 [ dbSNP | Ensembl ]. | VAR_042432 | |||||
Experimental info | |||||||||
| Sequence conflict | 340 | 1 | A → S in AAF76255. Ref.1 | ||||||
| Sequence conflict | 340 | 1 | A → S in AAF76256. Ref.1 | ||||||
| Sequence conflict | 381 | 1 | E → Q in AAF76255. Ref.1 | ||||||
| Sequence conflict | 381 | 1 | E → Q in AAF76256. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "A macrophage receptor for apolipoprotein B48: cloning, expression, and atherosclerosis." Brown M.L., Ramprasad M.P., Umeda P.K., Tanaka A., Kobayashi Y., Watanabe T., Shimoyamada H., Kuo W.-L., Li R., Song R., Bradley W.A., Gianturco S.H. Proc. Natl. Acad. Sci. U.S.A. 97:7488-7493(2000) [PubMed: 10852956] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORM 1), PROTEIN SEQUENCE OF 814-821; 857-868 AND 910-919, FUNCTION, TISSUE SPECIFICITY. Tissue: Monocytic leukemia and Placenta. |
| [2] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). |
| [3] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 756-1088 (ISOFORM 3). Tissue: Placenta. |
| [4] | "Antipeptide antibodies reveal interrelationships of MBP 200 and MBP 235: unique apoB-specific receptors for triglyceride-rich lipoproteins on human monocyte-macrophages." Bradley W.A., Brown M.L., Ramprasad M.P., Li R., Song R., Gianturco S.H. J. Lipid Res. 40:744-752(1999) [PubMed: 10191299] [Abstract] Cited for: PROTEIN SEQUENCE OF 910-919, SUBCELLULAR LOCATION, TISSUE SPECIFICITY, POST-TRANSLATIONAL MODIFICATION. |
| [5] | "Human THP-1 monocyte-macrophage membrane binding proteins: distinct receptor(s) for triglyceride-rich lipoproteins." Ramprasad M.P., Li R., Bradley W.A., Gianturco S.H. Biochemistry 34:9126-9135(1995) [PubMed: 7619811] [Abstract] Cited for: SUBCELLULAR LOCATION, POST-TRANSLATIONAL MODIFICATION. |
| [6] | "Apolipoprotein B-48 or its apolipoprotein B-100 equivalent mediates the binding of triglyceride-rich lipoproteins to their unique human monocyte-macrophage receptor." Gianturco S.H., Ramprasad M.P., Song R., Li R., Brown M.L., Bradley W.A. Arterioscler. Thromb. Vasc. Biol. 18:968-976(1998) [PubMed: 9633939] [Abstract] Cited for: FUNCTION. |
| [7] | "PPAR(alpha) and PPAR(gamma) activators suppress the monocyte-macrophage apoB-48 receptor." Haraguchi G., Kobayashi Y., Brown M.L., Tanaka A., Isobe M., Gianturco S.H., Bradley W.A. J. Lipid Res. 44:1224-1231(2003) [PubMed: 12700342] [Abstract] Cited for: INDUCTION. |
| [8] | "Pitavastatin inhibits remnant lipoprotein-induced macrophage foam cell formation through ApoB48 receptor-dependent mechanism." Kawakami A., Tani M., Chiba T., Yui K., Shinozaki S., Nakajima K., Tanaka A., Shimokado K., Yoshida M. Arterioscler. Thromb. Vasc. Biol. 25:424-429(2005) [PubMed: 15591219] [Abstract] Cited for: FUNCTION, INDUCTION. |
| [9] | "Association of nucleotide variations in the apolipoprotein B48 receptor gene (APOB48R) with hypercholesterolemia." Fujita Y., Ezura Y., Bujo H., Nakajima T., Takahashi K., Kamimura K., Iino Y., Katayama Y., Saito Y., Emi M. J. Hum. Genet. 50:203-209(2005) [PubMed: 15830122] [Abstract] Cited for: VARIANT PRO-419. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF141332 mRNA. Translation: AAF76255.1. AF141333 Genomic DNA. Translation: AAF76256.1. BC119786 mRNA. Translation: AAI19787.1. BC119788 mRNA. Translation: AAI19789.1. AK075085 mRNA. No translation available. |
| IPI | IPI00399183. IPI00889551. IPI00889754. |
| UniGene | Hs.200333. |
3D structure databases | |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q0VD83. 2 interactions. |
| STRING | Q0VD83. |
PTM databases | |
| PhosphoSite | Q0VD83. |
Polymorphism databases | |
| DMDM | 121940470. |
Proteomic databases | |
| PRIDE | Q0VD83. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000431282; ENSP00000416094; ENSG00000184730. |
| UCSC | uc002dqb.1. human. |
Organism-specific databases | |
| GeneCards | GC16P028506. |
| HGNC | HGNC:24087. APOBR. |
| HPA | HPA041667. HPA042093. |
| MIM | 605220. gene. |
| neXtProt | NX_Q0VD83. |
| GenAtlas | Search... |
Phylogenomic databases | |
| HOGENOM | HBG281647. |
| HOVERGEN | HBG073497. |
| InParanoid | Q0VD83. |
Gene expression databases | |
| ArrayExpress | Q0VD83. |
| Bgee | Q0VD83. |
| Genevestigator | Q0VD83. |
Family and domain databases | |
| ProtoNet | Search... |
Other | |
| NextBio | 61302. |
| SOURCE | Search... |
Entry information
| Entry name | APOBR_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q0VD83 Secondary accession number(s): Q0VD81, Q8NC15, Q9NPJ9 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 16 Human chromosome 16: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |

Clusters with