Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein ABHD18

Gene

ABHD18

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

Protein family/group databases

ESTHERihuman-ABHD18 ABHD18

Names & Taxonomyi

Protein namesi
Recommended name:
Protein ABHD18Curated
Alternative name(s):
Alpha/beta hydrolase domain-containing protein 18Curated
Short name:
Abhydrolase domain-containing protein 18Imported
Gene namesi
Name:ABHD18Imported
Synonyms:C4orf29
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 4

Organism-specific databases

EuPathDBiHostDB:ENSG00000164074.14
HGNCiHGNC:26111 ABHD18
neXtProtiNX_Q0P651

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Secreted

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000164074
PharmGKBiPA147358673

Polymorphism and mutation databases

BioMutaiC4orf29
DMDMi121940364

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 24Sequence analysisAdd BLAST24
ChainiPRO_000030196025 – 414Protein ABHD18Add BLAST390

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi282N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi307N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Glycoprotein

Proteomic databases

EPDiQ0P651
MaxQBiQ0P651
PaxDbiQ0P651
PeptideAtlasiQ0P651
PRIDEiQ0P651

PTM databases

iPTMnetiQ0P651
PhosphoSitePlusiQ0P651

Expressioni

Gene expression databases

BgeeiENSG00000164074
CleanExiHS_C4orf29
ExpressionAtlasiQ0P651 baseline and differential
GenevisibleiQ0P651 HS

Organism-specific databases

HPAiHPA050168
HPA051676

Interactioni

Protein-protein interaction databases

BioGridi123153, 16 interactors

Structurei

3D structure databases

ProteinModelPortaliQ0P651
SMRiQ0P651
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the AB hydrolase superfamily.Curated

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiKOG1551 Eukaryota
ENOG410XW3S LUCA
GeneTreeiENSGT00390000014635
HOGENOMiHOG000006608
HOVERGENiHBG057792
InParanoidiQ0P651
OMAiYRRMLIT
OrthoDBiEOG091G0AQA
PhylomeDBiQ0P651
TreeFamiTF314683

Family and domain databases

InterProiView protein in InterPro
IPR029058 AB_hydrolase
IPR019149 ABHD18
PfamiView protein in Pfam
PF09752 DUF2048, 1 hit
SUPFAMiSSF53474 SSF53474, 2 hits

Sequences (4)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q0P651-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGVSKLDILY RRLLLTKLFI RGWGRPEDLK RLFEFRKMIG NRERCQNLVS
60 70 80 90 100
SDYPVHIDKI EEQSDCKILD GHFVSPMAHY VPDIMPIESV IARFQFIVPK
110 120 130 140 150
EWNSKYRPVC IHLAGTGDHH YWRRRTLMAR PMIKEARMAS LLLENPYYGC
160 170 180 190 200
RKPKDQVRSS LKNVSDLFVM GGALVLESAA LLHWLEREGY GPLGMTGISM
210 220 230 240 250
GGHMASLAVS NWPKPMPLIP CLSWSTASGV FTTTDSFKMG QEFVKHFTSS
260 270 280 290 300
ADKLTNLNLV SRTLNLDISN QVVSQKPADC HNSSKTSVSA TSEGLLLQDT
310 320 330 340 350
SKMKRFNQTL STNKSGYTSR NPQSYHLLSK EQSRNSLRKE SLIFMKGVMD
360 370 380 390 400
ECTHVANFSV PVDPSLIIVV QAKEDAYIPR TGVRSLQEIW PGCEIRYLEG
410
GHISAYLFKQ GLFR
Length:414
Mass (Da):46,954
Last modified:September 19, 2006 - v1
Checksum:iD62F491F23A02D4C
GO
Isoform 2 (identifier: Q0P651-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-94: MGVSKLDILY...MPIESVIARF → MLDTNLILLPLF

Note: No experimental confirmation available.
Show »
Length:332
Mass (Da):37,264
Checksum:iBE0B8B5674CA986D
GO
Isoform 3 (identifier: Q0P651-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-127: Missing.
     233-233: T → TGVLSKSINWRELEKQYYTQTVYEEEIIHMLEYCG

Note: No experimental confirmation available.
Show »
Length:321
Mass (Da):35,967
Checksum:iFDF2F2F8A898BB16
GO
Isoform 4 (identifier: Q0P651-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-203: Missing.
     233-233: T → TGVLSKSINWRELEKQYYTQTVYEEEIIHMLEYCG

Note: No experimental confirmation available.Curated
Show »
Length:245
Mass (Da):27,634
Checksum:i01068D36CD198D4F
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Isoform 4 (identifier: Q0P651-4)
Sequence conflicti36S → P in BAB14990 (PubMed:14702039).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0278911 – 203Missing in isoform 4. 1 PublicationAdd BLAST203
Alternative sequenceiVSP_0278921 – 127Missing in isoform 3. 1 PublicationAdd BLAST127
Alternative sequenceiVSP_0278931 – 94MGVSK…VIARF → MLDTNLILLPLF in isoform 2. 1 PublicationAdd BLAST94
Alternative sequenceiVSP_027894233T → TGVLSKSINWRELEKQYYTQ TVYEEEIIHMLEYCG in isoform 3 and isoform 4. 2 Publications1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK024759 mRNA Translation: BAB14990.1
BC034253 mRNA Translation: AAH34253.1
BC128142 mRNA Translation: AAI28143.1
BC128143 mRNA Translation: AAI28144.1
UniGeneiHs.143995
Hs.445817

Genome annotation databases

EnsembliENST00000398965; ENSP00000381937; ENSG00000164074 [Q0P651-1]
ENST00000444616; ENSP00000397229; ENSG00000164074 [Q0P651-1]
ENST00000611882; ENSP00000480015; ENSG00000164074 [Q0P651-3]
UCSCiuc021xrt.2 human [Q0P651-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiABD18_HUMAN
AccessioniPrimary (citable) accession number: Q0P651
Secondary accession number(s): A1A4W8, A1A4W9, Q9H7A7
Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 11, 2007
Last sequence update: September 19, 2006
Last modified: March 28, 2018
This is version 95 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health