Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein very KIND

Gene

Kndc1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Probable guanine nucleotide exchange factor (GEF).

GO - Molecular functioni

  • Ras guanyl-nucleotide exchange factor activity Source: MGI

GO - Biological processi

  • cerebellar granule cell differentiation Source: MGI
  • positive regulation of GTPase activity Source: GOC
  • positive regulation of protein phosphorylation Source: MGI
  • regulation of dendrite development Source: MGI
  • regulation of dendrite morphogenesis Source: MGI
  • small GTPase mediated signal transduction Source: InterPro
Complete GO annotation...

Keywords - Molecular functioni

Guanine-nucleotide releasing factor

Names & Taxonomyi

Protein namesi
Recommended name:
Protein very KIND
Alternative name(s):
KIND domain-containing protein 1
Kinase non-catalytic C-lobe domain-containing protein 1
Ras-GEF domain-containing family member 2
Gene namesi
Name:Kndc1
Synonyms:Kiaa1768, Rasgef2, Vkind
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 7

Organism-specific databases

MGIiMGI:1923734. Kndc1.

Subcellular locationi

GO - Cellular componenti

  • dendrite Source: MGI
  • guanyl-nucleotide exchange factor complex Source: MGI
  • neuronal cell body Source: MGI
Complete GO annotation...

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 17421742Protein very KINDPRO_0000307142Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei267 – 2671PhosphoserineCombined sources
Modified residuei951 – 9511PhosphoserineCombined sources

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ0KK55.
PaxDbiQ0KK55.
PRIDEiQ0KK55.

PTM databases

iPTMnetiQ0KK55.
PhosphoSiteiQ0KK55.

Expressioni

Tissue specificityi

Highly expressed in the brain and at low levels in the ovary. In the brain it is most prominently expressed in the cerebellum where it is restricted to the granular Purkinje cell layer.1 Publication

Developmental stagei

At E14.5, highly expressed in the mid- and hindbrain and only weakly in the forebrain, but during development the main expression shifts towards the telencephalon as seen at E17.5.1 Publication

Gene expression databases

BgeeiQ0KK55.
ExpressionAtlasiQ0KK55. baseline and differential.
GenevisibleiQ0KK55. MM.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
Map2P203579EBI-8605532,EBI-397863

Protein-protein interaction databases

BioGridi218148. 3 interactions.
IntActiQ0KK55. 1 interaction.
MINTiMINT-8142436.
STRINGi10090.ENSMUSP00000050586.

Structurei

3D structure databases

ProteinModelPortaliQ0KK55.
SMRiQ0KK55. Positions 1501-1696.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini37 – 217181KIND 1PROSITE-ProRule annotationAdd
BLAST
Domaini456 – 620165KIND 2PROSITE-ProRule annotationAdd
BLAST
Domaini1239 – 1367129N-terminal Ras-GEFPROSITE-ProRule annotationAdd
BLAST
Domaini1461 – 1712252Ras-GEFPROSITE-ProRule annotationAdd
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili1112 – 117766Sequence analysisAdd
BLAST

Sequence similaritiesi

Contains 2 KIND domains.PROSITE-ProRule annotation
Contains 1 N-terminal Ras-GEF domain.PROSITE-ProRule annotation
Contains 1 Ras-GEF domain.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil, Repeat

Phylogenomic databases

eggNOGiENOG410II5U. Eukaryota.
ENOG410XQ1A. LUCA.
GeneTreeiENSGT00390000011408.
HOVERGENiHBG108658.
InParanoidiQ0KK55.
OMAiMQAEDPR.
PhylomeDBiQ0KK55.
TreeFamiTF336009.

