Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Cytosolic carboxypeptidase-like protein 5

Gene

Agbl5

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Metallocarboxypeptidase that mediates protein deglutamylation. Specifically catalyzes the deglutamylation of the branching point glutamate side chains generated by post-translational glutamylation in proteins such as tubulins (PubMed:20519502, PubMed:21074048). In contrast, it is not able to act as a long-chain deglutamylase that shortens long polyglutamate chains, a process catalyzed by AGTPBP1/CCP1, AGBL2/CCP2, AGBL3/CCP3, AGBL1/CCP4 and AGBL4/CCP6 (PubMed:25103237). Mediates deglutamylation of CGAS, regulating the antiviral activity of CGAS (PubMed:26829768).4 Publications

Cofactori

Zn2+By similarityNote: Binds 1 zinc ion per subunit.By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Metal bindingi252Zinc1 Publication1
Metal bindingi255Zinc1 Publication1
Active sitei303NucleophileBy similarity1
Metal bindingi434ZincBy similarity1

GO - Molecular functioni

  • metallocarboxypeptidase activity Source: UniProtKB
  • tubulin binding Source: UniProtKB
  • zinc ion binding Source: InterPro

GO - Biological processi

  • defense response to virus Source: UniProtKB
  • protein branching point deglutamylation Source: UniProtKB
  • protein deglutamylation Source: UniProtKB
  • protein side chain deglutamylation Source: Reactome

Keywordsi

Molecular functionCarboxypeptidase, Hydrolase, Metalloprotease, Protease
LigandMetal-binding, Zinc

Protein family/group databases

MEROPSiM14.036

Names & Taxonomyi

Protein namesi
Recommended name:
Cytosolic carboxypeptidase-like protein 5 (EC:3.4.17.-)
Alternative name(s):
ATP/GTP-binding protein-like 5
Gene namesi
Name:Agbl5
Synonyms:Ccp5
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 5

Organism-specific databases

MGIiMGI:2441745 Agbl5

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton, Nucleus

Pathology & Biotechi

Disruption phenotypei

Mice are more vulnerable to DNA virus infection due to impaired immune response.1 Publication

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi252H → S: Abolishes deglutamylase activity; when associated with Q-255. 2 Publications1
Mutagenesisi255E → Q: Abolishes deglutamylase activity; when associated with S-252. 2 Publications1

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003059221 – 886Cytosolic carboxypeptidase-like protein 5Add BLAST886

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei841PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ09M02
PRIDEiQ09M02

PTM databases

iPTMnetiQ09M02
PhosphoSitePlusiQ09M02

Expressioni

Tissue specificityi

Widely expressed. Highly expressed in testis, and moderately in pituitary, brain, eye and kidney.2 Publications

Gene expression databases

BgeeiENSMUSG00000029165
CleanExiMM_AGBL5
ExpressionAtlasiQ09M02 baseline and differential
GenevisibleiQ09M02 MM

Interactioni

GO - Molecular functioni

  • tubulin binding Source: UniProtKB

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000110348

Structurei

3D structure databases

ProteinModelPortaliQ09M02
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the peptidase M14 family.Curated

Phylogenomic databases

eggNOGiKOG3641 Eukaryota
COG2866 LUCA
GeneTreeiENSGT00550000074405
HOVERGENiHBG068187
InParanoidiQ09M02
OMAiDQRFPEN
OrthoDBiEOG091G03CV
TreeFamiTF324301

Family and domain databases

CDDicd06236 M14_AGBL5_like, 1 hit
InterProiView protein in InterPro
IPR034286 M14_AGBL5-like
IPR000834 Peptidase_M14
PfamiView protein in Pfam
PF00246 Peptidase_M14, 1 hit

Sequences (7)i

Sequence statusi: Complete.

