Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q09666 (AHNK_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 118. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (6) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Neuroblast differentiation-associated protein AHNAK
Alternative name(s):
Desmoyokin
Gene names
Name:AHNAK
Synonyms:PM227
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length5890 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

May be required for neuronal cell differentiation.

Subunit structure

Interacts with DYSF; the interaction is direct and Ca2+-independent. Ref.8

Subcellular location

Nucleus.

Sequence similarities

Contains 1 PDZ (DHR) domain.

Sequence caution

The sequence AAA69899.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

Ontologies

Keywords
   Cellular componentNucleus
   Coding sequence diversityAlternative splicing
Polymorphism
   DomainRepeat
   PTMAcetylation
Phosphoprotein
   Technical term3D-structure
Complete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processprotein oligomerization

Inferred from sequence or structural similarity PubMed 21940993. Source: UniProt

regulation of RNA splicing

Inferred from sequence or structural similarity PubMed 21940993. Source: UniProt

regulation of voltage-gated calcium channel activity

Inferred from mutant phenotype PubMed 22038483. Source: UniProt

   Cellular_componentT-tubule

Non-traceable author statement Ref.8. Source: UniProt

actin cytoskeleton

Inferred from direct assay PubMed 21940993. Source: UniProt

cell-cell contact zone

Inferred from direct assay PubMed 21940993. Source: UniProt

costamere

Inferred from sequence or structural similarity PubMed 21940993. Source: UniProt

cytoplasm

Inferred from direct assay PubMed 22057634. Source: UniProt

cytosol

Inferred from sequence or structural similarity PubMed 21940993. Source: UniProt

extracellular vesicular exosome

Inferred from direct assay PubMed 19056867PubMed 19199708PubMed 22057634. Source: UniProt

lysosomal membrane

Inferred from direct assay PubMed 17897319. Source: UniProtKB

nucleus

Non-traceable author statement Ref.4. Source: UniProtKB

plasma membrane

Inferred from direct assay PubMed 21940993PubMed 22057634. Source: UniProt

sarcolemma

Inferred from direct assay PubMed 22057634. Source: UniProt

vesicle

Inferred from direct assay PubMed 21940993. Source: UniProt

   Molecular_functionS100 protein binding

Inferred from physical interaction PubMed 14699089. Source: UniProt

poly(A) RNA binding

Inferred from direct assay PubMed 22658674. Source: UniProtKB

structural molecule activity conferring elasticity

Inferred from sequence or structural similarity PubMed 21940993. Source: UniProt

Complete GO annotation...

Binary interactions

With

Entry

#Exp.

IntAct

Notes

EGFRP005333EBI-2555881,EBI-297353

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q09666-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q09666-2)

The sequence of this isoform differs from the canonical sequence as follows:
     115-149: SGDDEEYQRIYTTKIKPRLKSEDGVEGDLGETQSR → NTPQPSALECKDQNKQKEASSQAGAVSVSTPNAGL
     150-5890: Missing.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 58905890Neuroblast differentiation-associated protein AHNAK
PRO_0000064504

Regions

Domain9 – 9082PDZ
Motif4971 – 49799Nuclear localization signal Potential
Motif5019 – 50279Nuclear localization signal Potential
Motif5034 – 50396Nuclear localization signal Potential
Motif5706 – 571611Nuclear localization signal Potential
Motif5772 – 57798Nuclear localization signal Potential
Compositional bias5458 – 5654197Gly-rich