Family and domain databases

Gene3Di1.10.840.10. 1 hit.
InterProiIPR011009. Kinase-like_dom.
IPR011019. KIND_dom.
IPR029899. KNDC1.
IPR000651. Ras-like_Gua-exchang_fac_N.
IPR023578. Ras_GEF_dom.
IPR001895. RASGEF_cat_dom.
[Graphical view]
PANTHERiPTHR21560:SF0. PTHR21560:SF0. 1 hit.
PfamiPF16474. KIND. 1 hit.
PF00617. RasGEF. 1 hit.
PF00618. RasGEF_N. 1 hit.
[Graphical view]
SMARTiSM00750. KIND. 2 hits.
SM00147. RasGEF. 1 hit.
[Graphical view]
SUPFAMiSSF48366. SSF48366. 3 hits.
SSF56112. SSF56112. 1 hit.
PROSITEiPS51377. KIND. 2 hits.
PS50009. RASGEF_CAT. 1 hit.
PS50212. RASGEF_NTER. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q0KK55-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MQAMDPASRG FYEEDGKDLD FYDFEPLPTL PEDEENVSLA DILSLRDRGL
60 70 80 90 100
SEQEAWAVCL ECSLSMRSVA HAAIFQTLCI TPDTLAFNTS GNVCFMEQLS
110 120 130 140 150
DDPEGAFVPP EFDLTGNTFE AHIYSLGATL KAALEYVPEP ELEPKLSTDL
160 170 180 190 200
EGLLSQMQAE DPRERPDLAS IIALCEEKMQ PVSSCRLCRS LSAIGRRVLS
210 220 230 240 250
IESFGAFQEL SENTWRGRPA PRNVGPKKMP GDLSTDPEAL FPSKGLLQPP
260 270 280 290 300
ASRDAEQEAG QRPRAPSPKP LLSAPVRNGE NPGQEGLADL VLDARCPLGE
310 320 330 340 350
LDRDNLRRSR LKKAQTFPRL LQESTETSTL CLSLNGSRNQ LAISEFFPPD
360 370 380 390 400
PRKLFLEGKN GLSGFKTQSK SRLWPEQEPG VQLDKTPGAG RNPHRSPGAS
410 420 430 440 450
GQLEASSPSQ GSVEYKPSPS PVDAGDSDHE GHIPRSEEKI PEESRQPGST
460 470 480 490 500
ATEQSLSLKD LLSKLGRPFR EYELWALCLS CLSTLQTHKE HPAHLCLDNV
510 520 530 540 550
LVAEDGTVFF GPPPANGAYN SLFLAPEVSE EKLVTEKASV YCVAAVLWTA
560 570 580 590 600
AKFSVPRDHK LALPRRLKTL LLDMARRHAS ERPSAAEAIK VCSSYLLQRG
610 620 630 640 650
MDSSKILAHL RASTCKVHPE EETIGLQNAF SVVELKSTTA PAPESSPGFL
660 670 680 690 700
QVSNDTKLVA VPGPVPGLPP CCKEACELPA AFTSEATHFK PIVLAQDASV
710 720 730 740 750
TRDQLALPSE SNEKPKEGSG HLDREGTRKQ AALELVEATD LKMSNQLSPG
760 770 780 790 800
PELQGATPDP DGDSGSPSSA TECSCPHGPA LVTQQKGTSG TPSSPASSLP
810 820 830 840 850
PEHRPDGEGP LGTTVLPGPT SASQGSRHPC KPPRGKAAAS PSSPRGSDGH
860 870 880 890 900
PEKPRPADRK LCPSSVDTSS PPKMTACPSL QEAMRLIQEE FAFDGYMDNG
910 920 930 940 950
LEALIMGEYI YALKDLTFAT FCGAISEKFC DLYWDEQLLK NLFKVVNGPA
960 970 980 990 1000
SPSESTSEEP GSQPEHSPSR CSLSSKRPSL HGLGKEKPAT TWGSGGPCSP
1010 1020 1030 1040 1050
TALSDIDSDT LSQGNFEVGF RSQKSIKVTR EQQPEAEVGG QPGPSQDSTS
1060 1070 1080 1090 1100
HASDTVARLA RSEDGGPAGS PGASDFQNCS PGWSSAFYEA DCFGADVYNY
1110 1120 1130 1140 1150
VKDLERQKTN GHTELEAQSP ELEQQLMIEK RNYRKTLKFY QKLLQKEKRN
1160 1170 1180 1190 1200
KGSEVRTMLS KLRGQLDEMK SKVQFLSLVK KYLQVMYAER WGLEPCALPV
1210 1220 1230 1240 1250
IVNIAAAPCD TLDFSPLDES SSLIFYNVNK HPGSGRQKKA RILQAGTPLG
1260 1270 1280 1290 1300
LMAYLYSSDA FLEGYVQQFL YTFRYFCTPH DFLHFLLDRI SSTLSRAHQD
1310 1320 1330 1340 1350
PTSTFTKIYR RSLCVLQAWV EDCYTVDFIR NAGLLGQLED FISSKILPLD
1360 1370 1380 1390 1400
GTAEHLLALL EVGTERRADS ASRGADLEDP KEAEEDTRPF NALCKRFSED
1410 1420 1430 1440 1450
GITRKSFSWR LPRGNGLVLP HHKERQYTIA SALPKPCFFE DFYGPYAKAS
1460 1470 1480 1490 1500
EKGPYFLTEY STNQLFTQLT LLQQELFQKC HPVHFLNSRA LGVMDKSAAI
1510 1520 1530 1540 1550
PKASSSESLS AKTCSLFLPN YVQDKYLLQL LRNADDVSTW VAAEIVTSHT
1560 1570 1580 1590 1600
SKLQVNLLSK FLLIAKSCYE QRNFATAMQI LGGLEHLAVR QSPAWRILPA
1610 1620 1630 1640 1650
KIAEVMEELK AVEVFLKSDS LCLMEGRRFR AQPTLPSAHL LAMHIQQLET
1660 1670 1680 1690 1700
GGFTMTNGAH RWSKLRNIAK VASQVHAFQE NPYTFSPDPK LQAHLKQRIA
1710 1720 1730 1740
RFSGADVSIL AADNRANFHQ IPGEKHSRKI QDKLRRMKAT FQ
Length:1,742
Mass (Da):191,313
Last modified:October 23, 2007 - v2
Checksum:i2C54217F515FA984
GO
Isoform 2 (identifier: Q0KK55-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     538-572: ASVYCVAAVLWTAAKFSVPRDHKLALPRRLKTLLL → VTSHITSLAPSSPSAQWIAGPDGLNVAPILLAGLL
     573-1742: Missing.

