Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q09666

- AHNK_HUMAN

UniProt

Q09666 - AHNK_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Neuroblast differentiation-associated protein AHNAK

Gene

AHNAK

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

May be required for neuronal cell differentiation.

GO - Molecular functioni

  1. poly(A) RNA binding Source: UniProtKB
  2. S100 protein binding Source: UniProt
  3. structural molecule activity conferring elasticity Source: UniProt

GO - Biological processi

  1. protein oligomerization Source: UniProt
  2. regulation of RNA splicing Source: UniProt
  3. regulation of voltage-gated calcium channel activity Source: UniProt
Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
Neuroblast differentiation-associated protein AHNAK
Alternative name(s):
Desmoyokin
Gene namesi
Name:AHNAK
Synonyms:PM227
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 11

Organism-specific databases

HGNCiHGNC:347. AHNAK.

Subcellular locationi

GO - Cellular componenti

  1. actin cytoskeleton Source: UniProt
  2. cell-cell contact zone Source: UniProt
  3. costamere Source: UniProt
  4. cytoplasm Source: UniProt
  5. cytosol Source: UniProt
  6. extracellular vesicular exosome Source: UniProt
  7. focal adhesion Source: UniProtKB
  8. lysosomal membrane Source: UniProtKB
  9. membrane Source: UniProtKB
  10. nucleus Source: UniProtKB
  11. plasma membrane Source: UniProt
  12. sarcolemma Source: UniProt
  13. T-tubule Source: UniProt
  14. vesicle Source: UniProt
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA24640.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 58905890Neuroblast differentiation-associated protein AHNAKPRO_0000064504Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei1 – 11N-acetylmethionine1 Publication
Modified residuei41 – 411Phosphoserine5 Publications
Modified residuei93 – 931Phosphoserine4 Publications
Modified residuei101 – 1011Phosphothreonine1 Publication
Modified residuei135 – 1351Phosphoserine2 Publications
Modified residuei177 – 1771Phosphoserine2 Publications
Modified residuei210 – 2101Phosphoserine1 Publication
Modified residuei212 – 2121Phosphoserine1 Publication
Modified residuei216 – 2161Phosphoserine1 Publication
Modified residuei490 – 4901Phosphothreonine4 Publications
Modified residuei511 – 5111Phosphoserine9 Publications
Modified residuei559 – 5591Phosphoserine2 Publications
Modified residuei570 – 5701Phosphoserine3 Publications
Modified residuei793 – 7931Phosphoserine2 Publications
Modified residuei1068 – 10681Phosphoserine1 Publication
Modified residuei1192 – 11921Phosphothreonine1 Publication
Modified residuei1286 – 12861Phosphoserine1 Publication
Modified residuei1986 – 19861Phosphothreonine1 Publication
Modified residuei2181 – 21811Phosphothreonine1 Publication
Modified residuei2309 – 23091Phosphothreonine1 Publication
Modified residuei2397 – 23971Phosphoserine2 Publications
Modified residuei2670 – 26701Phosphoserine1 Publication
Modified residuei2798 – 27981Phosphoserine1 Publication
Modified residuei2832 – 28321Phosphothreonine1 Publication
Modified residuei2845 – 28451Phosphothreonine1 Publication
Modified residuei3054 – 30541Phosphoserine1 Publication
Modified residuei3409 – 34091Phosphoserine1 Publication
Modified residuei3412 – 34121Phosphoserine1 Publication
Modified residuei3426 – 34261Phosphoserine1 Publication
Modified residuei3716 – 37161Phosphothreonine1 Publication
Modified residuei3836 – 38361Phosphoserine1 Publication
Modified residuei4092 – 40921Phosphoserine1 Publication
Modified residuei4100 – 41001Phosphothreonine2 Publications
Modified residuei4220 – 42201Phosphoserine1 Publication
Modified residuei4430 – 44301Phosphothreonine1 Publication
Modified residuei4516 – 45161Phosphoserine1 Publication
Modified residuei4684 – 46841Phosphoserine1 Publication
Modified residuei4766 – 47661Phosphothreonine1 Publication
Modified residuei4812 – 48121Phosphoserine1 Publication
Modified residuei4903 – 49031Phosphoserine1 Publication
Modified residuei4960 – 49601Phosphoserine2 Publications
Modified residuei4986 – 49861Phosphoserine2 Publications
Modified residuei4993 – 49931Phosphoserine1 Publication
Modified residuei5009 – 50091Phosphothreonine1 Publication
Modified residuei5077 – 50771Phosphoserine2 Publications
Modified residuei5099 – 50991Phosphoserine3 Publications
Modified residuei5110 – 51101Phosphoserine3 Publications
Modified residuei5125 – 51251Phosphoserine1 Publication
Modified residuei5332 – 53321Phosphoserine1 Publication
Modified residuei5386 – 53861Phosphoserine1 Publication
Modified residuei5400 – 54001Phosphoserine1 Publication
Modified residuei5415 – 54151Phosphothreonine1 Publication
Modified residuei5448 – 54481Phosphoserine3 Publications
Modified residuei5552 – 55521Phosphoserine3 Publications
Modified residuei5620 – 56201Phosphoserine1 Publication
Modified residuei5731 – 57311Phosphoserine5 Publications
Modified residuei5739 – 57391Phosphoserine1 Publication
Modified residuei5749 – 57491Phosphoserine3 Publications
Modified residuei5752 – 57521Phosphoserine6 Publications
Modified residuei5763 – 57631Phosphoserine4 Publications
Modified residuei5780 – 57801Phosphoserine2 Publications
Modified residuei5782 – 57821Phosphoserine2 Publications
Modified residuei5790 – 57901Phosphoserine1 Publication
Modified residuei5793 – 57931Phosphoserine1 Publication
Modified residuei5794 – 57941Phosphothreonine1 Publication
Modified residuei5824 – 58241Phosphothreonine1 Publication
Modified residuei5830 – 58301Phosphoserine2 Publications
Modified residuei5841 – 58411Phosphoserine3 Publications
Modified residuei5857 – 58571Phosphoserine1 Publication