Amino acid modifications

Modified residue11N-acetylmethionine Ref.21
Modified residue411Phosphoserine Ref.6 Ref.7 Ref.11 Ref.12 Ref.18
Modified residue931Phosphoserine Ref.6 Ref.12 Ref.18 Ref.20
Modified residue1011Phosphothreonine Ref.18
Modified residue1351Phosphoserine Ref.18 Ref.20
Modified residue1771Phosphoserine Ref.18 Ref.20
Modified residue2101Phosphoserine Ref.18
Modified residue2121Phosphoserine Ref.18
Modified residue2161Phosphoserine Ref.18
Modified residue4901Phosphothreonine Ref.6 Ref.9 Ref.18 Ref.20
Modified residue5111Phosphoserine Ref.6 Ref.7 Ref.9 Ref.11 Ref.12 Ref.16 Ref.17 Ref.18 Ref.20
Modified residue5591Phosphoserine Ref.18 Ref.20
Modified residue5701Phosphoserine Ref.12 Ref.17 Ref.18
Modified residue7931Phosphoserine Ref.12 Ref.18
Modified residue10681Phosphoserine Ref.18
Modified residue11921Phosphothreonine Ref.18
Modified residue12861Phosphoserine Ref.18
Modified residue19861Phosphothreonine Ref.18
Modified residue21811Phosphothreonine Ref.18
Modified residue23091Phosphothreonine Ref.18
Modified residue23971Phosphoserine Ref.17 Ref.18
Modified residue26701Phosphoserine Ref.18
Modified residue27981Phosphoserine Ref.18
Modified residue28321Phosphothreonine Ref.18
Modified residue28451Phosphothreonine Ref.18
Modified residue30541Phosphoserine Ref.18
Modified residue34091Phosphoserine Ref.18
Modified residue34121Phosphoserine Ref.18
Modified residue34261Phosphoserine Ref.18
Modified residue37161Phosphothreonine Ref.18
Modified residue38361Phosphoserine Ref.18
Modified residue40921Phosphoserine Ref.18
Modified residue41001Phosphothreonine Ref.6 Ref.18
Modified residue42201Phosphoserine Ref.18
Modified residue44301Phosphothreonine Ref.18
Modified residue45161Phosphoserine Ref.18
Modified residue46841Phosphoserine Ref.18
Modified residue47661Phosphothreonine Ref.6
Modified residue48121Phosphoserine Ref.18
Modified residue49031Phosphoserine Ref.12
Modified residue49601Phosphoserine Ref.12 Ref.18
Modified residue49861Phosphoserine Ref.9 Ref.18
Modified residue49931Phosphoserine Ref.12
Modified residue50091Phosphothreonine Ref.12
Modified residue50771Phosphoserine Ref.6 Ref.18
Modified residue50991Phosphoserine Ref.9 Ref.12 Ref.18
Modified residue51101Phosphoserine Ref.6 Ref.9 Ref.18
Modified residue51251Phosphoserine Ref.18
Modified residue53321Phosphoserine Ref.18
Modified residue53861Phosphoserine Ref.18
Modified residue54001Phosphoserine Ref.18
Modified residue54151Phosphothreonine Ref.12
Modified residue54481Phosphoserine Ref.6 Ref.17 Ref.18
Modified residue55521Phosphoserine Ref.6 Ref.9 Ref.18
Modified residue56201Phosphoserine Ref.18
Modified residue57311Phosphoserine Ref.7 Ref.12 Ref.17 Ref.18 Ref.20
Modified residue57391Phosphoserine Ref.18
Modified residue57491Phosphoserine Ref.10 Ref.12 Ref.14 Ref.17
Modified residue57521Phosphoserine Ref.6 Ref.10 Ref.12 Ref.16 Ref.17 Ref.18
Modified residue57631Phosphoserine Ref.7 Ref.12 Ref.17 Ref.18
Modified residue57801Phosphoserine Ref.12 Ref.18
Modified residue57821Phosphoserine Ref.12 Ref.18
Modified residue57901Phosphoserine Ref.18
Modified residue57931Phosphoserine Ref.12
Modified residue57941Phosphothreonine Ref.12
Modified residue58241Phosphothreonine Ref.18
Modified residue58301Phosphoserine Ref.12 Ref.18
Modified residue58411Phosphoserine Ref.12 Ref.18 Ref.20
Modified residue58571Phosphoserine Ref.18

