Q09666 (AHNK_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 107.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Neuroblast differentiation-associated protein AHNAK Alternative name(s): Desmoyokin | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 5890 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | May be required for neuronal cell differentiation. |
| Subunit structure | Interacts with DYSF; the interaction is direct and Ca2+-independent. Ref.8 |
| Subcellular location | |
| Sequence similarities | Contains 1 PDZ (DHR) domain. |
| Sequence caution | The sequence AAA69899.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Nucleus |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Repeat |
| PTM | Phosphoprotein |
| Technical term | 3D-structure Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | nervous system development Non-traceable author statement. Source: UniProtKB |
| Cellular_component | nucleus Non-traceable author statement Ref.4. Source: UniProtKB |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q09666-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q09666-2) The sequence of this isoform differs from the canonical sequence as follows: 115-149: SGDDEEYQRIYTTKIKPRLKSEDGVEGDLGETQSR → NTPQPSALECKDQNKQKEASSQAGAVSVSTPNAGL 150-5890: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 5890 | 5890 | Neuroblast differentiation-associated protein AHNAK | PRO_0000064504 | |||||
Regions | |||||||||
| Domain | 9 – 90 | 82 | PDZ | ||||||
| Motif | 4971 – 4979 | 9 | Nuclear localization signal Potential | ||||||
| Motif | 5019 – 5027 | 9 | Nuclear localization signal Potential | ||||||
| Motif | 5034 – 5039 | 6 | Nuclear localization signal Potential | ||||||
| Motif | 5706 – 5716 | 11 | Nuclear localization signal Potential | ||||||
| Motif | 5772 – 5779 | 8 | Nuclear localization signal Potential | ||||||
| Compositional bias | 5458 – 5654 | 197 | Gly-rich | ||||||
Amino acid modifications | |||||||||
| Modified residue | 41 | 1 | Phosphoserine Ref.6 Ref.7 Ref.11 Ref.12 Ref.17 | ||||||
| Modified residue | 93 | 1 | Phosphoserine Ref.6 Ref.12 Ref.17 Ref.19 | ||||||
| Modified residue | 101 | 1 | Phosphothreonine Ref.17 | ||||||
| Modified residue | 135 | 1 | Phosphoserine Ref.17 Ref.19 | ||||||
| Modified residue | 177 | 1 | Phosphoserine Ref.17 Ref.19 | ||||||
| Modified residue | 210 | 1 | Phosphoserine Ref.17 | ||||||
| Modified residue | 212 | 1 | Phosphoserine Ref.17 | ||||||
| Modified residue | 216 | 1 | Phosphoserine Ref.17 | ||||||
| Modified residue | 490 | 1 | Phosphothreonine Ref.6 Ref.9 Ref.17 Ref.19 | ||||||
| Modified residue | 511 | 1 | Phosphoserine Ref.6 Ref.7 Ref.9 Ref.11 Ref.12 Ref.15 Ref.16 Ref.17 Ref.19 | ||||||
| Modified residue | 559 | 1 | Phosphoserine Ref.17 Ref.19 | ||||||
| Modified residue | 570 | 1 | Phosphoserine Ref.12 Ref.16 Ref.17 | ||||||
| Modified residue | 793 | 1 | Phosphoserine Ref.12 Ref.17 | ||||||
| Modified residue | 1068 | 1 | Phosphoserine Ref.17 | ||||||
| Modified residue | 1192 | 1 | Phosphothreonine Ref.17 | ||||||
| Modified residue | 1286 | 1 | Phosphoserine Ref.17 | ||||||
| Modified residue | 1986 | 1 | Phosphothreonine Ref.17 | ||||||
| Modified residue | 2181 | 1 | Phosphothreonine Ref.17 | ||||||
| Modified residue | 2309 | 1 | Phosphothreonine Ref.17 | ||||||
| Modified residue | 2397 | 1 | Phosphoserine Ref.16 Ref.17 | ||||||
| Modified residue | 2670 | 1 | Phosphoserine Ref.17 | ||||||
| Modified residue | 2798 | 1 | Phosphoserine Ref.17 | ||||||
| Modified residue | 2832 | 1 | Phosphothreonine Ref.17 | ||||||
| Modified residue | 2845 | 1 | Phosphothreonine Ref.17 | ||||||
| Modified residue | 3054 | 1 | Phosphoserine Ref.17 | ||||||