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

MaxQBiQ09666.
PaxDbiQ09666.
PeptideAtlasiQ09666.
PRIDEiQ09666.

PTM databases

PhosphoSiteiQ09666.

Expressioni

Gene expression databases

BgeeiQ09666.
CleanExiHS_AHNAK.
ExpressionAtlasiQ09666. baseline and differential.
GenevestigatoriQ09666.

Organism-specific databases

HPAiHPA019010.
HPA019070.
HPA026643.

Interactioni

Subunit structurei

Interacts with DYSF; the interaction is direct and Ca2+-independent.1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
EGFRP005333EBI-2555881,EBI-297353

Protein-protein interaction databases

BioGridi122494. 31 interactions.
IntActiQ09666. 23 interactions.
MINTiMINT-4998803.
STRINGi9606.ENSP00000367263.

Structurei

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
4DRWX-ray3.50E/F5654-5673[»]
4FTGX-ray2.51E5654-5673[»]
4HRGX-ray2.00C/D5655-5668[»]
ProteinModelPortaliQ09666.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini9 – 9082PDZPROSITE-ProRule annotationAdd
BLAST

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi4971 – 49799Nuclear localization signalSequence Analysis
Motifi5019 – 50279Nuclear localization signalSequence Analysis
Motifi5034 – 50396Nuclear localization signalSequence Analysis
Motifi5706 – 571611Nuclear localization signalSequence AnalysisAdd
BLAST
Motifi5772 – 57798Nuclear localization signalSequence Analysis

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi5458 – 5654197Gly-richAdd
BLAST

Sequence similaritiesi

Contains 1 PDZ (DHR) domain.PROSITE-ProRule annotation

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiNOG12793.
GeneTreeiENSGT00530000063716.
HOGENOMiHOG000033865.
HOVERGENiHBG104864.
InParanoidiQ09666.
OMAiVASFHRD.
OrthoDBiEOG7BCNB3.
PhylomeDBiQ09666.
TreeFamiTF350595.