Natural variations

Alternative sequence115 – 14935SGDDE…ETQSR → NTPQPSALECKDQNKQKEAS SQAGAVSVSTPNAGL in isoform 2.
VSP_044233
Alternative sequence150 – 58905741Missing in isoform 2.
VSP_044234
Natural variant9621G → V.
Corresponds to variant rs664761 [ dbSNP | Ensembl ].
VAR_039058
Natural variant21141A → T.
Corresponds to variant rs1298288 [ dbSNP | Ensembl ].
VAR_039059
Natural variant22471K → T.
Corresponds to variant rs61524789 [ dbSNP | Ensembl ].
VAR_061551
Natural variant24391P → L.
Corresponds to variant rs11824660 [ dbSNP | Ensembl ].
VAR_039060
Natural variant30031Q → K.
Corresponds to variant rs566144 [ dbSNP | Ensembl ].
VAR_039061
Natural variant31901V → I.
Corresponds to variant rs11231129 [ dbSNP | Ensembl ].
VAR_039062
Natural variant37241S → P.
Corresponds to variant rs11231128 [ dbSNP | Ensembl ].
VAR_039063
Natural variant43041D → G.
Corresponds to variant rs11828907 [ dbSNP | Ensembl ].
VAR_061552
Natural variant45611G → D.
Corresponds to variant rs12795508 [ dbSNP | Ensembl ].
VAR_039064
Natural variant46111M → V.
Corresponds to variant rs12801302 [ dbSNP | Ensembl ].
VAR_039065
Natural variant46131I → V.
Corresponds to variant rs12801153 [ dbSNP | Ensembl ].
VAR_039066
Natural variant46311D → G.
Corresponds to variant rs12801123 [ dbSNP | Ensembl ].
VAR_039067
Natural variant54151T → A.
Corresponds to variant rs11231126 [ dbSNP | Ensembl ].
VAR_039068

Experimental info

Sequence conflict2881A → P in AAA69899. Ref.4
Sequence conflict3021G → A in AAA69899. Ref.4
Sequence conflict11561V → D in AAA69899. Ref.4
Sequence conflict17371P → R in AAA69899. Ref.4
Sequence conflict18211F → L in AAA69899. Ref.4
Sequence conflict46141S → T in AAA69898. Ref.4
Sequence conflict46271V → A in AAA69898. Ref.4
Sequence conflict4630 – 46312RD → KG in AAA69898. Ref.4
Sequence conflict4637 – 46382DV → NT in AAA69898. Ref.4
Sequence conflict46441Q → H in AAA69898. Ref.4
Sequence conflict48301A → P in AAA69898. Ref.4
Sequence conflict48341G → V in AAA69898. Ref.4
Sequence conflict48371F → V in AAA69898. Ref.4
Sequence conflict49841A → P in AAA69898. Ref.4
Sequence conflict54451P → S in AAA69898. Ref.4

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified November 13, 2007. Version 2.
Checksum: A82FC9645FDCA8DC

FASTA5,890629,101
        10         20         30         40         50         60 
MEKEETTREL LLPNWQGSGS HGLTIAQRDD GVFVQEVTQN SPAARTGVVK EGDQIVGATI 

        70         80         90        100        110        120 
YFDNLQSGEV TQLLNTMGHH TVGLKLHRKG DRSPEPGQTW TREVFSSCSS EVVLSGDDEE 

       130        140        150        160        170        180 
YQRIYTTKIK PRLKSEDGVE GDLGETQSRT ITVTRRVTAY TVDVTGREGA KDIDISSPEF 

       190        200        210        220        230        240 
KIKIPRHELT EISNVDVETQ SGKTVIRLPS GSGAASPTGS AVDIRAGAIS ASGPELQGAG 

       250        260        270        280        290        300 
HSKLQVTMPG IKVGGSGVNV NAKGLDLGGR GGVQVPAVDI SSSLGGRAVE VQGPSLESGD 

       310        320        330        340        350        360 
HGKIKFPTMK VPKFGVSTGR EGQTPKAGLR VSAPEVSVGH KGGKPGLTIQ APQLEVSVPS 

       370        380        390        400        410        420 
ANIEGLEGKL KGPQITGPSL EGDLGLKGAK PQGHIGVDAS APQIGGSITG PSVEVQAPDI 

       430        440        450        460        470        480 
DVQGPGSKLN VPKMKVPKFS VSGAKGEETG IDVTLPTGEV TVPGVSGDVS LPEIATGGLE 