| Modified residue | 3409 | 1 | Phosphoserine Ref.17 | ||||||
| Modified residue | 3412 | 1 | Phosphoserine Ref.17 | ||||||
| Modified residue | 3426 | 1 | Phosphoserine Ref.17 | ||||||
| Modified residue | 3716 | 1 | Phosphothreonine Ref.17 | ||||||
| Modified residue | 3836 | 1 | Phosphoserine Ref.17 | ||||||
| Modified residue | 4092 | 1 | Phosphoserine Ref.17 | ||||||
| Modified residue | 4100 | 1 | Phosphothreonine Ref.6 Ref.17 | ||||||
| Modified residue | 4220 | 1 | Phosphoserine Ref.17 | ||||||
| Modified residue | 4430 | 1 | Phosphothreonine Ref.17 | ||||||
| Modified residue | 4516 | 1 | Phosphoserine Ref.17 | ||||||
| Modified residue | 4684 | 1 | Phosphoserine Ref.17 | ||||||
| Modified residue | 4766 | 1 | Phosphothreonine Ref.6 | ||||||
| Modified residue | 4812 | 1 | Phosphoserine Ref.17 | ||||||
| Modified residue | 4903 | 1 | Phosphoserine Ref.12 | ||||||
| Modified residue | 4960 | 1 | Phosphoserine Ref.12 Ref.17 | ||||||
| Modified residue | 4986 | 1 | Phosphoserine Ref.9 Ref.17 | ||||||
| Modified residue | 4993 | 1 | Phosphoserine Ref.12 | ||||||
| Modified residue | 5009 | 1 | Phosphothreonine Ref.12 | ||||||
| Modified residue | 5077 | 1 | Phosphoserine Ref.6 Ref.17 | ||||||
| Modified residue | 5099 | 1 | Phosphoserine Ref.9 Ref.12 Ref.17 | ||||||
| Modified residue | 5110 | 1 | Phosphoserine Ref.6 Ref.9 Ref.17 | ||||||
| Modified residue | 5125 | 1 | Phosphoserine Ref.17 | ||||||
| Modified residue | 5332 | 1 | Phosphoserine Ref.17 | ||||||
| Modified residue | 5386 | 1 | Phosphoserine Ref.17 | ||||||
| Modified residue | 5400 | 1 | Phosphoserine Ref.17 | ||||||
| Modified residue | 5415 | 1 | Phosphothreonine Ref.12 | ||||||
| Modified residue | 5448 | 1 | Phosphoserine Ref.6 Ref.16 Ref.17 | ||||||
| Modified residue | 5552 | 1 | Phosphoserine Ref.6 Ref.9 Ref.17 | ||||||
| Modified residue | 5620 | 1 | Phosphoserine Ref.17 | ||||||
| Modified residue | 5731 | 1 | Phosphoserine Ref.7 Ref.12 Ref.16 Ref.17 Ref.19 | ||||||
| Modified residue | 5739 | 1 | Phosphoserine Ref.17 | ||||||
| Modified residue | 5749 | 1 | Phosphoserine Ref.10 Ref.12 Ref.14 Ref.16 | ||||||
| Modified residue | 5752 | 1 | Phosphoserine Ref.6 Ref.10 Ref.12 Ref.15 Ref.16 Ref.17 | ||||||
| Modified residue | 5763 | 1 | Phosphoserine Ref.7 Ref.12 Ref.16 Ref.17 | ||||||
| Modified residue | 5780 | 1 | Phosphoserine Ref.12 Ref.17 | ||||||
| Modified residue | 5782 | 1 | Phosphoserine Ref.12 Ref.17 | ||||||
| Modified residue | 5790 | 1 | Phosphoserine Ref.17 | ||||||
| Modified residue | 5793 | 1 | Phosphoserine Ref.12 | ||||||
| Modified residue | 5794 | 1 | Phosphothreonine Ref.12 | ||||||
| Modified residue | 5824 | 1 | Phosphothreonine Ref.17 | ||||||
| Modified residue | 5830 | 1 | Phosphoserine Ref.12 Ref.17 | ||||||
| Modified residue | 5841 | 1 | Phosphoserine Ref.12 Ref.17 Ref.19 | ||||||
| Modified residue | 5857 | 1 | Phosphoserine Ref.17 | ||||||
Natural variations | |||||||||
| Alternative sequence | 115 – 149 | 35 | SGDDE…ETQSR → NTPQPSALECKDQNKQKEAS SQAGAVSVSTPNAGL in isoform 2. | VSP_044233 | |||||
| Alternative sequence | 150 – 5890 | 5741 | Missing in isoform 2. | VSP_044234 | |||||
| Natural variant | 962 | 1 | G → V. Corresponds to variant rs664761 [ dbSNP | Ensembl ]. | VAR_039058 | |||||
| Natural variant | 2114 | 1 | A → T. Corresponds to variant rs1298288 [ dbSNP | Ensembl ]. | VAR_039059 | |||||
| Natural variant | 2247 | 1 | K → T. Corresponds to variant rs61524789 [ dbSNP | Ensembl ]. | VAR_061551 | |||||
| Natural variant | 2439 | 1 | P → L. Corresponds to variant rs11824660 [ dbSNP | Ensembl ]. | VAR_039060 | |||||
| Natural variant | 3003 | 1 | Q → K. Corresponds to variant rs566144 [ dbSNP | Ensembl ]. | VAR_039061 | |||||