Family and domain databases

Gene3Di2.30.42.10. 1 hit.
InterProiIPR001478. PDZ.
[Graphical view]
SMARTiSM00228. PDZ. 1 hit.
[Graphical view]
SUPFAMiSSF50156. SSF50156. 1 hit.
PROSITEiPS50106. PDZ. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q09666-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEKEETTREL LLPNWQGSGS HGLTIAQRDD GVFVQEVTQN SPAARTGVVK
60 70 80 90 100
EGDQIVGATI YFDNLQSGEV TQLLNTMGHH TVGLKLHRKG DRSPEPGQTW
110 120 130 140 150
TREVFSSCSS EVVLSGDDEE YQRIYTTKIK PRLKSEDGVE GDLGETQSRT
160 170 180 190 200
ITVTRRVTAY TVDVTGREGA KDIDISSPEF KIKIPRHELT EISNVDVETQ
210 220 230 240 250
SGKTVIRLPS GSGAASPTGS AVDIRAGAIS ASGPELQGAG HSKLQVTMPG
260 270 280 290 300
IKVGGSGVNV NAKGLDLGGR GGVQVPAVDI SSSLGGRAVE VQGPSLESGD
310 320 330 340 350
HGKIKFPTMK VPKFGVSTGR EGQTPKAGLR VSAPEVSVGH KGGKPGLTIQ
360 370 380 390 400
APQLEVSVPS ANIEGLEGKL KGPQITGPSL EGDLGLKGAK PQGHIGVDAS
410 420 430 440 450
APQIGGSITG PSVEVQAPDI DVQGPGSKLN VPKMKVPKFS VSGAKGEETG
460 470 480 490 500
IDVTLPTGEV TVPGVSGDVS LPEIATGGLE GKMKGTKVKT PEMIIQKPKI
510 520 530 540 550
SMQDVDLSLG SPKLKGDIKV SAPGVQGDVK GPQVALKGSR VDIETPNLEG
560 570 580 590 600
TLTGPRLGSP SGKTGTCRIS MSEVDLNVAA PKVKGGVDVT LPRVEGKVKV
610 620 630 640 650
PEVDVRGPKV DVSAPDVEAH GPEWNLKMPK MKMPTFSTPG AKGEGPDVHM
660 670 680 690 700
TLPKGDISIS GPKVNVEAPD VNLEGLGGKL KGPDVKLPDM SVKTPKISMP
710 720 730 740 750
DVDLHVKGTK VKGEYDVTVP KLEGELKGPK VDIDAPDVDV HGPDWHLKMP
760 770 780 790 800
KMKMPKFSVP GFKAEGPEVD VNLPKADVDI SGPKIDVTAP DVSIEEPEGK
810 820 830 840 850
LKGPKFKMPE MNIKVPKISM PDVDLHLKGP NVKGEYDVTM PKVESEIKVP
860 870 880 890 900
DVELKSAKMD IDVPDVEVQG PDWHLKMPKM KMPKFSMPGF KAEGPEVDVN
910 920 930 940 950
LPKADVDISG PKVGVEVPDV NIEGPEGKLK GPKFKMPEMN IKAPKISMPD
960 970 980 990 1000
VDLHMKGPKV KGEYDMTVPK LEGDLKGPKV DVSAPDVEMQ GPDWNLKMPK
1010 1020 1030 1040 1050
IKMPKFSMPS LKGEGPEFDV NLSKANVDIS APKVDTNAPD LSLEGPEGKL
1060 1070 1080 1090 1100
KGPKFKMPEM HFRAPKMSLP DVDLDLKGPK MKGNVDISAP KIEGEMQVPD
1110 1120 1130 1140 1150
VDIRGPKVDI KAPDVEGQGL DWSLKIPKMK MPKFSMPSLK GEGPEVDVNL
1160 1170 1180 1190 1200
PKADVVVSGP KVDIEAPDVS LEGPEGKLKG PKFKMPEMHF KTPKISMPDV
1210 1220 1230 1240 1250
DLHLKGPKVK GDVDVSVPKV EGEMKVPDVE IKGPKMDIDA PDVEVQGPDW
1260 1270 1280 1290 1300
HLKMPKMKMP KFSMPGFKGE GREVDVNLPK ADIDVSGPKV DVEVPDVSLE
1310 1320 1330 1340 1350
GPEGKLKGPK FKMPEMHFKA PKISMPDVDL NLKGPKLKGD VDVSLPEVEG
1360 1370 1380 1390 1400
EMKVPDVDIK GPKVDISAPD VDVHGPDWHL KMPKVKMPKF SMPGFKGEGP
1410 1420 1430 1440 1450
EVDVKLPKAD VDVSGPKMDA EVPDVNIEGP DAKLKGPKFK MPEMSIKPQK
1460 1470 1480 1490 1500
ISIPDVGLHL KGPKMKGDYD VTVPKVEGEI KAPDVDIKGP KVDINAPDVE
1510 1520 1530 1540 1550
VHGPDWHLKM PKVKMPKFSM PGFKGEGPEV DMNLPKADLG VSGPKVDIDV
1560 1570 1580 1590 1600
PDVNLEAPEG KLKGPKFKMP SMNIQTHKIS MPDVGLNLKA PKLKTDVDVS
1610 1620 1630 1640 1650
LPKVEGDLKG PEIDVKAPKM DVNVGDIDIE GPEGKLKGPK FKMPEMHFKA
1660 1670 1680 1690 1700
PKISMPDVDL HLKGPKVKGD MDVSVPKVEG EMKVPDVDIK GPKVDIDAPD
1710 1720 1730 1740 1750
VEVHDPDWHL KMPKMKMPKF SMPGFKAEGP EVDVNLPKAD IDVSGPSVDT
1760 1770 1780 1790 1800
DAPDLDIEGP EGKLKGSKFK MPKLNIKAPK VSMPDVDLNL KGPKLKGEID
1810 1820 1830 1840 1850
ASVPELEGDL RGPQVDVKGP FVEAEVPDVD LECPDAKLKG PKFKMPEMHF
1860 1870 1880 1890 1900
KAPKISMPDV DLHLKGPKVK GDADVSVPKL EGDLTGPSVG VEVPDVELEC
1910 1920 1930 1940 1950
PDAKLKGPKF KMPDMHFKAP KISMPDVDLH LKGPKVKGDV DVSVPKLEGD