       490        500        510        520        530        540 
GKMKGTKVKT PEMIIQKPKI SMQDVDLSLG SPKLKGDIKV SAPGVQGDVK GPQVALKGSR 

       550        560        570        580        590        600 
VDIETPNLEG TLTGPRLGSP SGKTGTCRIS MSEVDLNVAA PKVKGGVDVT LPRVEGKVKV 

       610        620        630        640        650        660 
PEVDVRGPKV DVSAPDVEAH GPEWNLKMPK MKMPTFSTPG AKGEGPDVHM TLPKGDISIS 

       670        680        690        700        710        720 
GPKVNVEAPD VNLEGLGGKL KGPDVKLPDM SVKTPKISMP DVDLHVKGTK VKGEYDVTVP 

       730        740        750        760        770        780 
KLEGELKGPK VDIDAPDVDV HGPDWHLKMP KMKMPKFSVP GFKAEGPEVD VNLPKADVDI 

       790        800        810        820        830        840 
SGPKIDVTAP DVSIEEPEGK LKGPKFKMPE MNIKVPKISM PDVDLHLKGP NVKGEYDVTM 

       850        860        870        880        890        900 
PKVESEIKVP DVELKSAKMD IDVPDVEVQG PDWHLKMPKM KMPKFSMPGF KAEGPEVDVN 

       910        920        930        940        950        960 
LPKADVDISG PKVGVEVPDV NIEGPEGKLK GPKFKMPEMN IKAPKISMPD VDLHMKGPKV 

       970        980        990       1000       1010       1020 
KGEYDMTVPK LEGDLKGPKV DVSAPDVEMQ GPDWNLKMPK IKMPKFSMPS LKGEGPEFDV 

      1030       1040       1050       1060       1070       1080 
NLSKANVDIS APKVDTNAPD LSLEGPEGKL KGPKFKMPEM HFRAPKMSLP DVDLDLKGPK 

      1090       1100       1110       1120       1130       1140 
MKGNVDISAP KIEGEMQVPD VDIRGPKVDI KAPDVEGQGL DWSLKIPKMK MPKFSMPSLK 

      1150       1160       1170       1180       1190       1200 
GEGPEVDVNL PKADVVVSGP KVDIEAPDVS LEGPEGKLKG PKFKMPEMHF KTPKISMPDV 

      1210       1220       1230       1240       1250       1260 
DLHLKGPKVK GDVDVSVPKV EGEMKVPDVE IKGPKMDIDA PDVEVQGPDW HLKMPKMKMP 

      1270       1280       1290       1300       1310       1320 
KFSMPGFKGE GREVDVNLPK ADIDVSGPKV DVEVPDVSLE GPEGKLKGPK FKMPEMHFKA 

      1330       1340       1350       1360       1370       1380 
PKISMPDVDL NLKGPKLKGD VDVSLPEVEG EMKVPDVDIK GPKVDISAPD VDVHGPDWHL 

      1390       1400       1410       1420       1430       1440 
KMPKVKMPKF SMPGFKGEGP EVDVKLPKAD VDVSGPKMDA EVPDVNIEGP DAKLKGPKFK 

      1450       1460       1470       1480       1490       1500 
MPEMSIKPQK ISIPDVGLHL KGPKMKGDYD VTVPKVEGEI KAPDVDIKGP KVDINAPDVE 

      1510       1520       1530       1540       1550       1560 
VHGPDWHLKM PKVKMPKFSM PGFKGEGPEV DMNLPKADLG VSGPKVDIDV PDVNLEAPEG 

      1570       1580       1590       1600       1610       1620 
KLKGPKFKMP SMNIQTHKIS MPDVGLNLKA PKLKTDVDVS LPKVEGDLKG PEIDVKAPKM 

      1630       1640       1650       1660       1670       1680 
DVNVGDIDIE GPEGKLKGPK FKMPEMHFKA PKISMPDVDL HLKGPKVKGD MDVSVPKVEG 

      1690       1700       1710       1720       1730       1740 
EMKVPDVDIK GPKVDIDAPD VEVHDPDWHL KMPKMKMPKF SMPGFKAEGP EVDVNLPKAD 