| Natural variant | 3190 | 1 | V → I. Corresponds to variant rs11231129 [ dbSNP | Ensembl ]. | VAR_039062 | |||||
| Natural variant | 3724 | 1 | S → P. Corresponds to variant rs11231128 [ dbSNP | Ensembl ]. | VAR_039063 | |||||
| Natural variant | 4304 | 1 | D → G. Corresponds to variant rs11828907 [ dbSNP | Ensembl ]. | VAR_061552 | |||||
| Natural variant | 4561 | 1 | G → D. Corresponds to variant rs12795508 [ dbSNP | Ensembl ]. | VAR_039064 | |||||
| Natural variant | 4611 | 1 | M → V. Corresponds to variant rs12801302 [ dbSNP | Ensembl ]. | VAR_039065 | |||||
| Natural variant | 4613 | 1 | I → V. Corresponds to variant rs12801153 [ dbSNP | Ensembl ]. | VAR_039066 | |||||
| Natural variant | 4631 | 1 | D → G. Corresponds to variant rs12801123 [ dbSNP | Ensembl ]. | VAR_039067 | |||||
| Natural variant | 5415 | 1 | T → A. Corresponds to variant rs11231126 [ dbSNP | Ensembl ]. | VAR_039068 | |||||
Experimental info | |||||||||
| Sequence conflict | 288 | 1 | A → P in AAA69899. Ref.4 | ||||||
| Sequence conflict | 302 | 1 | G → A in AAA69899. Ref.4 | ||||||
| Sequence conflict | 1156 | 1 | V → D in AAA69899. Ref.4 | ||||||
| Sequence conflict | 1737 | 1 | P → R in AAA69899. Ref.4 | ||||||
| Sequence conflict | 1821 | 1 | F → L in AAA69899. Ref.4 | ||||||
| Sequence conflict | 4614 | 1 | S → T in AAA69898. Ref.4 | ||||||
| Sequence conflict | 4627 | 1 | V → A in AAA69898. Ref.4 | ||||||
| Sequence conflict | 4630 – 4631 | 2 | RD → KG in AAA69898. Ref.4 | ||||||
| Sequence conflict | 4637 – 4638 | 2 | DV → NT in AAA69898. Ref.4 | ||||||
| Sequence conflict | 4644 | 1 | Q → H in AAA69898. Ref.4 | ||||||
| Sequence conflict | 4830 | 1 | A → P in AAA69898. Ref.4 | ||||||
| Sequence conflict | 4834 | 1 | G → V in AAA69898. Ref.4 | ||||||
| Sequence conflict | 4837 | 1 | F → V in AAA69898. Ref.4 | ||||||
| Sequence conflict | 4984 | 1 | A → P in AAA69898. Ref.4 | ||||||
| Sequence conflict | 5445 | 1 | P → S in AAA69898. Ref.4 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Human chromosome 11 DNA sequence and analysis including novel gene identification." Taylor T.D., Noguchi H., Totoki Y., Toyoda A., Kuroki Y., Dewar K., Lloyd C., Itoh T., Takeda T., Kim D.-W., She X., Barlow K.F., Bloom T., Bruford E., Chang J.L., Cuomo C.A., Eichler E., FitzGerald M.G. Sakaki Y.Nature 440:497-500(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [2] | Mural R.J., Istrail S., Sutton G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). |
| [4] | "A human gene (AHNAK) encoding an unusually large protein with a 1.2-microns polyionic rod structure." Shtivelman E., Cohen F.E., Bishop J.M. Proc. Natl. Acad. Sci. U.S.A. 89:5472-5476(1992) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 114-1930 (ISOFORM 1), NUCLEOTIDE SEQUENCE [MRNA] OF 4614-5890 (ISOFORM 1). Tissue: Placenta. |
| [5] | Erratum Shtivelman E., Cohen F.E., Bishop J.M. Proc. Natl. Acad. Sci. U.S.A. 90:4328-4328(1993) |
| [6] | "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks." Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M. Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-41; SER-93; THR-490; SER-511; THR-4100; THR-4766; SER-5077; SER-5110; SER-5448; SER-5552 AND SER-5752, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [7] | "A probability-based approach for high-throughput protein phosphorylation analysis and site localization." Beausoleil S.A., Villen J., Gerber S.A., Rush J., Gygi S.P. Nat. Biotechnol. 24:1285-1292(2006) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-41; SER-511; SER-5731 AND SER-5763, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [8] | "AHNAK, a novel component of the dysferlin protein complex, redistributes to the cytoplasm with dysferlin during skeletal muscle regeneration." Huang Y., Laval S.H., van Remoortere A., Baudier J., Benaud C., Anderson L.V., Straub V., Deelder A., Frants R.R., den Dunnen J.T., Bushby K., van der Maarel S.M. FASEB J. 21:732-742(2007) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH DYSF. |