1960 1970 1980 1990 2000
LTGPSVGVEV PDVELECPDA KLKGPKFKMP EMHFKTPKIS MPDVDLHLKG
2010 2020 2030 2040 2050
PKVKGDMDVS VPKVEGEMKV PDVDIKGPKM DIDAPDVDVH GPDWHLKMPK
2060 2070 2080 2090 2100
MKMPKFSMPG FKAEGPEVDV NLPKADVVVS GPKVDVEVPD VSLEGPEGKL
2110 2120 2130 2140 2150
KGPKLKMPEM HFKAPKISMP DVDLHLKGPK VKGDVDVSLP KLEGDLTGPS
2160 2170 2180 2190 2200
VDVEVPDVEL ECPDAKLKGP KFKMPEMHFK TPKISMPDVN LNLKGPKVKG
2210 2220 2230 2240 2250
DMDVSVPKVE GEMKVPDVDI RGPKVDIDAP DVDVHGPDWH LKMPKMKMPK
2260 2270 2280 2290 2300
FSMPGFKGEG PEVDVNLPKA DVDVSGPKVD VEVPDVSLEG PEGKLKGPKF
2310 2320 2330 2340 2350
KMPEMHFKTP KISMPDVDFN LKGPKIKGDV DVSAPKLEGE LKGPELDVKG
2360 2370 2380 2390 2400
PKLDADMPEV AVEGPNGKWK TPKFKMPDMH FKAPKISMPD LDLHLKSPKA
2410 2420 2430 2440 2450
KGEVDVDVPK LEGDLKGPHV DVSGPDIDIE GPEGKLKGPK FKMPDMHFKA
2460 2470 2480 2490 2500
PNISMPDVDL NLKGPKIKGD VDVSVPEVEG KLEVPDMNIR GPKVDVNAPD
2510 2520 2530 2540 2550
VQAPDWHLKM PKMKMPKFSM PGFKAEGPEV DVNLPKADVD ISGPKVDIEG
2560 2570 2580 2590 2600
PDVNIEGPEG KLKGPKLKMP EMNIKAPKIS MPDFDLHLKG PKVKGDVDVS
2610 2620 2630 2640 2650
LPKVEGDLKG PEVDIKGPKV DINAPDVGVQ GPDWHLKMPK VKMPKFSMPG
2660 2670 2680 2690 2700
FKGEGPDGDV KLPKADIDVS GPKVDIEGPD VNIEGPEGKL KGPKFKMPEM
2710 2720 2730 2740 2750
NIKAPKISMP DIDLNLKGPK VKGDVDVSLP KVEGDLKGPE VDIKGPKVDI
2760 2770 2780 2790 2800
DAPDVDVHGP DWHLKMPKIK MPKISMPGFK GEGPDVDVNL PKADIDVSGP
2810 2820 2830 2840 2850
KVDVECPDVN IEGPEGKWKS PKFKMPEMHF KTPKISMPDI DLNLTGPKIK
2860 2870 2880 2890 2900
GDVDVTGPKV EGDLKGPEVD LKGPKVDIDV PDVNVQGPDW HLKMPKMKMP
2910 2920 2930 2940 2950
KFSMPGFKAE GPEVDVNLPK ADVDVSGPKV DVEGPDVNIE GPEGKLKGPK
2960 2970 2980 2990 3000
FKMPEMNIKA PKIPMPDFDL HLKGPKVKGD VDISLPKVEG DLKGPEVDIR
3010 3020 3030 3040 3050
GPQVDIDVPD VGVQGPDWHL KMPKVKMPKF SMPGFKGEGP DVDVNLPKAD
3060 3070 3080 3090 3100
LDVSGPKVDI DVPDVNIEGP EGKLKGPKFK MPEMNIKAPK ISMPDIDLNL
3110 3120 3130 3140 3150
KGPKVKGDMD VSLPKVEGDM KVPDVDIKGP KVDINAPDVD VQGPDWHLKM
3160 3170 3180 3190 3200
PKIKMPKISM PGFKGEGPEV DVNLPKADLD VSGPKVDVDV PDVNIEGPDA
3210 3220 3230 3240 3250
KLKGPKFKMP EMNIKAPKIS MPDLDLNLKG PKMKGEVDVS LANVEGDLKG
3260 3270 3280 3290 3300
PALDIKGPKI DVDAPDIDIH GPDAKLKGPK LKMPDMHVNM PKISMPEIDL
3310 3320 3330 3340 3350
NLKGSKLKGD VDVSGPKLEG DIKAPSLDIK GPEVDVSGPK LNIEGKSKKS
3360 3370 3380 3390 3400
RFKLPKFNFS GSKVQTPEVD VKGKKPDIDI TGPKVDINAP DVEVQGKVKG
3410 3420 3430 3440 3450
SKFKMPFLSI SSPKVSMPDV ELNLKSPKVK GDLDIAGPNL EGDFKGPKVD
3460 3470 3480 3490 3500
IKAPEVNLNA PDVDVHGPDW NLKMPKMKMP KFSVSGLKAE GPDVAVDLPK
3510 3520 3530 3540 3550
GDINIEGPSM NIEGPDLNVE GPEGGLKGPK FKMPDMNIKA PKISMPDIDL
3560 3570 3580 3590 3600
NLKGPKVKGD VDISLPKLEG DLKGPEVDIK GPKVDINAPD VDVHGPDWHL
3610 3620 3630 3640 3650
KMPKVKMPKF SMPGFKGEGP EVDVTLPKAD IDISGPNVDV DVPDVNIEGP
3660 3670 3680 3690 3700
DAKLKGPKFK MPEMNIKAPK ISMPDFDLNL KGPKMKGDVV VSLPKVEGDL
3710 3720 3730 3740 3750
KGPEVDIKGP KVDIDTPDIN IEGSEGKFKG PKFKIPEMHL KAPKISMPDI
3760 3770 3780 3790 3800
DLNLKGPKVK GDVDVSLPKM EGDLKGPEVD IKGPKVDINA PDVDVQGPDW
3810 3820 3830 3840 3850
HLKMPKVKMP KFSMPGFKGE GPDVDVNLPK ADLDVSGPKV DIDVPDVNIE
3860 3870 3880 3890 3900
GPEGKLKGPK FKMPEMNIKA PKISMPDIDL NLKGPKVKGD MDVSLPKVEG
3910 3920 3930 3940 3950
DMQVPDLDIK GPKVDINAPD VDVRGPDWHL KMPKIKMPKI SMPGFKGEGP
3960 3970 3980 3990 4000
EVDVNLPKAD LDVSGPKVDV DVPDVNIEGP DAKLKGPKFK MPEMNIKAPK
4010 4020 4030 4040 4050