      1750       1760       1770       1780       1790       1800 
IDVSGPSVDT DAPDLDIEGP EGKLKGSKFK MPKLNIKAPK VSMPDVDLNL KGPKLKGEID 

      1810       1820       1830       1840       1850       1860 
ASVPELEGDL RGPQVDVKGP FVEAEVPDVD LECPDAKLKG PKFKMPEMHF KAPKISMPDV 

      1870       1880       1890       1900       1910       1920 
DLHLKGPKVK GDADVSVPKL EGDLTGPSVG VEVPDVELEC PDAKLKGPKF KMPDMHFKAP 

      1930       1940       1950       1960       1970       1980 
KISMPDVDLH LKGPKVKGDV DVSVPKLEGD LTGPSVGVEV PDVELECPDA KLKGPKFKMP 

      1990       2000       2010       2020       2030       2040 
EMHFKTPKIS MPDVDLHLKG PKVKGDMDVS VPKVEGEMKV PDVDIKGPKM DIDAPDVDVH 

      2050       2060       2070       2080       2090       2100 
GPDWHLKMPK MKMPKFSMPG FKAEGPEVDV NLPKADVVVS GPKVDVEVPD VSLEGPEGKL 

      2110       2120       2130       2140       2150       2160 
KGPKLKMPEM HFKAPKISMP DVDLHLKGPK VKGDVDVSLP KLEGDLTGPS VDVEVPDVEL 

      2170       2180       2190       2200       2210       2220 
ECPDAKLKGP KFKMPEMHFK TPKISMPDVN LNLKGPKVKG DMDVSVPKVE GEMKVPDVDI 

      2230       2240       2250       2260       2270       2280 
RGPKVDIDAP DVDVHGPDWH LKMPKMKMPK FSMPGFKGEG PEVDVNLPKA DVDVSGPKVD 

      2290       2300       2310       2320       2330       2340 
VEVPDVSLEG PEGKLKGPKF KMPEMHFKTP KISMPDVDFN LKGPKIKGDV DVSAPKLEGE 

      2350       2360       2370       2380       2390       2400 
LKGPELDVKG PKLDADMPEV AVEGPNGKWK TPKFKMPDMH FKAPKISMPD LDLHLKSPKA 

      2410       2420       2430       2440       2450       2460 
KGEVDVDVPK LEGDLKGPHV DVSGPDIDIE GPEGKLKGPK FKMPDMHFKA PNISMPDVDL 

      2470       2480       2490       2500       2510       2520 
NLKGPKIKGD VDVSVPEVEG KLEVPDMNIR GPKVDVNAPD VQAPDWHLKM PKMKMPKFSM 

      2530       2540       2550       2560       2570       2580 
PGFKAEGPEV DVNLPKADVD ISGPKVDIEG PDVNIEGPEG KLKGPKLKMP EMNIKAPKIS 

      2590       2600       2610       2620       2630       2640 
MPDFDLHLKG PKVKGDVDVS LPKVEGDLKG PEVDIKGPKV DINAPDVGVQ GPDWHLKMPK 

      2650       2660       2670       2680       2690       2700 
VKMPKFSMPG FKGEGPDGDV KLPKADIDVS GPKVDIEGPD VNIEGPEGKL KGPKFKMPEM 

      2710       2720       2730       2740       2750       2760 
NIKAPKISMP DIDLNLKGPK VKGDVDVSLP KVEGDLKGPE VDIKGPKVDI DAPDVDVHGP 

      2770       2780       2790       2800       2810       2820 
DWHLKMPKIK MPKISMPGFK GEGPDVDVNL PKADIDVSGP KVDVECPDVN IEGPEGKWKS 

      2830       2840       2850       2860       2870       2880 
PKFKMPEMHF KTPKISMPDI DLNLTGPKIK GDVDVTGPKV EGDLKGPEVD LKGPKVDIDV 

      2890       2900       2910       2920       2930       2940 
PDVNVQGPDW HLKMPKMKMP KFSMPGFKAE GPEVDVNLPK ADVDVSGPKV DVEGPDVNIE 

      2950       2960       2970       2980       2990       3000 
GPEGKLKGPK FKMPEMNIKA PKIPMPDFDL HLKGPKVKGD VDISLPKVEG DLKGPEVDIR 