| [9] | "Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra." Yu L.-R., Zhu Z., Chan K.C., Issaq H.J., Dimitrov D.S., Veenstra T.D. J. Proteome Res. 6:4150-4162(2007) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-490; SER-511; SER-4986; SER-5099; SER-5110 AND SER-5552, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [10] | "Phosphorylation analysis of primary human T lymphocytes using sequential IMAC and titanium oxide enrichment." Carrascal M., Ovelleiro D., Casas V., Gay M., Abian J. J. Proteome Res. 7:5167-5176(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-5749 AND SER-5752, MASS SPECTROMETRY. Tissue: T-cell. |
| [11] | "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle." Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M. Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-41 AND SER-511, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [12] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-41; SER-93; SER-511; SER-570; SER-793; SER-4903; SER-4960; SER-4993; THR-5009; SER-5099; THR-5415; SER-5731; SER-5749; SER-5752; SER-5763; SER-5780; SER-5782; SER-5793; THR-5794; SER-5830 AND SER-5841, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [13] | "Large-scale phosphoproteome analysis of human liver tissue by enrichment and fractionation of phosphopeptides with strong anion exchange chromatography." Han G., Ye M., Zhou H., Jiang X., Feng S., Jiang X., Tian R., Wan D., Zou H., Gu J. Proteomics 8:1346-1361(2008) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. Tissue: Liver. |
| [14] | Carrascal M., Abian J. Submitted (JAN-2008) to UniProtKB Cited for: PHOSPHORYLATION AT SER-5749, MASS SPECTROMETRY. |
| [15] | "Large-scale proteomics analysis of the human kinome." Oppermann F.S., Gnad F., Olsen J.V., Hornberger R., Greff Z., Keri G., Mann M., Daub H. Mol. Cell. Proteomics 8:1751-1764(2009) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-511 AND SER-5752, MASS SPECTROMETRY. |
| [16] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-511; SER-570; SER-2397; SER-5448; SER-5731; SER-5749; SER-5752 AND SER-5763, MASS SPECTROMETRY. Tissue: Leukemic T-cell. |
| [17] | "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis." Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M. Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-41; SER-93; THR-101; SER-135; SER-177; SER-210; SER-212; SER-216; THR-490; SER-511; SER-559; SER-570; SER-793; SER-1068; THR-1192; SER-1286; THR-1986; THR-2181; THR-2309; SER-2397; SER-2670; SER-2798; THR-2832; THR-2845; SER-3054; SER-3409; SER-3412; SER-3426; THR-3716; SER-3836; SER-4092; THR-4100; SER-4220; THR-4430; SER-4516; SER-4684; SER-4812; SER-4960; SER-4986; SER-5077; SER-5099; SER-5110; SER-5125; SER-5332; SER-5386; SER-5400; SER-5448; SER-5552; SER-5620; SER-5731; SER-5739; SER-5752; SER-5763; SER-5780; SER-5782; SER-5790; THR-5824; SER-5830; SER-5841 AND SER-5857, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [18] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [19] | "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation." Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B. Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-93; SER-135; SER-177; THR-490; SER-511; SER-559; SER-5731 AND SER-5841, MASS SPECTROMETRY. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AP001363 Genomic DNA. No translation available. AP003064 Genomic DNA. No translation available. CH471076 Genomic DNA. Translation: EAW74019.1. BC128460 mRNA. Translation: AAI28461.1. M80899 mRNA. Translation: AAA69898.1. M80902 mRNA. Translation: AAA69899.1. Different initiation. | ||||||||||||||||||||||||
