Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Cytosolic carboxypeptidase-like protein 5

Gene

Agbl5

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Metallocarboxypeptidase that mediates protein deglutamylation. Specifically catalyzes the deglutamylation of the branching point glutamate side chains generated by post-translational glutamylation in proteins such as tubulins (PubMed:20519502, PubMed:21074048). In contrast, it is not able to act as a long-chain deglutamylase that shortens long polyglutamate chains, a process catalyzed by AGTPBP1/CCP1, AGBL2/CCP2, AGBL3/CCP3, AGBL1/CCP4 and AGBL4/CCP6 (PubMed:25103237). Mediates deglutamylation of CGAS/MB21D1, regulating the antiviral activity of CGAS/MB21D1 (PubMed:26829768).4 Publications

Cofactori

Zn2+By similarityNote: Binds 1 zinc ion per subunit.By similarity

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Metal bindingi252 – 2521Zinc1 Publication
Metal bindingi255 – 2551Zinc1 Publication
Active sitei303 – 3031NucleophileBy similarity
Metal bindingi434 – 4341ZincBy similarity

GO - Molecular functioni

  • metallocarboxypeptidase activity Source: UniProtKB
  • tubulin binding Source: UniProtKB
  • zinc ion binding Source: InterPro

GO - Biological processi

  • defense response to virus Source: UniProtKB
  • protein branching point deglutamylation Source: UniProtKB
  • protein deglutamylation Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Carboxypeptidase, Hydrolase, Metalloprotease, Protease

Keywords - Ligandi

Metal-binding, Zinc

Protein family/group databases

MEROPSiM14.954.

Names & Taxonomyi

Protein namesi
Recommended name:
Cytosolic carboxypeptidase-like protein 5 (EC:3.4.17.-)
Alternative name(s):
ATP/GTP-binding protein-like 5
Gene namesi
Name:Agbl5
Synonyms:Ccp5
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 5

Organism-specific databases

MGIiMGI:2441745. Agbl5.

Subcellular locationi

  • Cytoplasmcytosol 1 Publication
  • Nucleus 1 Publication
  • Cytoplasmcytoskeletonspindle By similarity
  • Midbody By similarity

  • Note: Colocalizes with alpha-tubulin in the mitotic spindle and with midbody microtubules in the intercellular bridges formed during cytokinesis (By similarity). Mainly cytoplasmic. Slight accumulation in the nucleus is observed (PubMed:17244818).By similarity1 Publication

GO - Cellular componenti

  • cytoplasm Source: MGI
  • cytosol Source: UniProtKB
  • midbody Source: UniProtKB
  • mitotic spindle Source: UniProtKB
  • nucleus Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton, Nucleus

Pathology & Biotechi

Disruption phenotypei

Mice are more vulnerable to DNA virus infection due to impaired immune response.1 Publication

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi252 – 2521H → S: Abolishes deglutamylase activity; when associated with Q-255. 2 Publications
Mutagenesisi255 – 2551E → Q: Abolishes deglutamylase activity; when associated with S-252. 2 Publications

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 886886Cytosolic carboxypeptidase-like protein 5PRO_0000305922Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei841 – 8411PhosphoserineCombined sources

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ09M02.
PRIDEiQ09M02.

PTM databases

iPTMnetiQ09M02.
PhosphoSiteiQ09M02.

Expressioni

Tissue specificityi

Widely expressed. Highly expressed in testis, and moderately in pituitary, brain, eye and kidney.2 Publications

Gene expression databases

BgeeiENSMUSG00000029165.
CleanExiMM_AGBL5.
ExpressionAtlasiQ09M02. baseline and differential.
GenevisibleiQ09M02. MM.

Interactioni

GO - Molecular functioni

  • tubulin binding Source: UniProtKB

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000110348.

Structurei

3D structure databases

ProteinModelPortaliQ09M02.
SMRiQ09M02. Positions 252-338.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the peptidase M14 family.Curated

Phylogenomic databases

eggNOGiKOG3641. Eukaryota.
COG2866. LUCA.
GeneTreeiENSGT00550000074405.
HOVERGENiHBG068187.
InParanoidiQ09M02.
OMAiPDTIPPK.
OrthoDBiEOG091G03CV.
TreeFamiTF324301.