      3010       3020       3030       3040       3050       3060 
GPQVDIDVPD VGVQGPDWHL KMPKVKMPKF SMPGFKGEGP DVDVNLPKAD LDVSGPKVDI 

      3070       3080       3090       3100       3110       3120 
DVPDVNIEGP EGKLKGPKFK MPEMNIKAPK ISMPDIDLNL KGPKVKGDMD VSLPKVEGDM 

      3130       3140       3150       3160       3170       3180 
KVPDVDIKGP KVDINAPDVD VQGPDWHLKM PKIKMPKISM PGFKGEGPEV DVNLPKADLD 

      3190       3200       3210       3220       3230       3240 
VSGPKVDVDV PDVNIEGPDA KLKGPKFKMP EMNIKAPKIS MPDLDLNLKG PKMKGEVDVS 

      3250       3260       3270       3280       3290       3300 
LANVEGDLKG PALDIKGPKI DVDAPDIDIH GPDAKLKGPK LKMPDMHVNM PKISMPEIDL 

      3310       3320       3330       3340       3350       3360 
NLKGSKLKGD VDVSGPKLEG DIKAPSLDIK GPEVDVSGPK LNIEGKSKKS RFKLPKFNFS 

      3370       3380       3390       3400       3410       3420 
GSKVQTPEVD VKGKKPDIDI TGPKVDINAP DVEVQGKVKG SKFKMPFLSI SSPKVSMPDV 

      3430       3440       3450       3460       3470       3480 
ELNLKSPKVK GDLDIAGPNL EGDFKGPKVD IKAPEVNLNA PDVDVHGPDW NLKMPKMKMP 

      3490       3500       3510       3520       3530       3540 
KFSVSGLKAE GPDVAVDLPK GDINIEGPSM NIEGPDLNVE GPEGGLKGPK FKMPDMNIKA 

      3550       3560       3570       3580       3590       3600 
PKISMPDIDL NLKGPKVKGD VDISLPKLEG DLKGPEVDIK GPKVDINAPD VDVHGPDWHL 

      3610       3620       3630       3640       3650       3660 
KMPKVKMPKF SMPGFKGEGP EVDVTLPKAD IDISGPNVDV DVPDVNIEGP DAKLKGPKFK 

      3670       3680       3690       3700       3710       3720 
MPEMNIKAPK ISMPDFDLNL KGPKMKGDVV VSLPKVEGDL KGPEVDIKGP KVDIDTPDIN 

      3730       3740       3750       3760       3770       3780 
IEGSEGKFKG PKFKIPEMHL KAPKISMPDI DLNLKGPKVK GDVDVSLPKM EGDLKGPEVD 

      3790       3800       3810       3820       3830       3840 
IKGPKVDINA PDVDVQGPDW HLKMPKVKMP KFSMPGFKGE GPDVDVNLPK ADLDVSGPKV 

      3850       3860       3870       3880       3890       3900 
DIDVPDVNIE GPEGKLKGPK FKMPEMNIKA PKISMPDIDL NLKGPKVKGD MDVSLPKVEG 

      3910       3920       3930       3940       3950       3960 
DMQVPDLDIK GPKVDINAPD VDVRGPDWHL KMPKIKMPKI SMPGFKGEGP EVDVNLPKAD 

      3970       3980       3990       4000       4010       4020 
LDVSGPKVDV DVPDVNIEGP DAKLKGPKFK MPEMNIKAPK ISMPDFDLHL KGPKVKGDVD 

      4030       4040       4050       4060       4070       4080 
VSLPKMEGDL KAPEVDIKGP KVDIDAPDVD VHGPDWHLKM PKVKMPKFSM PGFKGEGPEV 

      4090       4100       4110       4120       4130       4140 
DVNLPKADID VSGPKVDIDT PDIDIHGPEG KLKGPKFKMP DLHLKAPKIS MPEVDLNLKG 

      4150       4160       4170       4180       4190       4200 
PKMKGDVDVS LPKVEGDLKG PEVDIKGPKV DIDVPDVDVQ GPDWHLKMPK VKMPKFSMPG 