ISMPDFDLHL KGPKVKGDVD VSLPKMEGDL KAPEVDIKGP KVDIDAPDVD
4060 4070 4080 4090 4100
VHGPDWHLKM PKVKMPKFSM PGFKGEGPEV DVNLPKADID VSGPKVDIDT
4110 4120 4130 4140 4150
PDIDIHGPEG KLKGPKFKMP DLHLKAPKIS MPEVDLNLKG PKMKGDVDVS
4160 4170 4180 4190 4200
LPKVEGDLKG PEVDIKGPKV DIDVPDVDVQ GPDWHLKMPK VKMPKFSMPG
4210 4220 4230 4240 4250
FKGEGPDVDV NLPKADLDVS GPKVDIDVPD VNIEGPDAKL KGPKFKMPEM
4260 4270 4280 4290 4300
NIKAPKISMP DFDLHLKGPK VKGDVDVSLP KVEGDLKGPE VDIKGPKVDI
4310 4320 4330 4340 4350
DAPDVDVHGP DWHLKMPKVK MPKFSMPGFK GEGPDVDVTL PKADIEISGP
4360 4370 4380 4390 4400
KVDIDAPDVS IEGPDAKLKG PKFKMPEMNI KAPKISMPDI DFNLKGPKVK
4410 4420 4430 4440 4450
GDVDVSLPKV EGDLKGPEID IKGPSLDIDT PDVNIEGPEG KLKGPKFKMP
4460 4470 4480 4490 4500
EMNIKAPKIS MPDFDLHLKG PKVKGDVDVS LPKVESDLKG PEVDIEGPEG
4510 4520 4530 4540 4550
KLKGPKFKMP DVHFKSPQIS MSDIDLNLKG PKIKGDMDIS VPKLEGDLKG
4560 4570 4580 4590 4600
PKVDVKGPKV GIDTPDIDIH GPEGKLKGPK FKMPDLHLKA PKISMPEVDL
4610 4620 4630 4640 4650
NLKGPKVKGD MDISLPKVEG DLKGPEVDIR DPKVDIDVPD VDVQGPDWHL
4660 4670 4680 4690 4700
KMPKVKMPKF SMPGFKGEGP DVDVNLPKAD IDVSGPKVDV DVPDVNIEGP
4710 4720 4730 4740 4750
DAKLKGPKFK MPEMSIKAPK ISMPDIDLNL KGPKVKGDVD VTLPKVEGDL
4760 4770 4780 4790 4800
KGPEADIKGP KVDINTPDVD VHGPDWHLKM PKVKMPKFSM PGFKGEGPDV
4810 4820 4830 4840 4850
DVSLPKADID VSGPKVDVDI PDVNIEGPDA KLKGPKFKMP EINIKAPKIS
4860 4870 4880 4890 4900
IPDVDLDLKG PKVKGDFDVS VPKVEGTLKG PEVDLKGPRL DFEGPDAKLS
4910 4920 4930 4940 4950
GPSLKMPSLE ISAPKVTAPD VDLHLKAPKI GFSGPKLEGG EVDLKGPKVE
4960 4970 4980 4990 5000
APSLDVHMDS PDINIEGPDV KIPKFKKPKF GFGAKSPKAD IKSPSLDVTV
5010 5020 5030 5040 5050
PEAELNLETP EISVGGKGKK SKFKMPKIHM SGPKIKAKKQ GFDLNVPGGE
5060 5070 5080 5090 5100
IDASLKAPDV DVNIAGPDAA LKVDVKSPKT KKTMFGKMYF PDVEFDIKSP
5110 5120 5130 5140 5150
KFKAEAPLPS PKLEGELQAP DLELSLPAIH VEGLDIKAKA PKVKMPDVDI
5160 5170 5180 5190 5200
SVPKIEGDLK GPKVQANLGA PDINIEGLDA KVKTPSFGIS APQVSIPDVN
5210 5220 5230 5240 5250
VNLKGPKIKG DVPSVGLEGP DVDLQGPEAK IKFPKFSMPK IGIPGVKMEG
5260 5270 5280 5290 5300
GGAEVHAQLP SLEGDLRGPD VKLEGPDVSL KGPGVDLPSV NLSMPKVSGP
5310 5320 5330 5340 5350
DLDLNLKGPS LKGDLDASVP SMKVHAPGLN LSGVGGKMQV GGDGVKVPGI
5360 5370 5380 5390 5400
DATTKLNVGA PDVTLRGPSL QGDLAVSGDI KCPKVSVGAP DLSLEASEGS
5410 5420 5430 5440 5450
IKLPKMKLPQ FGISTPGSDL HVNAKGPQVS GELKGPGVDV NLKGPRISAP
5460 5470 5480 5490 5500
NVDFNLEGPK VKGSLGATGE IKGPTVGGGL PGIGVQGLEG NLQMPGIKSS
5510 5520 5530 5540 5550
GCDVNLPGVN VKLPTGQISG PEIKGGLKGS EVGFHGAAPD ISVKGPAFNM
5560 5570 5580 5590 5600
ASPESDFGIN LKGPKIKGGA DVSGGVSAPD ISLGEGHLSV KGSGGEWKGP
5610 5620 5630 5640 5650
QVSSALNLDT SKFAGGLHFS GPKVEGGVKG GQIGLQAPGL SVSGPQGHLE
5660 5670 5680 5690 5700
SGSGKVTFPK MKIPKFTFSG RELVGREMGV DVHFPKAEAS IQAGAGDGEW
5710 5720 5730 5740 5750
EESEVKLKKS KIKMPKFNFS KPKGKGGVTG SPEASISGSK GDLKSSKASL
5760 5770 5780 5790 5800
GSLEGEAEAE ASSPKGKFSL FKSKKPRHRS NSFSDEREFS GPSTPTGTLE
5810 5820 5830 5840 5850
FEGGEVSLEG GKVKGKHGKL KFGTFGGLGS KSKGHYEVTG SDDETGKLQG
5860 5870 5880 5890
SGVSLASKKS RLSSSSSNDS GNKVGIQLPE VELSVSTKKE
Length:5,890
Mass (Da):629,101
Last modified:November 13, 2007 - v2
Checksum:iA82FC9645FDCA8DC
GO
Isoform 2 (identifier: Q09666-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     115-149: SGDDEEYQRIYTTKIKPRLKSEDGVEGDLGETQSR → NTPQPSALECKDQNKQKEASSQAGAVSVSTPNAGL
     150-5890: Missing.