This entry describes 7 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q09M02-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MELRCGGLLF SSRFDSGNLA HVEKVETVSS DGEGVGGVAT APASGSAASP
60 70 80 90 100
DYEFNVWTRP DCAETEYENG NRSWFYFSVR GGTPGKLIKI NIMNMNKQSK
110 120 130 140 150
LYSQGMAPFV RTLPSRPRWE RIRERPTFEM TETQFVLSFV HRFVEGRGAT
160 170 180 190 200
TFFAFCYPFS YSDCQDLLSQ LDQRFSENYS THSSPLDSIY YHRELLCYSL
210 220 230 240 250
DGLRVDLLTI TSCHGLRDDR EPRLEQLFPD LGTPRPFRFT GKRIFFLSSR
260 270 280 290 300
VHPGETPSSF VFNGFLDFIL RPDDPRAQTL RRLFVFKLIP MLNPDGVVRG
310 320 330 340 350
HYRTDSRGVN LNRQYLKPDA VLHPAIYGAK AVLLYHHVHS RLNAKSPTNQ
360 370 380 390 400
QPTLHLPPEA PLSDLEKANN LHNEAHLGQS PDGENPATWP ETEPAEEKTD
410 420 430 440 450
PVWLMPQPIP ELEEPAPDTI PPKESGVAYY VDLHGHASKR GCFMYGNSFS
460 470 480 490 500
DESTQVENML YPKLISLNSA HFDFQGCNFS EKNMYARDRR DGQSKEGSGR
510 520 530 540 550
VAIYKASGII HSYTLECNYN TGRSVNSIPA ACHDNGRASP PPPPAFPSRY
560 570 580 590 600
TVELFEQVGR AMAIAALDMA ECNPWPRIVL SEHSSLTNLR AWMLRHVRNS
610 620 630 640 650
RGLTSAGNMG ASKKRGARTP PKSNNSLPVS CSENALSRVR SFSTGTSTGG
660 670 680 690 700
SSSSQQNSPQ MKNSPSFPFH GSRTAGLPGL GSSTQKVSHR VLGPVREPRC
710 720 730 740 750
SDRRRRQQPL NHRSTTSSLA PSPTLASSGP TSSRNMGSCL LPNSLSLSGS
760 770 780 790 800
SCSFSSSGDK PEAVMVIGKS LLGAGARIPC IRTRLQARPR LGRSSPPTRR
810 820 830 840 850
GMRGSSPTSP IPQTRESSEL EPGPHSATPG LPQAGPPRPR SAPAFSPISC
860 870 880
TLSDSPSRIC YSRGLLNQCE VCFVPKSPPL TISPRV
Length:886
Mass (Da):97,607
Last modified:January 11, 2011 - v2
Checksum:i58A971BD521890D6
GO
Isoform 2 (identifier: Q09M02-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     787-886: ARPRLGRSSP...SPPLTISPRV → TCQRRVSARRGPGFPRLGPGWAGAHRRLAEG

Note: No experimental confirmation available.
Show »
Length:817
Mass (Da):90,366
Checksum:i4C090370AB629155
GO
Isoform 3 (identifier: Q09M02-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     750-886: SSCSFSSSGD...SPPLTISPRV → RYPLPLKPELPTFFPFLPPRA

Show »
Length:770
Mass (Da):85,683
Checksum:iA1EEFB1D5037750A
GO
Isoform 4 (identifier: Q09M02-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     787-886: ARPRLGRSSP...SPPLTISPRV → TPLSLPDAPQPQPTSFGFPTRP

Show »
Length:808
Mass (Da):89,343
Checksum:i69D1E2018E2E4536
GO
Isoform 5 (identifier: Q09M02-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-92: Missing.
     129-129: E → ELGSKLSPCFSKPEEAGSHVESVRGRELVK
     456-458: VEN → VGL
     459-886: Missing.

Note: No experimental confirmation available.
Show »
Length:395
Mass (Da):45,047
Checksum:iFD3426A0657D3EB8
GO
Isoform 6 (identifier: Q09M02-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     697-886: EPRCSDRRRR...SPPLTISPRV → GKPVWEPLQQVFGCLGHCWGERA

Note: No experimental confirmation available.
Show »
Length:719
Mass (Da):80,149
Checksum:i3DF13D17AC999AE7
GO
Isoform 7 (identifier: Q09M02-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     129-129: E → ELGSKLSPCFSKPEEAGSHVESVRGRELVK
     787-886: ARPRLGRSSP...SPPLTISPRV → TCQRRVSARRGPGFPRLGPGWAGAHRRLAEG