      4210       4220       4230       4240       4250       4260 
FKGEGPDVDV NLPKADLDVS GPKVDIDVPD VNIEGPDAKL KGPKFKMPEM NIKAPKISMP 

      4270       4280       4290       4300       4310       4320 
DFDLHLKGPK VKGDVDVSLP KVEGDLKGPE VDIKGPKVDI DAPDVDVHGP DWHLKMPKVK 

      4330       4340       4350       4360       4370       4380 
MPKFSMPGFK GEGPDVDVTL PKADIEISGP KVDIDAPDVS IEGPDAKLKG PKFKMPEMNI 

      4390       4400       4410       4420       4430       4440 
KAPKISMPDI DFNLKGPKVK GDVDVSLPKV EGDLKGPEID IKGPSLDIDT PDVNIEGPEG 

      4450       4460       4470       4480       4490       4500 
KLKGPKFKMP EMNIKAPKIS MPDFDLHLKG PKVKGDVDVS LPKVESDLKG PEVDIEGPEG 

      4510       4520       4530       4540       4550       4560 
KLKGPKFKMP DVHFKSPQIS MSDIDLNLKG PKIKGDMDIS VPKLEGDLKG PKVDVKGPKV 

      4570       4580       4590       4600       4610       4620 
GIDTPDIDIH GPEGKLKGPK FKMPDLHLKA PKISMPEVDL NLKGPKVKGD MDISLPKVEG 

      4630       4640       4650       4660       4670       4680 
DLKGPEVDIR DPKVDIDVPD VDVQGPDWHL KMPKVKMPKF SMPGFKGEGP DVDVNLPKAD 

      4690       4700       4710       4720       4730       4740 
IDVSGPKVDV DVPDVNIEGP DAKLKGPKFK MPEMSIKAPK ISMPDIDLNL KGPKVKGDVD 

      4750       4760       4770       4780       4790       4800 
VTLPKVEGDL KGPEADIKGP KVDINTPDVD VHGPDWHLKM PKVKMPKFSM PGFKGEGPDV 

      4810       4820       4830       4840       4850       4860 
DVSLPKADID VSGPKVDVDI PDVNIEGPDA KLKGPKFKMP EINIKAPKIS IPDVDLDLKG 

      4870       4880       4890       4900       4910       4920 
PKVKGDFDVS VPKVEGTLKG PEVDLKGPRL DFEGPDAKLS GPSLKMPSLE ISAPKVTAPD 

      4930       4940       4950       4960       4970       4980 
VDLHLKAPKI GFSGPKLEGG EVDLKGPKVE APSLDVHMDS PDINIEGPDV KIPKFKKPKF 

      4990       5000       5010       5020       5030       5040 
GFGAKSPKAD IKSPSLDVTV PEAELNLETP EISVGGKGKK SKFKMPKIHM SGPKIKAKKQ 

      5050       5060       5070       5080       5090       5100 
GFDLNVPGGE IDASLKAPDV DVNIAGPDAA LKVDVKSPKT KKTMFGKMYF PDVEFDIKSP 

      5110       5120       5130       5140       5150       5160 
KFKAEAPLPS PKLEGELQAP DLELSLPAIH VEGLDIKAKA PKVKMPDVDI SVPKIEGDLK 

      5170       5180       5190       5200       5210       5220 
GPKVQANLGA PDINIEGLDA KVKTPSFGIS APQVSIPDVN VNLKGPKIKG DVPSVGLEGP 

      5230       5240       5250       5260       5270       5280 
DVDLQGPEAK IKFPKFSMPK IGIPGVKMEG GGAEVHAQLP SLEGDLRGPD VKLEGPDVSL 

      5290       5300       5310       5320       5330       5340 
KGPGVDLPSV NLSMPKVSGP DLDLNLKGPS LKGDLDASVP SMKVHAPGLN LSGVGGKMQV 

      5350       5360       5370       5380       5390       5400 
GGDGVKVPGI DATTKLNVGA PDVTLRGPSL QGDLAVSGDI KCPKVSVGAP DLSLEASEGS 