Show »
Length:149
Mass (Da):16,061
Checksum:i4CB0471C1B60F60D
GO

Sequence cautioni

The sequence AAA69899.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti288 – 2881A → P in AAA69899. (PubMed:1608957)Curated
Sequence conflicti302 – 3021G → A in AAA69899. (PubMed:1608957)Curated
Sequence conflicti1156 – 11561V → D in AAA69899. (PubMed:1608957)Curated
Sequence conflicti1737 – 17371P → R in AAA69899. (PubMed:1608957)Curated
Sequence conflicti1821 – 18211F → L in AAA69899. (PubMed:1608957)Curated
Sequence conflicti4614 – 46141S → T in AAA69898. (PubMed:1608957)Curated
Sequence conflicti4627 – 46271V → A in AAA69898. (PubMed:1608957)Curated
Sequence conflicti4630 – 46312RD → KG in AAA69898. (PubMed:1608957)Curated
Sequence conflicti4637 – 46382DV → NT in AAA69898. (PubMed:1608957)Curated
Sequence conflicti4644 – 46441Q → H in AAA69898. (PubMed:1608957)Curated
Sequence conflicti4830 – 48301A → P in AAA69898. (PubMed:1608957)Curated
Sequence conflicti4834 – 48341G → V in AAA69898. (PubMed:1608957)Curated
Sequence conflicti4837 – 48371F → V in AAA69898. (PubMed:1608957)Curated
Sequence conflicti4984 – 49841A → P in AAA69898. (PubMed:1608957)Curated
Sequence conflicti5445 – 54451P → S in AAA69898. (PubMed:1608957)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti962 – 9621G → V.
Corresponds to variant rs664761 [ dbSNP | Ensembl ].
VAR_039058
Natural varianti2114 – 21141A → T.
Corresponds to variant rs1298288 [ dbSNP | Ensembl ].
VAR_039059
Natural varianti2247 – 22471K → T.
Corresponds to variant rs61524789 [ dbSNP | Ensembl ].
VAR_061551
Natural varianti2439 – 24391P → L.
Corresponds to variant rs11824660 [ dbSNP | Ensembl ].
VAR_039060
Natural varianti3003 – 30031Q → K.
Corresponds to variant rs566144 [ dbSNP | Ensembl ].
VAR_039061
Natural varianti3190 – 31901V → I.
Corresponds to variant rs11231129 [ dbSNP | Ensembl ].
VAR_039062
Natural varianti3724 – 37241S → P.
Corresponds to variant rs11231128 [ dbSNP | Ensembl ].
VAR_039063
Natural varianti4304 – 43041D → G.
Corresponds to variant rs11828907 [ dbSNP | Ensembl ].
VAR_061552
Natural varianti4561 – 45611G → D.
Corresponds to variant rs12795508 [ dbSNP | Ensembl ].
VAR_039064
Natural varianti4611 – 46111M → V.
Corresponds to variant rs12801302 [ dbSNP | Ensembl ].
VAR_039065
Natural varianti4613 – 46131I → V.
Corresponds to variant rs12801153 [ dbSNP | Ensembl ].
VAR_039066
Natural varianti4631 – 46311D → G.
Corresponds to variant rs12801123 [ dbSNP | Ensembl ].
VAR_039067
Natural varianti5415 – 54151T → A.
Corresponds to variant rs11231126 [ dbSNP | Ensembl ].
VAR_039068