Show »
Length:572
Mass (Da):62,270
Checksum:i66ACFDB2890AAFA1
GO
Isoform 3 (identifier: Q0KK55-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1126: Missing.

Show »
Length:616
Mass (Da):70,144
Checksum:i63C5E20CEA1B89CD
GO

Sequence cautioni

The sequence BAC41157.1 differs from that shown. Reason: Frameshift at position 296. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti20 – 201D → G in CAE30489 (PubMed:16099729).Curated
Sequence conflicti154 – 1541L → V in BAC41157 (PubMed:16141072).Curated
Sequence conflicti253 – 2531R → E in BAF03200 (PubMed:16807365).Curated
Sequence conflicti289 – 2891D → G in BAF03200 (PubMed:16807365).Curated
Sequence conflicti310 – 3101R → Q in BAF03205 (PubMed:16807365).Curated
Sequence conflicti427 – 4271S → L in BAF03200 (PubMed:16807365).Curated
Sequence conflicti431 – 4311G → C in BAE27853 (PubMed:16141072).Curated
Sequence conflicti440 – 4401I → T in BAE28078 (PubMed:16141072).Curated
Sequence conflicti780 – 7801A → V in BAF03200 (PubMed:16807365).Curated
Sequence conflicti812 – 8121G → D in BAF03200 (PubMed:16807365).Curated
Sequence conflicti836 – 8361K → R in CAE30489 (PubMed:16099729).Curated
Sequence conflicti845 – 8451R → G in BAE28064 (PubMed:16141072).Curated
Sequence conflicti957 – 9571S → N in CAE30489 (PubMed:16099729).Curated
Sequence conflicti1109 – 11091T → A in CAE30489 (PubMed:16099729).Curated
Sequence conflicti1109 – 11091T → A in BAF03200 (PubMed:16807365).Curated
Sequence conflicti1209 – 12091C → F in CAE30489 (PubMed:16099729).Curated
Sequence conflicti1306 – 13061T → A in CAE30489 (PubMed:16099729).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 11261126Missing in isoform 3. 1 PublicationVSP_028599Add
BLAST
Alternative sequencei538 – 57235ASVYC…KTLLL → VTSHITSLAPSSPSAQWIAG PDGLNVAPILLAGLL in isoform 2. 1 PublicationVSP_028600Add
BLAST
Alternative sequencei573 – 17421170Missing in isoform 2. 1 PublicationVSP_028601Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ580324 mRNA. Translation: CAE30489.2.
AB257857 mRNA. Translation: BAF03200.1.
AB257862 Genomic DNA. Translation: BAF03205.1.
AK046817 mRNA. Translation: BAC32882.1.
AK090282 mRNA. Translation: BAC41157.1. Frameshift.
AK147335 mRNA. Translation: BAE27853.1.
AK147672 mRNA. Translation: BAE28064.1.
AK147693 mRNA. Translation: BAE28078.1.
AK169316 mRNA. Translation: BAE41071.1.
RefSeqiNP_796235.4. NM_177261.4. [Q0KK55-1]
UniGeneiMm.44442.