| IPI | IPI00021812. | ||||||||||||||||||||||||
| PIR | A45259. | ||||||||||||||||||||||||
| RefSeq | NP_001611.1. NM_001620.2. NP_076965.2. NM_024060.3. | ||||||||||||||||||||||||
| UniGene | Hs.502756. | ||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||
| ProteinModelPortal | Q09666. | ||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||
| IntAct | Q09666. 14 interactions. | ||||||||||||||||||||||||
| MINT | MINT-4998803. | ||||||||||||||||||||||||
| STRING | 9606.ENSP00000367263. | ||||||||||||||||||||||||
Protein family/group databases | |||||||||||||||||||||||||
| TCDB | 1.A.31.1.4. annexin family. | ||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||
| PhosphoSite | Q09666. | ||||||||||||||||||||||||
Polymorphism databases | |||||||||||||||||||||||||
| DMDM | 160332335. | ||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||
| PaxDb | Q09666. | ||||||||||||||||||||||||
| PeptideAtlas | Q09666. | ||||||||||||||||||||||||
| PRIDE | Q09666. | ||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||
| DNASU | 79026. | ||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||
| Ensembl | ENST00000257247; ENSP00000257247; ENSG00000124942. ENST00000378024; ENSP00000367263; ENSG00000124942. | ||||||||||||||||||||||||
| GeneID | 79026. | ||||||||||||||||||||||||
| KEGG | hsa:79026. | ||||||||||||||||||||||||
| UCSC | uc001ntl.3. human. | ||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||
| CTD | 79026. | ||||||||||||||||||||||||
| GeneCards | GC11M062202. | ||||||||||||||||||||||||
| H-InvDB | HIX0171266. HIX0171345. | ||||||||||||||||||||||||
| HGNC | HGNC:347. AHNAK. | ||||||||||||||||||||||||
| HPA | HPA019010. HPA019070. HPA026643. | ||||||||||||||||||||||||
| MIM | 103390. gene. | ||||||||||||||||||||||||
| neXtProt | NX_Q09666. | ||||||||||||||||||||||||
| PharmGKB | PA24640. | ||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||
| eggNOG | NOG12793. | ||||||||||||||||||||||||
| HOGENOM | HOG000033865. | ||||||||||||||||||||||||
| HOVERGEN | HBG104864. | ||||||||||||||||||||||||
| InParanoid | Q09666. | ||||||||||||||||||||||||
| OMA | WKGPKFK. | ||||||||||||||||||||||||
| OrthoDB | EOG4RFKTT. | ||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||
| ArrayExpress | Q09666. | ||||||||||||||||||||||||
| Bgee | Q09666. | ||||||||||||||||||||||||
| CleanEx | HS_AHNAK. | ||||||||||||||||||||||||
| Genevestigator | Q09666. | ||||||||||||||||||||||||
| GermOnline | ENSG00000124942. Homo sapiens. | ||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||
| InterPro | IPR001478. PDZ. [Graphical view] | ||||||||||||||||||||||||
| SMART | SM00228. PDZ. 1 hit. [Graphical view] | ||||||||||||||||||||||||
| SUPFAM | SSF50156. PDZ. 1 hit. | ||||||||||||||||||||||||
| PROSITE | PS50106. PDZ. 1 hit. [Graphical view] | ||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||
Other | |||||||||||||||||||||||||
| ChiTaRS | AHNAK. human. | ||||||||||||||||||||||||
| GenomeRNAi | 79026. | ||||||||||||||||||||||||
| NextBio | 67715. | ||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||
Entry information
| Entry name | AHNK_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q09666 Secondary accession number(s): A1A586 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 11 Human chromosome 11: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