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei115 – 14935SGDDE…ETQSR → NTPQPSALECKDQNKQKEAS SQAGAVSVSTPNAGL in isoform 2. 1 PublicationVSP_044233Add
BLAST
Alternative sequencei150 – 58905741Missing in isoform 2. 1 PublicationVSP_044234Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AP001363 Genomic DNA. No translation available.
AP003064 Genomic DNA. No translation available.
CH471076 Genomic DNA. Translation: EAW74019.1.
BC128460 mRNA. Translation: AAI28461.1.
M80899 mRNA. Translation: AAA69898.1.
M80902 mRNA. Translation: AAA69899.1. Different initiation.
CCDSiCCDS31584.1. [Q09666-1]
CCDS44625.1. [Q09666-2]
PIRiA45259.
RefSeqiNP_001611.1. NM_001620.2. [Q09666-1]
NP_076965.2. NM_024060.3. [Q09666-2]
XP_005274297.1. XM_005274240.1. [Q09666-1]
XP_005274298.1. XM_005274241.1. [Q09666-1]
UniGeneiHs.502756.

Genome annotation databases

EnsembliENST00000257247; ENSP00000257247; ENSG00000124942. [Q09666-2]
ENST00000378024; ENSP00000367263; ENSG00000124942. [Q09666-1]
GeneIDi79026.
KEGGihsa:79026.
UCSCiuc001ntk.2. human. [Q09666-2]
uc001ntl.3. human. [Q09666-1]

Polymorphism databases

DMDMi160332335.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AP001363 Genomic DNA. No translation available.
AP003064 Genomic DNA. No translation available.
CH471076 Genomic DNA. Translation: EAW74019.1 .
BC128460 mRNA. Translation: AAI28461.1 .
M80899 mRNA. Translation: AAA69898.1 .
M80902 mRNA. Translation: AAA69899.1 . Different initiation.
CCDSi CCDS31584.1. [Q09666-1 ]
CCDS44625.1. [Q09666-2 ]
PIRi A45259.
RefSeqi NP_001611.1. NM_001620.2. [Q09666-1 ]
NP_076965.2. NM_024060.3. [Q09666-2 ]
XP_005274297.1. XM_005274240.1. [Q09666-1 ]
XP_005274298.1. XM_005274241.1. [Q09666-1 ]
UniGenei Hs.502756.

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
4DRW X-ray 3.50 E/F 5654-5673 [» ]
4FTG X-ray 2.51 E 5654-5673 [» ]
4HRG X-ray 2.00 C/D 5655-5668 [» ]
ProteinModelPortali Q09666.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 122494. 31 interactions.
IntActi Q09666. 23 interactions.
MINTi MINT-4998803.
STRINGi 9606.ENSP00000367263.

PTM databases

PhosphoSitei Q09666.

Polymorphism databases

DMDMi 160332335.

Proteomic databases

MaxQBi Q09666.
PaxDbi Q09666.
PeptideAtlasi Q09666.
PRIDEi Q09666.

Protocols and materials databases

DNASUi 79026.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000257247 ; ENSP00000257247 ; ENSG00000124942 . [Q09666-2 ]
ENST00000378024 ; ENSP00000367263 ; ENSG00000124942 . [Q09666-1 ]
GeneIDi 79026.
KEGGi hsa:79026.
UCSCi uc001ntk.2. human. [Q09666-2 ]
uc001ntl.3. human. [Q09666-1 ]

Organism-specific databases

CTDi 79026.
GeneCardsi GC11M062202.
H-InvDB HIX0171266.
HIX0171345.
HGNCi HGNC:347. AHNAK.
HPAi HPA019010.
HPA019070.
HPA026643.
MIMi 103390. gene.
neXtProti NX_Q09666.
PharmGKBi PA24640.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG12793.
GeneTreei ENSGT00530000063716.
HOGENOMi HOG000033865.
HOVERGENi HBG104864.
InParanoidi Q09666.
OMAi VASFHRD.
OrthoDBi EOG7BCNB3.
PhylomeDBi Q09666.
TreeFami TF350595.