Family and domain databases

InterProiIPR000834. Peptidase_M14.
[Graphical view]
PfamiPF00246. Peptidase_M14. 1 hit.
[Graphical view]

Sequences (7)i

Sequence statusi: Complete.

This entry describes 7 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q09M02-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MELRCGGLLF SSRFDSGNLA HVEKVETVSS DGEGVGGVAT APASGSAASP
60 70 80 90 100
DYEFNVWTRP DCAETEYENG NRSWFYFSVR GGTPGKLIKI NIMNMNKQSK
110 120 130 140 150
LYSQGMAPFV RTLPSRPRWE RIRERPTFEM TETQFVLSFV HRFVEGRGAT
160 170 180 190 200
TFFAFCYPFS YSDCQDLLSQ LDQRFSENYS THSSPLDSIY YHRELLCYSL
210 220 230 240 250
DGLRVDLLTI TSCHGLRDDR EPRLEQLFPD LGTPRPFRFT GKRIFFLSSR
260 270 280 290 300
VHPGETPSSF VFNGFLDFIL RPDDPRAQTL RRLFVFKLIP MLNPDGVVRG
310 320 330 340 350
HYRTDSRGVN LNRQYLKPDA VLHPAIYGAK AVLLYHHVHS RLNAKSPTNQ
360 370 380 390 400
QPTLHLPPEA PLSDLEKANN LHNEAHLGQS PDGENPATWP ETEPAEEKTD
410 420 430 440 450
PVWLMPQPIP ELEEPAPDTI PPKESGVAYY VDLHGHASKR GCFMYGNSFS
460 470 480 490 500
DESTQVENML YPKLISLNSA HFDFQGCNFS EKNMYARDRR DGQSKEGSGR
510 520 530 540 550
VAIYKASGII HSYTLECNYN TGRSVNSIPA ACHDNGRASP PPPPAFPSRY
560 570 580 590 600
TVELFEQVGR AMAIAALDMA ECNPWPRIVL SEHSSLTNLR AWMLRHVRNS
610 620 630 640 650
RGLTSAGNMG ASKKRGARTP PKSNNSLPVS CSENALSRVR SFSTGTSTGG
660 670 680 690 700
SSSSQQNSPQ MKNSPSFPFH GSRTAGLPGL GSSTQKVSHR VLGPVREPRC
710 720 730 740 750
SDRRRRQQPL NHRSTTSSLA PSPTLASSGP TSSRNMGSCL LPNSLSLSGS
760 770 780 790 800
SCSFSSSGDK PEAVMVIGKS LLGAGARIPC IRTRLQARPR LGRSSPPTRR
810 820 830 840 850
GMRGSSPTSP IPQTRESSEL EPGPHSATPG LPQAGPPRPR SAPAFSPISC
860 870 880
TLSDSPSRIC YSRGLLNQCE VCFVPKSPPL TISPRV
Length:886
Mass (Da):97,607
Last modified:January 11, 2011 - v2
Checksum:i58A971BD521890D6
GO
Isoform 2 (identifier: Q09M02-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     787-886: ARPRLGRSSP...SPPLTISPRV → TCQRRVSARRGPGFPRLGPGWAGAHRRLAEG

Note: No experimental confirmation available.
Show »
Length:817
Mass (Da):90,366
Checksum:i4C090370AB629155
GO
Isoform 3 (identifier: Q09M02-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     750-886: SSCSFSSSGD...SPPLTISPRV → RYPLPLKPELPTFFPFLPPRA

Show »
Length:770
Mass (Da):85,683
Checksum:iA1EEFB1D5037750A
GO
Isoform 4 (identifier: Q09M02-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     787-886: ARPRLGRSSP...SPPLTISPRV → TPLSLPDAPQPQPTSFGFPTRP

Show »
Length:808
Mass (Da):89,343
Checksum:i69D1E2018E2E4536
GO
Isoform 5 (identifier: Q09M02-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-92: Missing.
     129-129: E → ELGSKLSPCFSKPEEAGSHVESVRGRELVK
     456-458: VEN → VGL
     459-886: Missing.

