Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Zinc finger protein 415

Gene

ZNF415

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Involved in transcriptional regulation. Transcriptional activity differed among the various isoforms. All isoforms except isoform 3 seem to suppresses the transcriptional activities of AP-1 and p53/TP53.1 Publication

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri264 – 286C2H2-type 1; degeneratePROSITE-ProRule annotationAdd BLAST23
Zinc fingeri292 – 314C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri320 – 342C2H2-type 3PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri348 – 370C2H2-type 4PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri376 – 398C2H2-type 5PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri404 – 426C2H2-type 6PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri432 – 454C2H2-type 7PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri460 – 482C2H2-type 8PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri488 – 510C2H2-type 9PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri516 – 538C2H2-type 10PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri544 – 566C2H2-type 11PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri572 – 594C2H2-type 12PROSITE-ProRule annotationAdd BLAST23

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding, Metal-binding, Zinc

Enzyme and pathway databases

ReactomeiR-HSA-212436. Generic Transcription Pathway.

Names & Taxonomyi

Protein namesi
Recommended name:
Zinc finger protein 415
Gene namesi
Name:ZNF415
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 19

Organism-specific databases

HGNCiHGNC:20636. ZNF415.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000170954.
PharmGKBiPA134984602.

Polymorphism and mutation databases

BioMutaiZNF415.
DMDMi147742905.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002868081 – 603Zinc finger protein 415Add BLAST603

Proteomic databases

PaxDbiQ09FC8.
PeptideAtlasiQ09FC8.
PRIDEiQ09FC8.

PTM databases

iPTMnetiQ09FC8.
PhosphoSitePlusiQ09FC8.

Expressioni

Tissue specificityi

Expressed in all tissues examined. Isoforms are differentially expressed. Isoform 3 and isoform 5 were highly expressed, isoform 4 moderately expressed, isoform 2 lower expression, the lowest expression level was seem with isoform 1.1 Publication

Gene expression databases

BgeeiENSG00000170954.
CleanExiHS_ZNF415.
ExpressionAtlasiQ09FC8. baseline and differential.
GenevisibleiQ09FC8. HS.

Organism-specific databases

HPAiHPA005553.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
KRTAP4-12Q9BQ663EBI-10226171,EBI-739863
MTUS2Q5JR593EBI-10226171,EBI-742948

Protein-protein interaction databases

BioGridi120900. 2 interactors.
IntActiQ09FC8. 2 interactors.
STRINGi9606.ENSP00000243643.

Structurei

3D structure databases

ProteinModelPortaliQ09FC8.
SMRiQ09FC8.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Contains 12 C2H2-type zinc fingers.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri264 – 286C2H2-type 1; degeneratePROSITE-ProRule annotationAdd BLAST23
Zinc fingeri292 – 314C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri320 – 342C2H2-type 3PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri348 – 370C2H2-type 4PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri376 – 398C2H2-type 5PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri404 – 426C2H2-type 6PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri432 – 454C2H2-type 7PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri460 – 482C2H2-type 8PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri488 – 510C2H2-type 9PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri516 – 538C2H2-type 10PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri544 – 566C2H2-type 11PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri572 – 594C2H2-type 12PROSITE-ProRule annotationAdd BLAST23

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiKOG1721. Eukaryota.
COG5048. LUCA.
GeneTreeiENSGT00690000102079.
HOVERGENiHBG018163.
InParanoidiQ09FC8.
KOiK09228.
OMAiTVHQVSH.
OrthoDBiEOG091G02KC.
PhylomeDBiQ09FC8.
TreeFamiTF341892.

Family and domain databases

Gene3Di3.30.160.60. 12 hits.
InterProiIPR003656. Znf_BED.
IPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view]
PfamiPF00096. zf-C2H2. 6 hits.
[Graphical view]
SMARTiSM00614. ZnF_BED. 2 hits.
SM00355. ZnF_C2H2. 11 hits.
[Graphical view]
PROSITEiPS00028. ZINC_FINGER_C2H2_1. 11 hits.
PS50157. ZINC_FINGER_C2H2_2. 11 hits.
[Graphical view]

Sequences (6)i

Sequence statusi: Complete.