Show »
Length:846
Mass (Da):93,475
Checksum:i83CADF3960CA52E0
GO

Sequence cautioni

The sequence AAH57349 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti103S → A in BAC29150 (PubMed:16141072).Curated1
Sequence conflicti337H → R in BAC28871 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0404271 – 92Missing in isoform 5. 1 PublicationAdd BLAST92
Alternative sequenceiVSP_040428129E → ELGSKLSPCFSKPEEAGSHV ESVRGRELVK in isoform 5 and isoform 7. 2 Publications1
Alternative sequenceiVSP_040429456 – 458VEN → VGL in isoform 5. 1 Publication3
Alternative sequenceiVSP_040430459 – 886Missing in isoform 5. 1 PublicationAdd BLAST428
Alternative sequenceiVSP_040431697 – 886EPRCS…ISPRV → GKPVWEPLQQVFGCLGHCWG ERA in isoform 6. 1 PublicationAdd BLAST190
Alternative sequenceiVSP_040432750 – 886SSCSF…ISPRV → RYPLPLKPELPTFFPFLPPR A in isoform 3. 2 PublicationsAdd BLAST137
Alternative sequenceiVSP_040433787 – 886ARPRL…ISPRV → TCQRRVSARRGPGFPRLGPG WAGAHRRLAEG in isoform 2 and isoform 7. 2 PublicationsAdd BLAST100
Alternative sequenceiVSP_040434787 – 886ARPRL…ISPRV → TPLSLPDAPQPQPTSFGFPT RP in isoform 4. 2 PublicationsAdd BLAST100

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
DQ867034 mRNA Translation: ABI51953.1
DQ867035 mRNA Translation: ABI51954.1
DQ867036 mRNA Translation: ABI51955.1
DQ867037 mRNA Translation: ABI51956.1
DQ867038 mRNA Translation: ABI51957.1
AK029676 mRNA Translation: BAC26559.1
AK035680 mRNA Translation: BAC29150.1
AK034894 mRNA Translation: BAC28871.1
AK044195 mRNA Translation: BAC31813.1
AC109606 Genomic DNA No translation available.
BC057349 mRNA Translation: AAH57349.1 Different initiation.
CCDSiCCDS19165.1 [Q09M02-6]
CCDS39048.1 [Q09M02-7]
CCDS80242.1 [Q09M02-3]
RefSeqiNP_001041657.1, NM_001048192.2 [Q09M02-7]
NP_001281191.1, NM_001294262.1 [Q09M02-3]
NP_777274.1, NM_174849.3 [Q09M02-6]
XP_006503938.1, XM_006503875.1 [Q09M02-1]
XP_006503939.1, XM_006503876.1 [Q09M02-1]
XP_006503940.1, XM_006503877.1 [Q09M02-1]
UniGeneiMm.440364

Genome annotation databases

EnsembliENSMUST00000069705; ENSMUSP00000063228; ENSMUSG00000029165 [Q09M02-6]
ENSMUST00000114700; ENSMUSP00000110348; ENSMUSG00000029165 [Q09M02-7]
ENSMUST00000201168; ENSMUSP00000143808; ENSMUSG00000029165 [Q09M02-1]
ENSMUST00000201225; ENSMUSP00000143934; ENSMUSG00000029165 [Q09M02-3]
ENSMUST00000201817; ENSMUSP00000144304; ENSMUSG00000029165 [Q09M02-4]
ENSMUST00000201917; ENSMUSP00000144188; ENSMUSG00000029165 [Q09M02-2]
ENSMUST00000202060; ENSMUSP00000144018; ENSMUSG00000029165 [Q09M02-3]
GeneIDi231093
KEGGimmu:231093
UCSCiuc008wwc.1 mouse [Q09M02-6]
uc008wwd.1 mouse [Q09M02-5]
uc008wwf.2 mouse [Q09M02-3]
uc008wwg.2 mouse [Q09M02-7]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiCBPC5_MOUSE
AccessioniPrimary (citable) accession number: Q09M02
Secondary accession number(s): D3Z6S8
, Q09M01, Q09M03, Q09M04, Q6PFZ3, Q8BLL9, Q8BM52, Q8BZD8, Q8C0W4
Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 2, 2007
Last sequence update: January 11, 2011
Last modified: March 28, 2018
This is version 88 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. Peptidase families
    Classification of peptidase families and list of entries
  3. SIMILARITY comments
    Index of protein domains and families

Cookie policy

We would like to use anonymized google analytics cookies to gather statistics on how uniprot.org is used in aggregate. Learn more

UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health