Note: No experimental confirmation available.
Show »
Length:395
Mass (Da):45,047
Checksum:iFD3426A0657D3EB8
GO
Isoform 6 (identifier: Q09M02-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     697-886: EPRCSDRRRR...SPPLTISPRV → GKPVWEPLQQVFGCLGHCWGERA

Note: No experimental confirmation available.
Show »
Length:719
Mass (Da):80,149
Checksum:i3DF13D17AC999AE7
GO
Isoform 7 (identifier: Q09M02-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     129-129: E → ELGSKLSPCFSKPEEAGSHVESVRGRELVK
     787-886: ARPRLGRSSP...SPPLTISPRV → TCQRRVSARRGPGFPRLGPGWAGAHRRLAEG

Show »
Length:846
Mass (Da):93,475
Checksum:i83CADF3960CA52E0
GO

Sequence cautioni

The sequence AAH57349 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti103 – 1031S → A in BAC29150 (PubMed:16141072).Curated
Sequence conflicti337 – 3371H → R in BAC28871 (PubMed:16141072).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 9292Missing in isoform 5. 1 PublicationVSP_040427Add
BLAST
Alternative sequencei129 – 1291E → ELGSKLSPCFSKPEEAGSHV ESVRGRELVK in isoform 5 and isoform 7. 2 PublicationsVSP_040428
Alternative sequencei456 – 4583VEN → VGL in isoform 5. 1 PublicationVSP_040429
Alternative sequencei459 – 886428Missing in isoform 5. 1 PublicationVSP_040430Add
BLAST
Alternative sequencei697 – 886190EPRCS…ISPRV → GKPVWEPLQQVFGCLGHCWG ERA in isoform 6. 1 PublicationVSP_040431Add
BLAST
Alternative sequencei750 – 886137SSCSF…ISPRV → RYPLPLKPELPTFFPFLPPR A in isoform 3. 2 PublicationsVSP_040432Add
BLAST
Alternative sequencei787 – 886100ARPRL…ISPRV → TCQRRVSARRGPGFPRLGPG WAGAHRRLAEG in isoform 2 and isoform 7. 2 PublicationsVSP_040433Add
BLAST
Alternative sequencei787 – 886100ARPRL…ISPRV → TPLSLPDAPQPQPTSFGFPT RP in isoform 4. 2 PublicationsVSP_040434Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
DQ867034 mRNA. Translation: ABI51953.1.
DQ867035 mRNA. Translation: ABI51954.1.
DQ867036 mRNA. Translation: ABI51955.1.
DQ867037 mRNA. Translation: ABI51956.1.
DQ867038 mRNA. Translation: ABI51957.1.
AK029676 mRNA. Translation: BAC26559.1.
AK035680 mRNA. Translation: BAC29150.1.
AK034894 mRNA. Translation: BAC28871.1.
AK044195 mRNA. Translation: BAC31813.1.
AC109606 Genomic DNA. No translation available.
BC057349 mRNA. Translation: AAH57349.1. Different initiation.
CCDSiCCDS19165.1. [Q09M02-6]
CCDS39048.1. [Q09M02-7]
CCDS80242.1. [Q09M02-3]
RefSeqiNP_001041657.1. NM_001048192.2. [Q09M02-7]
NP_001281191.1. NM_001294262.1. [Q09M02-3]
NP_777274.1. NM_174849.3. [Q09M02-6]
XP_006503938.1. XM_006503875.1. [Q09M02-1]
XP_006503939.1. XM_006503876.1. [Q09M02-1]
XP_006503940.1. XM_006503877.1. [Q09M02-1]
UniGeneiMm.440364.