This entry describes 6 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q09FC8-1) [UniParc]FASTAAdd to basket
Also known as: ZNF415-3

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MPELYTEDFI QGCDVGELQE PGLPGVLSYV GAQERALDHR KPSTSSKKTK
60 70 80 90 100
RVEIDQRCEN RLECNGAISA HCNLRLPDSN DSPASASRVA GITDLSRNCV
110 120 130 140 150
IKELAPQQEG NPGEVFHTVT LEQHEKHDIE EFCFREIKKK IHDFDCQWRD
160 170 180 190 200
DERNCNKVTT APKENLTCRR DQRDRRGIGN KSIKHQLGLS FLPHPHELQQ
210 220 230 240 250
FQAEGKIYEC NHVEKSVNHG SSVSPPQIIS STIKTHVSNK YGTDFICSSL
260 270 280 290 300
LTQEQKSCIR EKPYRYIECD KALNHGSHMT VRQVSHSGEK GYKCDLCGKV
310 320 330 340 350
FSQKSNLARH WRVHTGEKPY KCNECDRSFS RNSCLALHRR VHTGEKPYKC
360 370 380 390 400
YECDKVFSRN SCLALHQKTH IGEKPYTCKE CGKAFSVRST LTNHQVIHSG
410 420 430 440 450
KKPYKCNECG KVFSQTSSLA THQRIHTGEK PYKCNECGKV FSQTSSLARH
460 470 480 490 500
WRIHTGEKPY KCNECGKVFS YNSHLASHRR VHTGEKPYKC NECGKAFSVH
510 520 530 540 550
SNLTTHQVIH TGEKPYKCNQ CGKGFSVHSS LTTHQVIHTG EKPYKCNECG
560 570 580 590 600
KSFSVRPNLT RHQIIHTGKK PYKCSDCGKS FSVRPNLFRH QIIHTKEKPY

KRN
Length:603
Mass (Da):68,798
Last modified:May 15, 2007 - v2
Checksum:i6B62D29A4E6E9300
GO
Isoform 2 (identifier: Q09FC8-2) [UniParc]FASTAAdd to basket
Also known as: ZNF415-2

The sequence of this isoform differs from the canonical sequence as follows:
     26-61: Missing.

Show »
Length:567
Mass (Da):64,629
Checksum:iF3858FF0048D2953
GO
Isoform 3 (identifier: Q09FC8-3) [UniParc]FASTAAdd to basket
Also known as: ZNF415-1

The sequence of this isoform differs from the canonical sequence as follows:
     1-278: Missing.

Show »
Length:325
Mass (Da):37,237
Checksum:i8E557F03DB31B1BE
GO
Isoform 4 (identifier: Q09FC8-4) [UniParc]FASTAAdd to basket
Also known as: ZNF415-4

The sequence of this isoform differs from the canonical sequence as follows:
     1-92: MPELYTEDFI...PASASRVAGI → MWEHRKEPWTIESQVRVARKPKGWEWIKGVK

Show »
Length:542
Mass (Da):62,646
Checksum:i7EFB14E7808AE46B
GO
Isoform 5 (identifier: Q09FC8-5) [UniParc]FASTAAdd to basket
Also known as: ZNF415-5

The sequence of this isoform differs from the canonical sequence as follows:
     1-93: MPELYTEDFI...ASASRVAGIT → MAFTQLTFRD...LENYRNLVSL

Show »
Length:555
Mass (Da):64,116
Checksum:i6BF6BA5514484EC4
GO
Isoform 6 (identifier: Q09FC8-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-93: MPELYTEDFI...ASASRVAGIT → MDGDGLTFRD...LENYRNLVSL

Note: No experimental confirmation available.
Show »
Length:555
Mass (Da):64,012
Checksum:i41AFE1DB5E2F6AD0
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_032166196H → P.Corresponds to variant rs16984466dbSNPEnsembl.1
Natural variantiVAR_032167229I → L.2 PublicationsCorresponds to variant rs1054485dbSNPEnsembl.1
Natural variantiVAR_032168233I → V.2 PublicationsCorresponds to variant rs1133327dbSNPEnsembl.1
Natural variantiVAR_032169241Y → C.Corresponds to variant rs1560099dbSNPEnsembl.1
Natural variantiVAR_032170463N → D.1 PublicationCorresponds to variant rs10410030dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0251751 – 278Missing in isoform 3. 1 PublicationAdd BLAST278
Alternative sequenceiVSP_0251761 – 93MPELY…VAGIT → MAFTQLTFRDVAIEFSQDEW KCLNSTQRTLYRDVMLENYR NLVSL in isoform 5. 2 PublicationsAdd BLAST93
Alternative sequenceiVSP_0448071 – 93MPELY…VAGIT → MDGDGLTFRDVAIEFSQDEW KCLNSTQRTLYRDVMLENYR NLVSL in isoform 6. 1 PublicationAdd BLAST93
Alternative sequenceiVSP_0251771 – 92MPELY…RVAGI → MWEHRKEPWTIESQVRVARK PKGWEWIKGVK in isoform 4. 2 PublicationsAdd BLAST92
Alternative sequenceiVSP_02517826 – 61Missing in isoform 2. 1 PublicationAdd BLAST36