Miscellaneous databases

ChiTaRSi AHNAK. human.
GeneWikii AHNAK.
GenomeRNAii 79026.
NextBioi 67715.
PROi Q09666.
SOURCEi Search...

Gene expression databases

Bgeei Q09666.
CleanExi HS_AHNAK.
ExpressionAtlasi Q09666. baseline and differential.
Genevestigatori Q09666.

Family and domain databases

Gene3Di 2.30.42.10. 1 hit.
InterProi IPR001478. PDZ.
[Graphical view ]
SMARTi SM00228. PDZ. 1 hit.
[Graphical view ]
SUPFAMi SSF50156. SSF50156. 1 hit.
PROSITEi PS50106. PDZ. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
  4. "A human gene (AHNAK) encoding an unusually large protein with a 1.2-microns polyionic rod structure."
    Shtivelman E., Cohen F.E., Bishop J.M.
    Proc. Natl. Acad. Sci. U.S.A. 89:5472-5476(1992) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 114-1930 (ISOFORM 1), NUCLEOTIDE SEQUENCE [MRNA] OF 4614-5890 (ISOFORM 1).
    Tissue: Placenta.
  5. Erratum
    Shtivelman E., Cohen F.E., Bishop J.M.
    Proc. Natl. Acad. Sci. U.S.A. 90:4328-4328(1993)
  6. "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks."
    Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M.
    Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-41; SER-93; THR-490; SER-511; THR-4100; THR-4766; SER-5077; SER-5110; SER-5448; SER-5552 AND SER-5752, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  7. "A probability-based approach for high-throughput protein phosphorylation analysis and site localization."
    Beausoleil S.A., Villen J., Gerber S.A., Rush J., Gygi S.P.
    Nat. Biotechnol. 24:1285-1292(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-41; SER-511; SER-5731 AND SER-5763, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  8. "AHNAK, a novel component of the dysferlin protein complex, redistributes to the cytoplasm with dysferlin during skeletal muscle regeneration."
    Huang Y., Laval S.H., van Remoortere A., Baudier J., Benaud C., Anderson L.V., Straub V., Deelder A., Frants R.R., den Dunnen J.T., Bushby K., van der Maarel S.M.
    FASEB J. 21:732-742(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH DYSF.
  9. "Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra."
    Yu L.R., Zhu Z., Chan K.C., Issaq H.J., Dimitrov D.S., Veenstra T.D.
    J. Proteome Res. 6:4150-4162(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-490; SER-511; SER-4986; SER-5099; SER-5110 AND SER-5552, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  10. "Phosphorylation analysis of primary human T lymphocytes using sequential IMAC and titanium oxide enrichment."
    Carrascal M., Ovelleiro D., Casas V., Gay M., Abian J.
    J. Proteome Res. 7:5167-5176(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-5749 AND SER-5752, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: T-cell.
  11. "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle."
    Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M.
    Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-41 AND SER-511, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  12. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-41; SER-93; SER-511; SER-570; SER-793; SER-4903; SER-4960; SER-4993; THR-5009; SER-5099; THR-5415; SER-5731; SER-5749; SER-5752; SER-5763; SER-5780; SER-5782; SER-5793; THR-5794; SER-5830 AND SER-5841, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  13. "Large-scale phosphoproteome analysis of human liver tissue by enrichment and fractionation of phosphopeptides with strong anion exchange chromatography."
    Han G., Ye M., Zhou H., Jiang X., Feng S., Jiang X., Tian R., Wan D., Zou H., Gu J.
    Proteomics 8:1346-1361(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Liver.
  14. "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
    Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
    Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  15. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-511 AND SER-5752, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  16. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
    Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
    Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-511; SER-570; SER-2397; SER-5448; SER-5731; SER-5749; SER-5752 AND SER-5763, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Leukemic T-cell.
  17. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
    Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
    Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-41; SER-93; THR-101; SER-135; SER-177; SER-210; SER-212; SER-216; THR-490; SER-511; SER-559; SER-570; SER-793; SER-1068; THR-1192; SER-1286; THR-1986; THR-2181; THR-2309; SER-2397; SER-2670; SER-2798; THR-2832; THR-2845; SER-3054; SER-3409; SER-3412; SER-3426; THR-3716; SER-3836; SER-4092; THR-4100; SER-4220; THR-4430; SER-4516; SER-4684; SER-4812; SER-4960; SER-4986; SER-5077; SER-5099; SER-5110; SER-5125; SER-5332; SER-5386; SER-5400; SER-5448; SER-5552; SER-5620; SER-5731; SER-5739; SER-5752; SER-5763; SER-5780; SER-5782; SER-5790; THR-5824; SER-5830; SER-5841 AND SER-5857, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  18. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  19. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
    Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
    Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-93; SER-135; SER-177; THR-490; SER-511; SER-559; SER-5731 AND SER-5841, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  20. Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT MET-1, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiAHNK_HUMAN
AccessioniPrimary (citable) accession number: Q09666
Secondary accession number(s): A1A586
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 1, 1996
Last sequence update: November 13, 2007
Last modified: October 29, 2014
This is version 124 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3