Genome annotation databases

EnsembliENSMUST00000069705; ENSMUSP00000063228; ENSMUSG00000029165. [Q09M02-6]
ENSMUST00000114700; ENSMUSP00000110348; ENSMUSG00000029165. [Q09M02-7]
ENSMUST00000201168; ENSMUSP00000143808; ENSMUSG00000029165. [Q09M02-1]
ENSMUST00000201225; ENSMUSP00000143934; ENSMUSG00000029165. [Q09M02-3]
ENSMUST00000201817; ENSMUSP00000144304; ENSMUSG00000029165. [Q09M02-4]
ENSMUST00000201917; ENSMUSP00000144188; ENSMUSG00000029165. [Q09M02-2]
ENSMUST00000202060; ENSMUSP00000144018; ENSMUSG00000029165. [Q09M02-3]
GeneIDi231093.
KEGGimmu:231093.
UCSCiuc008wwc.1. mouse. [Q09M02-6]
uc008wwd.1. mouse. [Q09M02-5]
uc008wwf.2. mouse. [Q09M02-3]
uc008wwg.2. mouse. [Q09M02-7]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
DQ867034 mRNA. Translation: ABI51953.1.
DQ867035 mRNA. Translation: ABI51954.1.
DQ867036 mRNA. Translation: ABI51955.1.
DQ867037 mRNA. Translation: ABI51956.1.
DQ867038 mRNA. Translation: ABI51957.1.
AK029676 mRNA. Translation: BAC26559.1.
AK035680 mRNA. Translation: BAC29150.1.
AK034894 mRNA. Translation: BAC28871.1.
AK044195 mRNA. Translation: BAC31813.1.
AC109606 Genomic DNA. No translation available.
BC057349 mRNA. Translation: AAH57349.1. Different initiation.
CCDSiCCDS19165.1. [Q09M02-6]
CCDS39048.1. [Q09M02-7]
CCDS80242.1. [Q09M02-3]
RefSeqiNP_001041657.1. NM_001048192.2. [Q09M02-7]
NP_001281191.1. NM_001294262.1. [Q09M02-3]
NP_777274.1. NM_174849.3. [Q09M02-6]
XP_006503938.1. XM_006503875.1. [Q09M02-1]
XP_006503939.1. XM_006503876.1. [Q09M02-1]
XP_006503940.1. XM_006503877.1. [Q09M02-1]
UniGeneiMm.440364.

3D structure databases

ProteinModelPortaliQ09M02.
SMRiQ09M02. Positions 252-338.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000110348.

Protein family/group databases

MEROPSiM14.954.

PTM databases

iPTMnetiQ09M02.
PhosphoSiteiQ09M02.

Proteomic databases

PaxDbiQ09M02.
PRIDEiQ09M02.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000069705; ENSMUSP00000063228; ENSMUSG00000029165. [Q09M02-6]
ENSMUST00000114700; ENSMUSP00000110348; ENSMUSG00000029165. [Q09M02-7]
ENSMUST00000201168; ENSMUSP00000143808; ENSMUSG00000029165. [Q09M02-1]
ENSMUST00000201225; ENSMUSP00000143934; ENSMUSG00000029165. [Q09M02-3]
ENSMUST00000201817; ENSMUSP00000144304; ENSMUSG00000029165. [Q09M02-4]
ENSMUST00000201917; ENSMUSP00000144188; ENSMUSG00000029165. [Q09M02-2]
ENSMUST00000202060; ENSMUSP00000144018; ENSMUSG00000029165. [Q09M02-3]
GeneIDi231093.
KEGGimmu:231093.
UCSCiuc008wwc.1. mouse. [Q09M02-6]
uc008wwd.1. mouse. [Q09M02-5]
uc008wwf.2. mouse. [Q09M02-3]
uc008wwg.2. mouse. [Q09M02-7]

Organism-specific databases

CTDi60509.
MGIiMGI:2441745. Agbl5.

Phylogenomic databases

eggNOGiKOG3641. Eukaryota.
COG2866. LUCA.
GeneTreeiENSGT00550000074405.
HOVERGENiHBG068187.
InParanoidiQ09M02.
OMAiPDTIPPK.
OrthoDBiEOG091G03CV.
TreeFamiTF324301.

Miscellaneous databases

PROiQ09M02.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000029165.
CleanExiMM_AGBL5.
ExpressionAtlasiQ09M02. baseline and differential.
GenevisibleiQ09M02. MM.

Family and domain databases

InterProiIPR000834. Peptidase_M14.
[Graphical view]
PfamiPF00246. Peptidase_M14. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiCBPC5_MOUSE
AccessioniPrimary (citable) accession number: Q09M02
Secondary accession number(s): D3Z6S8
, Q09M01, Q09M03, Q09M04, Q6PFZ3, Q8BLL9, Q8BM52, Q8BZD8, Q8C0W4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 2, 2007
Last sequence update: January 11, 2011
Last modified: September 7, 2016
This is version 78 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. Peptidase families
    Classification of peptidase families and list of entries
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.