Q09M05 (CBPC4_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 57.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Cytosolic carboxypeptidase 4 EC=3.4.17.- Alternative name(s): ATP/GTP-binding protein-like 1 | ||||
| Gene names |
| ||||
| Organism | Mus musculus (Mouse) [Reference proteome] | ||||
| Taxonomic identifier | 10090 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus![]() |
Protein attributes
| Sequence length | 972 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Metallocarboxypeptidase that mediates deglutamylation of target proteins. Catalyzes the deglutamylation of polyglutamate side chains generated by post-translational polyglutamylation in proteins such as tubulins. Also removes gene-encoded polyglutamates from the carboxy-terminus of target proteins such as MYLK. Acts as a long-chain deglutamylase and specifically shortens long polyglutamate chains, while it is not able to remove the branching point glutamate, a process catalyzed by AGBL5/CCP5. Ref.2 |
| Cofactor | Binds 1 zinc ion per subunit By similarity. |
| Subunit structure | Interacts with MYLK. Ref.2 |
| Subcellular location | |
| Tissue specificity | Expressed at low level. Expressed in eye, muscle, pituitary, testis and to a lower extent in brain. Ref.1 Ref.2 |
| Sequence similarities | Belongs to the peptidase M14 family. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cytoplasm |
| Coding sequence diversity | Alternative splicing |
| Ligand | Metal-binding Zinc |
| Molecular function | Carboxypeptidase Hydrolase Metalloprotease Protease |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | C-terminal protein deglutamylation Inferred from direct assay Ref.2. Source: UniProtKB protein side chain deglutamylationInferred from direct assay Ref.2. Source: UniProtKB proteolysisInferred from electronic annotation. Source: UniProtKB-KW |
| Cellular_component | cytosol Inferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular_function | metallocarboxypeptidase activity Inferred from direct assay Ref.2. Source: UniProtKB tubulin bindingInferred from direct assay Ref.2. Source: UniProtKB zinc ion bindingInferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q09M05-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 2 (identifier: Q09M05-2) The sequence of this isoform differs from the canonical sequence as follows: 1-206: Missing. 850-857: FCDFHGHS → SHFLLFIL 858-972: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q09M05-3) The sequence of this isoform differs from the canonical sequence as follows: 1-206: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 4 (identifier: Q09M05-4) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MAEQEGSGLQMLLHTLQNSSDKASTLSILQVLGDLLSVGTDRRIYYM 952-972: VCEVYTARSLCSAADHKNRGK → GLQFGTGELE...GTGWRRRSVT |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 972 | 972 | Cytosolic carboxypeptidase 4 | PRO_0000305000 | |||||
Regions | |||||||||
| Compositional bias | 256 – 283 | 28 | Asp-rich | ||||||
Sites | |||||||||
| Active site | 807 | 1 | Nucleophile By similarity | ||||||
| Metal binding | 757 | 1 | Zinc Probable | ||||||
| Metal binding | 760 | 1 | Zinc Probable | ||||||
| Metal binding | 854 | 1 | Zinc By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 206 | 206 | Missing in isoform 2 and isoform 3. | VSP_028179 | |||||
| Alternative sequence | 1 | 1 | M → MAEQEGSGLQMLLHTLQNSS DKASTLSILQVLGDLLSVGT DRRIYYM in isoform 4. | VSP_040424 | |||||
| Alternative sequence | 850 – 857 | 8 | FCDFHGHS → SHFLLFIL in isoform 2. | VSP_028180 | |||||
| Alternative sequence | 858 – 972 | 115 | Missing in isoform 2. | VSP_028181 | |||||
| Alternative sequence | 952 – 972 | 21 | VCEVY…KNRGK → GLQFGTGELEEMGAMYCLGL LILELKSVNCSHKLLARASS LLNADVLEHYLQRCSSSSSN SSNRTSEVDDEPYCMEEIDY SADSSSDAEQNFTELDRQIQ ECALNKDEEEEEKEEGTGWR RRSVT in isoform 4. | VSP_040425 | |||||
Experimental info | |||||||||
| Mutagenesis | 757 | 1 | H → S: Abolishes deglutamylase activity; when associated with Q-760. Ref.2 | ||||||
| Mutagenesis | 760 | 1 | E → Q: Abolishes deglutamylase activity; when associated with S-757. Ref.2 | ||||||
| Sequence conflict | 130 – 133 | 4 | SKHL → KSNC in CAZ69802. Ref.2 | ||||||
| Sequence conflict | 197 | 1 | S → I in CAZ69802. Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | DQ867033 mRNA. Translation: ABI51952.1. FN429927 mRNA. Translation: CAZ69802.1. AK052433 mRNA. Translation: BAC34986.1. AC115830 Genomic DNA. No translation available. AC165265 Genomic DNA. No translation available. AC121812 Genomic DNA. No translation available. AC123792 Genomic DNA. No translation available. AC121971 Genomic DNA. No translation available. |
| IPI | IPI00226518. IPI00856787. IPI00857194. IPI00973603. |
| RefSeq | NP_001186153.1. NM_001199224.1. |
| UniGene | Mm.322829. |
3D structure databases | |
| ProteinModelPortal | Q09M05. |
| SMR | Q09M05. Positions 97-199, 547-869. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 10090.ENSMUSP00000103066. |
Protein family/group databases | |
| MEROPS | M14.030. |
PTM databases | |
| PhosphoSite | Q09M05. |
Proteomic databases | |
| PaxDb | Q09M05. |
| PRIDE | Q09M05. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSMUST00000026854; ENSMUSP00000026854; ENSMUSG00000025754. ENSMUST00000107442; ENSMUSP00000103066; ENSMUSG00000025754. |
| GeneID | 244071. |
| KEGG | mmu:244071. |
| UCSC | uc009hxb.1. mouse. uc009hxc.1. mouse. uc012fnc.1. mouse. |
Organism-specific databases | |
| CTD | 123624. |
| MGI | MGI:3646469. Agbl1. |
Phylogenomic databases | |
| eggNOG | COG2866. |
| GeneTree | ENSGT00550000074405. |
| HOGENOM | HOG000293310. |
| HOVERGEN | HBG107587. |
| InParanoid | Q09M05. |
| OrthoDB | EOG4JDH61. |
Gene expression databases | |
| ArrayExpress | Q09M05. |
| Bgee | Q09M05. |
| CleanEx | MM_AGBL1. |
| Genevestigator | Q09M05. |
Family and domain databases | |
| Gene3D | 1.25.10.10. 1 hit. |
| InterPro | IPR011989. ARM-like. IPR016024. ARM-type_fold. IPR000834. Peptidase_M14. [Graphical view] |
| Pfam | PF00246. Peptidase_M14. 1 hit. [Graphical view] |
| SUPFAM | SSF48371. ARM-type_fold. 1 hit. |
| PROSITE | PS00132. CARBOXYPEPT_ZN_1. False negative. PS00133. CARBOXYPEPT_ZN_2. False negative. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 386109. |
| SOURCE | Search... |
Entry information
| Entry name | CBPC4_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q09M05 Secondary accession number(s): Q8C768 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| Peptidase families Classification of peptidase families and list of entries |
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
