Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Kinase non-catalytic C-lobe domain-containing protein 1

Gene

Kndc1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

RAS-Guanine nucleotide exchange factor (GEF) that controls the negative regulation of neuronal dendrite growth by mediating a signaling pathway linking RAS and MAP2 (PubMed:17984326, PubMed:21385318). May be involved in cellular senescence (By similarity).By similarity2 Publications

GO - Molecular functioni

  • Ras guanyl-nucleotide exchange factor activity Source: MGI

GO - Biological processi

  • cerebellar granule cell differentiation Source: MGI
  • positive regulation of protein phosphorylation Source: MGI
  • regulation of dendrite development Source: MGI
  • regulation of dendrite morphogenesis Source: MGI
  • small GTPase mediated signal transduction Source: InterPro

Keywordsi

Molecular functionGuanine-nucleotide releasing factor

Names & Taxonomyi

Protein namesi
Recommended name:
Kinase non-catalytic C-lobe domain-containing protein 1Imported
Short name:
KIND domain-containing protein 1Curated
Alternative name(s):
Protein very KIND1 Publication
Short name:
v-KIND1 Publication
Ras-GEF domain-containing family member 2Curated
Gene namesi
Name:Kndc1Imported
Synonyms:Kiaa1768, Rasgef2, Vkind1 Publication
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 7

Organism-specific databases

MGIiMGI:1923734 Kndc1

Subcellular locationi

Keywords - Cellular componenti

Cell projection

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi461L → A: Abolishes interaction with MAP2. 1 Publication1
Mutagenesisi474L → A: Abolishes interaction with MAP2. 1 Publication1
Mutagenesisi477L → A: Abolishes interaction with MAP2. 1 Publication1
Mutagenesisi482L → A: No effect on interaction with MAP2. 1 Publication1
Mutagenesisi485L → A: No effect on interaction with MAP2. 1 Publication1

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003071421 – 1742Kinase non-catalytic C-lobe domain-containing protein 1Add BLAST1742

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei267PhosphoserineCombined sources1
Modified residuei951PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ0KK55
PaxDbiQ0KK55
PeptideAtlasiQ0KK55
PRIDEiQ0KK55

PTM databases

iPTMnetiQ0KK55
PhosphoSitePlusiQ0KK55

Expressioni

Tissue specificityi

Highly expressed in the brain and at low levels in the ovary. In the brain it is most prominently expressed in the cerebellum where it is restricted to the granular Purkinje cell layer.2 Publications

Developmental stagei

At E14.5, highly expressed in the mid- and hindbrain and only weakly in the forebrain, but during development the main expression shifts towards the telencephalon as seen at E17.5 (PubMed:16099729). In cerebellum expression is highly up-regulated between postnatal days P7 and P12. At P7, low expression levels throughout the brain, but high in hippocampus, thalamus and the cerebellar white matter (PubMed:17984326).2 Publications

Gene expression databases

BgeeiENSMUSG00000066129
ExpressionAtlasiQ0KK55 baseline and differential
GenevisibleiQ0KK55 MM

Interactioni

Subunit structurei

Interacts (via KIND2) with MAP2; the interaction enhances MAP2 phosphorylation and localizes KNDC1 to dendrites.1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
Map2P203579EBI-8605532,EBI-397863

GO - Molecular functioni

  • Ras guanyl-nucleotide exchange factor activity Source: MGI

Protein-protein interaction databases

BioGridi218148, 3 interactors
IntActiQ0KK55, 1 interactor
MINTiQ0KK55
STRINGi10090.ENSMUSP00000050586

Structurei

3D structure databases

ProteinModelPortaliQ0KK55
SMRiQ0KK55
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini37 – 217KIND 1PROSITE-ProRule annotationAdd BLAST181
Domaini456 – 620KIND 2PROSITE-ProRule annotationAdd BLAST165
Domaini1239 – 1367N-terminal Ras-GEFPROSITE-ProRule annotationAdd BLAST129
Domaini1461 – 1712Ras-GEFPROSITE-ProRule annotationAdd BLAST252

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili1112 – 1177Sequence analysisAdd BLAST66

Keywords - Domaini

Coiled coil, Repeat

Phylogenomic databases

eggNOGiENOG410II5U Eukaryota
ENOG410XQ1A LUCA
GeneTreeiENSGT00390000011408
HOVERGENiHBG108658
InParanoidiQ0KK55
OMAiTSGNVCF
OrthoDBiEOG091G06SI
PhylomeDBiQ0KK55
TreeFamiTF336009