Genome annotation databases

EnsembliENSMUST00000053445; ENSMUSP00000050586; ENSMUSG00000066129. [Q0KK55-1]
GeneIDi76484.
KEGGimmu:76484.
UCSCiuc009kgd.1. mouse. [Q0KK55-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ580324 mRNA. Translation: CAE30489.2.
AB257857 mRNA. Translation: BAF03200.1.
AB257862 Genomic DNA. Translation: BAF03205.1.
AK046817 mRNA. Translation: BAC32882.1.
AK090282 mRNA. Translation: BAC41157.1. Frameshift.
AK147335 mRNA. Translation: BAE27853.1.
AK147672 mRNA. Translation: BAE28064.1.
AK147693 mRNA. Translation: BAE28078.1.
AK169316 mRNA. Translation: BAE41071.1.
RefSeqiNP_796235.4. NM_177261.4. [Q0KK55-1]
UniGeneiMm.44442.

3D structure databases

ProteinModelPortaliQ0KK55.
SMRiQ0KK55. Positions 1501-1696.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi218148. 3 interactions.
IntActiQ0KK55. 1 interaction.
MINTiMINT-8142436.
STRINGi10090.ENSMUSP00000050586.

PTM databases

iPTMnetiQ0KK55.
PhosphoSiteiQ0KK55.

Proteomic databases

MaxQBiQ0KK55.
PaxDbiQ0KK55.
PRIDEiQ0KK55.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000053445; ENSMUSP00000050586; ENSMUSG00000066129. [Q0KK55-1]
GeneIDi76484.
KEGGimmu:76484.
UCSCiuc009kgd.1. mouse. [Q0KK55-1]

Organism-specific databases

CTDi85442.
MGIiMGI:1923734. Kndc1.
RougeiSearch...

Phylogenomic databases

eggNOGiENOG410II5U. Eukaryota.
ENOG410XQ1A. LUCA.
GeneTreeiENSGT00390000011408.
HOVERGENiHBG108658.
InParanoidiQ0KK55.
OMAiMQAEDPR.
PhylomeDBiQ0KK55.
TreeFamiTF336009.

Miscellaneous databases

NextBioi345232.
PROiQ0KK55.
SOURCEiSearch...

Gene expression databases

BgeeiQ0KK55.
ExpressionAtlasiQ0KK55. baseline and differential.
GenevisibleiQ0KK55. MM.

Family and domain databases

Gene3Di1.10.840.10. 1 hit.
InterProiIPR011009. Kinase-like_dom.
IPR011019. KIND_dom.
IPR029899. KNDC1.
IPR000651. Ras-like_Gua-exchang_fac_N.
IPR023578. Ras_GEF_dom.
IPR001895. RASGEF_cat_dom.
[Graphical view]
PANTHERiPTHR21560:SF0. PTHR21560:SF0. 1 hit.
PfamiPF16474. KIND. 1 hit.
PF00617. RasGEF. 1 hit.
PF00618. RasGEF_N. 1 hit.
[Graphical view]
SMARTiSM00750. KIND. 2 hits.
SM00147. RasGEF. 1 hit.
[Graphical view]
SUPFAMiSSF48366. SSF48366. 3 hits.
SSF56112. SSF56112. 1 hit.
PROSITEiPS51377. KIND. 2 hits.
PS50009. RASGEF_CAT. 1 hit.
PS50212. RASGEF_NTER. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Very-KIND is a novel nervous system specific guanine nucleotide exchange factor for Ras GTPases."
    Mees A., Rock R., Ciccarelli F.D., Leberfinger C.B., Borawski J.M., Bork P., Wiese S., Gessler M., Kerkhoff E.
    Gene Expr. Patterns 6:79-85(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY, DEVELOPMENTAL STAGE.
    Strain: C57BL/6J.
    Tissue: Cerebellum.
  2. "A gene-targeting approach for functional characterization of KIAA genes encoding extremely large proteins."
    Nakayama M., Iida M., Koseki H., Ohara O.
    FASEB J. 20:1718-1720(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORM 1).
    Strain: BALB/cCrSlc.
    Tissue: Brain.
  3. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2 AND 3).
    Strain: C57BL/6J.
    Tissue: Brain, Cerebellum, Liver and Medulla oblongata.
  4. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-267 AND SER-951, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Brain.

Entry informationi

Entry nameiVKIND_MOUSE
AccessioniPrimary (citable) accession number: Q0KK55
Secondary accession number(s): Q0KK50
, Q3TF27, Q3UGX9, Q3UGZ3, Q3UHK4, Q7TNH0, Q8BTH5, Q8BXJ3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 23, 2007
Last sequence update: October 23, 2007
Last modified: May 11, 2016
This is version 75 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.