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
DQ925697 mRNA. Translation: ABI51311.1.
DQ925696 mRNA. Translation: ABI51310.1.
DQ925698 mRNA. Translation: ABI51312.1.
DQ925695 mRNA. Translation: ABI51309.1.
AY283600 mRNA. Translation: AAP35086.1.
AK002053 mRNA. Translation: BAA92059.1.
DA518713 mRNA. No translation available.
AC010328 Genomic DNA. No translation available.
BC069668 mRNA. Translation: AAH69668.1.
BC063880 mRNA. Translation: AAH63880.1.
CCDSiCCDS12860.1. [Q09FC8-5]
CCDS54313.1. [Q09FC8-6]
CCDS82393.1. [Q09FC8-3]
RefSeqiNP_001129510.2. NM_001136038.2. [Q09FC8-6]
NP_001157781.1. NM_001164309.1. [Q09FC8-5]
NP_001317688.1. NM_001330759.1.
NP_001317695.1. NM_001330766.1.
NP_060825.2. NM_018355.3. [Q09FC8-5]
XP_006723335.1. XM_006723272.2. [Q09FC8-2]
XP_006723336.1. XM_006723273.2. [Q09FC8-2]
XP_006723337.1. XM_006723274.2. [Q09FC8-2]
XP_006723340.1. XM_006723277.2. [Q09FC8-4]
XP_006723342.1. XM_006723279.1. [Q09FC8-4]
XP_006723344.1. XM_006723281.2. [Q09FC8-3]
XP_011525405.1. XM_011527103.1. [Q09FC8-5]
XP_011525406.1. XM_011527104.1. [Q09FC8-4]
XP_016882453.1. XM_017026964.1. [Q09FC8-5]
XP_016882454.1. XM_017026965.1. [Q09FC8-6]
XP_016882455.1. XM_017026966.1. [Q09FC8-6]
XP_016882456.1. XM_017026967.1. [Q09FC8-6]
XP_016882457.1. XM_017026968.1. [Q09FC8-4]
XP_016882459.1. XM_017026970.1. [Q09FC8-2]
XP_016882461.1. XM_017026972.1. [Q09FC8-3]
XP_016882462.1. XM_017026973.1. [Q09FC8-2]
UniGeneiHs.147765.