Family and domain databases

CDDicd06224 REM, 1 hit
Gene3Di1.10.840.10, 1 hit
InterProiView protein in InterPro
IPR011009 Kinase-like_dom_sf
IPR011019 KIND_dom
IPR029899 KNDC1
IPR000651 Ras-like_Gua-exchang_fac_N
IPR023578 Ras_GEF_dom_sf
IPR001895 RASGEF_cat_dom
IPR036964 RASGEF_cat_dom_sf
PANTHERiPTHR21560 PTHR21560, 1 hit
PfamiView protein in Pfam
PF16474 KIND, 1 hit
PF00617 RasGEF, 1 hit
PF00618 RasGEF_N, 1 hit
SMARTiView protein in SMART
SM00750 KIND, 2 hits
SM00147 RasGEF, 1 hit
SUPFAMiSSF48366 SSF48366, 3 hits
SSF56112 SSF56112, 1 hit
PROSITEiView protein in PROSITE
PS51377 KIND, 2 hits
PS50009 RASGEF_CAT, 1 hit
PS50212 RASGEF_NTER, 1 hit

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q0KK55-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MQAMDPASRG FYEEDGKDLD FYDFEPLPTL PEDEENVSLA DILSLRDRGL
60 70 80 90 100
SEQEAWAVCL ECSLSMRSVA HAAIFQTLCI TPDTLAFNTS GNVCFMEQLS
110 120 130 140 150
DDPEGAFVPP EFDLTGNTFE AHIYSLGATL KAALEYVPEP ELEPKLSTDL
160 170 180 190 200
EGLLSQMQAE DPRERPDLAS IIALCEEKMQ PVSSCRLCRS LSAIGRRVLS
210 220 230 240 250
IESFGAFQEL SENTWRGRPA PRNVGPKKMP GDLSTDPEAL FPSKGLLQPP
260 270 280 290 300
ASRDAEQEAG QRPRAPSPKP LLSAPVRNGE NPGQEGLADL VLDARCPLGE
310 320 330 340 350
LDRDNLRRSR LKKAQTFPRL LQESTETSTL CLSLNGSRNQ LAISEFFPPD
360 370 380 390 400
PRKLFLEGKN GLSGFKTQSK SRLWPEQEPG VQLDKTPGAG RNPHRSPGAS
410 420 430 440 450
GQLEASSPSQ GSVEYKPSPS PVDAGDSDHE GHIPRSEEKI PEESRQPGST
460 470 480 490 500
ATEQSLSLKD LLSKLGRPFR EYELWALCLS CLSTLQTHKE HPAHLCLDNV
510 520 530 540 550
LVAEDGTVFF GPPPANGAYN SLFLAPEVSE EKLVTEKASV YCVAAVLWTA
560 570 580 590 600
AKFSVPRDHK LALPRRLKTL LLDMARRHAS ERPSAAEAIK VCSSYLLQRG
610 620 630 640 650
MDSSKILAHL RASTCKVHPE EETIGLQNAF SVVELKSTTA PAPESSPGFL
660 670 680 690 700
QVSNDTKLVA VPGPVPGLPP CCKEACELPA AFTSEATHFK PIVLAQDASV
710 720 730 740 750
TRDQLALPSE SNEKPKEGSG HLDREGTRKQ AALELVEATD LKMSNQLSPG
760 770 780 790 800
PELQGATPDP DGDSGSPSSA TECSCPHGPA LVTQQKGTSG TPSSPASSLP
810 820 830 840 850
PEHRPDGEGP LGTTVLPGPT SASQGSRHPC KPPRGKAAAS PSSPRGSDGH
860 870 880 890 900
PEKPRPADRK LCPSSVDTSS PPKMTACPSL QEAMRLIQEE FAFDGYMDNG
910 920 930 940 950
LEALIMGEYI YALKDLTFAT FCGAISEKFC DLYWDEQLLK NLFKVVNGPA
960 970 980 990 1000
SPSESTSEEP GSQPEHSPSR CSLSSKRPSL HGLGKEKPAT TWGSGGPCSP
1010 1020 1030 1040 1050
TALSDIDSDT LSQGNFEVGF RSQKSIKVTR EQQPEAEVGG QPGPSQDSTS
1060 1070 1080 1090 1100
HASDTVARLA RSEDGGPAGS PGASDFQNCS PGWSSAFYEA DCFGADVYNY
1110 1120 1130 1140 1150
VKDLERQKTN GHTELEAQSP ELEQQLMIEK RNYRKTLKFY QKLLQKEKRN
1160 1170 1180 1190 1200
KGSEVRTMLS KLRGQLDEMK SKVQFLSLVK KYLQVMYAER WGLEPCALPV
1210 1220 1230 1240 1250
IVNIAAAPCD TLDFSPLDES SSLIFYNVNK HPGSGRQKKA RILQAGTPLG
1260 1270 1280 1290 1300
LMAYLYSSDA FLEGYVQQFL YTFRYFCTPH DFLHFLLDRI SSTLSRAHQD
1310 1320 1330 1340 1350
PTSTFTKIYR RSLCVLQAWV EDCYTVDFIR NAGLLGQLED FISSKILPLD
1360 1370 1380 1390 1400
GTAEHLLALL EVGTERRADS ASRGADLEDP KEAEEDTRPF NALCKRFSED
1410 1420 1430 1440 1450
GITRKSFSWR LPRGNGLVLP HHKERQYTIA SALPKPCFFE DFYGPYAKAS
1460 1470 1480 1490 1500
EKGPYFLTEY STNQLFTQLT LLQQELFQKC HPVHFLNSRA LGVMDKSAAI
1510 1520 1530 1540 1550
PKASSSESLS AKTCSLFLPN YVQDKYLLQL LRNADDVSTW VAAEIVTSHT
1560 1570 1580 1590 1600
SKLQVNLLSK FLLIAKSCYE QRNFATAMQI LGGLEHLAVR QSPAWRILPA
1610 1620 1630 1640 1650
KIAEVMEELK AVEVFLKSDS LCLMEGRRFR AQPTLPSAHL LAMHIQQLET
1660 1670 1680 1690 1700
GGFTMTNGAH RWSKLRNIAK VASQVHAFQE NPYTFSPDPK LQAHLKQRIA
1710 1720 1730 1740
RFSGADVSIL AADNRANFHQ IPGEKHSRKI QDKLRRMKAT FQ
Length:1,742
Mass (Da):191,313
Last modified:October 23, 2007 - v2
Checksum:i2C54217F515FA984
GO
Isoform 2 (identifier: Q0KK55-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     538-572: ASVYCVAAVLWTAAKFSVPRDHKLALPRRLKTLLL → VTSHITSLAPSSPSAQWIAGPDGLNVAPILLAGLL
     573-1742: Missing.