Genome annotation databases

EnsembliENST00000243643; ENSP00000243643; ENSG00000170954. [Q09FC8-5]
ENST00000421033; ENSP00000395055; ENSG00000170954. [Q09FC8-5]
ENST00000500065; ENSP00000439435; ENSG00000170954. [Q09FC8-6]
ENST00000601493; ENSP00000472911; ENSG00000170954. [Q09FC8-3]
GeneIDi55786.
KEGGihsa:55786.
UCSCiuc002qaw.4. human. [Q09FC8-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
DQ925697 mRNA. Translation: ABI51311.1.
DQ925696 mRNA. Translation: ABI51310.1.
DQ925698 mRNA. Translation: ABI51312.1.
DQ925695 mRNA. Translation: ABI51309.1.
AY283600 mRNA. Translation: AAP35086.1.
AK002053 mRNA. Translation: BAA92059.1.
DA518713 mRNA. No translation available.
AC010328 Genomic DNA. No translation available.
BC069668 mRNA. Translation: AAH69668.1.
BC063880 mRNA. Translation: AAH63880.1.
CCDSiCCDS12860.1. [Q09FC8-5]
CCDS54313.1. [Q09FC8-6]
CCDS82393.1. [Q09FC8-3]
RefSeqiNP_001129510.2. NM_001136038.2. [Q09FC8-6]
NP_001157781.1. NM_001164309.1. [Q09FC8-5]
NP_001317688.1. NM_001330759.1.
NP_001317695.1. NM_001330766.1.
NP_060825.2. NM_018355.3. [Q09FC8-5]
XP_006723335.1. XM_006723272.2. [Q09FC8-2]
XP_006723336.1. XM_006723273.2. [Q09FC8-2]
XP_006723337.1. XM_006723274.2. [Q09FC8-2]
XP_006723340.1. XM_006723277.2. [Q09FC8-4]
XP_006723342.1. XM_006723279.1. [Q09FC8-4]
XP_006723344.1. XM_006723281.2. [Q09FC8-3]
XP_011525405.1. XM_011527103.1. [Q09FC8-5]
XP_011525406.1. XM_011527104.1. [Q09FC8-4]
XP_016882453.1. XM_017026964.1. [Q09FC8-5]
XP_016882454.1. XM_017026965.1. [Q09FC8-6]
XP_016882455.1. XM_017026966.1. [Q09FC8-6]
XP_016882456.1. XM_017026967.1. [Q09FC8-6]
XP_016882457.1. XM_017026968.1. [Q09FC8-4]
XP_016882459.1. XM_017026970.1. [Q09FC8-2]
XP_016882461.1. XM_017026972.1. [Q09FC8-3]
XP_016882462.1. XM_017026973.1. [Q09FC8-2]
UniGeneiHs.147765.

3D structure databases

ProteinModelPortaliQ09FC8.
SMRiQ09FC8.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi120900. 2 interactors.
IntActiQ09FC8. 2 interactors.
STRINGi9606.ENSP00000243643.

PTM databases

iPTMnetiQ09FC8.
PhosphoSitePlusiQ09FC8.

Polymorphism and mutation databases

BioMutaiZNF415.
DMDMi147742905.

Proteomic databases

PaxDbiQ09FC8.
PeptideAtlasiQ09FC8.
PRIDEiQ09FC8.

Protocols and materials databases

DNASUi55786.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000243643; ENSP00000243643; ENSG00000170954. [Q09FC8-5]
ENST00000421033; ENSP00000395055; ENSG00000170954. [Q09FC8-5]
ENST00000500065; ENSP00000439435; ENSG00000170954. [Q09FC8-6]
ENST00000601493; ENSP00000472911; ENSG00000170954. [Q09FC8-3]
GeneIDi55786.
KEGGihsa:55786.
UCSCiuc002qaw.4. human. [Q09FC8-1]

Organism-specific databases

CTDi55786.
GeneCardsiZNF415.
HGNCiHGNC:20636. ZNF415.
HPAiHPA005553.
neXtProtiNX_Q09FC8.
OpenTargetsiENSG00000170954.
PharmGKBiPA134984602.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1721. Eukaryota.
COG5048. LUCA.
GeneTreeiENSGT00690000102079.
HOVERGENiHBG018163.
InParanoidiQ09FC8.
KOiK09228.
OMAiTVHQVSH.
OrthoDBiEOG091G02KC.
PhylomeDBiQ09FC8.
TreeFamiTF341892.

Enzyme and pathway databases

ReactomeiR-HSA-212436. Generic Transcription Pathway.

Miscellaneous databases

ChiTaRSiZNF415. human.
GenomeRNAii55786.
PROiQ09FC8.

Gene expression databases

BgeeiENSG00000170954.
CleanExiHS_ZNF415.
ExpressionAtlasiQ09FC8. baseline and differential.
GenevisibleiQ09FC8. HS.

Family and domain databases

Gene3Di3.30.160.60. 12 hits.
InterProiIPR003656. Znf_BED.
IPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view]
PfamiPF00096. zf-C2H2. 6 hits.
[Graphical view]
SMARTiSM00614. ZnF_BED. 2 hits.
SM00355. ZnF_C2H2. 11 hits.
[Graphical view]
PROSITEiPS00028. ZINC_FINGER_C2H2_1. 11 hits.
PS50157. ZINC_FINGER_C2H2_2. 11 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiZN415_HUMAN
AccessioniPrimary (citable) accession number: Q09FC8
Secondary accession number(s): F5H287
, Q09FC7, Q09FC9, Q09FD0, Q6NSZ2, Q6P3S0, Q9NUR2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 15, 2007
Last sequence update: May 15, 2007
Last modified: November 30, 2016
This is version 101 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.