Show »
Length:572
Mass (Da):62,270
Checksum:i66ACFDB2890AAFA1
GO
Isoform 3 (identifier: Q0KK55-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1126: Missing.

Show »
Length:616
Mass (Da):70,144
Checksum:i63C5E20CEA1B89CD
GO

Sequence cautioni

The sequence BAC41157 differs from that shown. Reason: Frameshift at position 296.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti20D → G in CAE30489 (PubMed:16099729).Curated1
Sequence conflicti154L → V in BAC41157 (PubMed:16141072).Curated1
Sequence conflicti253R → E in BAF03200 (PubMed:16807365).Curated1
Sequence conflicti289D → G in BAF03200 (PubMed:16807365).Curated1
Sequence conflicti310R → Q in BAF03205 (PubMed:16807365).Curated1
Sequence conflicti427S → L in BAF03200 (PubMed:16807365).Curated1
Sequence conflicti431G → C in BAE27853 (PubMed:16141072).Curated1
Sequence conflicti440I → T in BAE28078 (PubMed:16141072).Curated1
Sequence conflicti780A → V in BAF03200 (PubMed:16807365).Curated1
Sequence conflicti812G → D in BAF03200 (PubMed:16807365).Curated1
Sequence conflicti836K → R in CAE30489 (PubMed:16099729).Curated1
Sequence conflicti845R → G in BAE28064 (PubMed:16141072).Curated1
Sequence conflicti957S → N in CAE30489 (PubMed:16099729).Curated1
Sequence conflicti1109T → A in CAE30489 (PubMed:16099729).Curated1
Sequence conflicti1109T → A in BAF03200 (PubMed:16807365).Curated1
Sequence conflicti1209C → F in CAE30489 (PubMed:16099729).Curated1
Sequence conflicti1306T → A in CAE30489 (PubMed:16099729).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0285991 – 1126Missing in isoform 3. 1 PublicationAdd BLAST1126
Alternative sequenceiVSP_028600538 – 572ASVYC…KTLLL → VTSHITSLAPSSPSAQWIAG PDGLNVAPILLAGLL in isoform 2. 1 PublicationAdd BLAST35
Alternative sequenceiVSP_028601573 – 1742Missing in isoform 2. 1 PublicationAdd BLAST1170

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ580324 mRNA Translation: CAE30489.2
AB257857 mRNA Translation: BAF03200.1
AB257862 Genomic DNA Translation: BAF03205.1
AK046817 mRNA Translation: BAC32882.1
AK090282 mRNA Translation: BAC41157.1 Frameshift.
AK147335 mRNA Translation: BAE27853.1
AK147672 mRNA Translation: BAE28064.1
AK147693 mRNA Translation: BAE28078.1
AK169316 mRNA Translation: BAE41071.1
RefSeqiNP_796235.4, NM_177261.4 [Q0KK55-1]
UniGeneiMm.44442

Genome annotation databases

EnsembliENSMUST00000053445; ENSMUSP00000050586; ENSMUSG00000066129 [Q0KK55-1]
GeneIDi76484
KEGGimmu:76484
UCSCiuc009kgd.1 mouse [Q0KK55-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiKNDC1_MOUSE
AccessioniPrimary (citable) accession number: Q0KK55
Secondary accession number(s): Q0KK50
, Q3TF27, Q3UGX9, Q3UGZ3, Q3UHK4, Q7TNH0, Q8BTH5, Q8BXJ3
Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 23, 2007
Last sequence update: October 23, 2007
Last modified: March 28, 2018
This is version 89 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Cookie policy

We would like to use anonymized google analytics cookies to gather statistics on how uniprot.org is used in aggregate. Learn more

UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health