      5410       5420       5430       5440       5450       5460 
IKLPKMKLPQ FGISTPGSDL HVNAKGPQVS GELKGPGVDV NLKGPRISAP NVDFNLEGPK 

      5470       5480       5490       5500       5510       5520 
VKGSLGATGE IKGPTVGGGL PGIGVQGLEG NLQMPGIKSS GCDVNLPGVN VKLPTGQISG 

      5530       5540       5550       5560       5570       5580 
PEIKGGLKGS EVGFHGAAPD ISVKGPAFNM ASPESDFGIN LKGPKIKGGA DVSGGVSAPD 

      5590       5600       5610       5620       5630       5640 
ISLGEGHLSV KGSGGEWKGP QVSSALNLDT SKFAGGLHFS GPKVEGGVKG GQIGLQAPGL 

      5650       5660       5670       5680       5690       5700 
SVSGPQGHLE SGSGKVTFPK MKIPKFTFSG RELVGREMGV DVHFPKAEAS IQAGAGDGEW 

      5710       5720       5730       5740       5750       5760 
EESEVKLKKS KIKMPKFNFS KPKGKGGVTG SPEASISGSK GDLKSSKASL GSLEGEAEAE 

      5770       5780       5790       5800       5810       5820 
ASSPKGKFSL FKSKKPRHRS NSFSDEREFS GPSTPTGTLE FEGGEVSLEG GKVKGKHGKL 

      5830       5840       5850       5860       5870       5880 
KFGTFGGLGS KSKGHYEVTG SDDETGKLQG SGVSLASKKS RLSSSSSNDS GNKVGIQLPE 

      5890 
VELSVSTKKE 

« Hide

Isoform 2 [UniParc].

Checksum: 4CB0471C1B60F60D
Show »

FASTA14916,061

References

« Hide 'large scale' references
[1]"Human chromosome 11 DNA sequence and analysis including novel gene identification."
Taylor T.D., Noguchi H., Totoki Y., Toyoda A., Kuroki Y., Dewar K., Lloyd C., Itoh T., Takeda T., Kim D.-W., She X., Barlow K.F., Bloom T., Bruford E., Chang J.L., Cuomo C.A., Eichler E., FitzGerald M.G. expand/collapse author list , Jaffe D.B., LaButti K., Nicol R., Park H.-S., Seaman C., Sougnez C., Yang X., Zimmer A.R., Zody M.C., Birren B.W., Nusbaum C., Fujiyama A., Hattori M., Rogers J., Lander E.S., Sakaki Y.
Nature 440:497-500(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[2]Mural R.J., Istrail S., Sutton G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[3]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
[4]"A human gene (AHNAK) encoding an unusually large protein with a 1.2-microns polyionic rod structure."
Shtivelman E., Cohen F.E., Bishop J.M.
Proc. Natl. Acad. Sci. U.S.A. 89:5472-5476(1992) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 114-1930 (ISOFORM 1), NUCLEOTIDE SEQUENCE [MRNA] OF 4614-5890 (ISOFORM 1).
Tissue: Placenta.
[5]Erratum
Shtivelman E., Cohen F.E., Bishop J.M.
Proc. Natl. Acad. Sci. U.S.A. 90:4328-4328(1993)
[6]"Global, in vivo, and site-specific phosphorylation dynamics in signaling networks."
Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M.
Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-41; SER-93; THR-490; SER-511; THR-4100; THR-4766; SER-5077; SER-5110; SER-5448; SER-5552 AND SER-5752, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[7]"A probability-based approach for high-throughput protein phosphorylation analysis and site localization."
Beausoleil S.A., Villen J., Gerber S.A., Rush J., Gygi S.P.
Nat. Biotechnol. 24:1285-1292(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-41; SER-511; SER-5731 AND SER-5763, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[8]"AHNAK, a novel component of the dysferlin protein complex, redistributes to the cytoplasm with dysferlin during skeletal muscle regeneration."
Huang Y., Laval S.H., van Remoortere A., Baudier J., Benaud C., Anderson L.V., Straub V., Deelder A., Frants R.R., den Dunnen J.T., Bushby K., van der Maarel S.M.
FASEB J. 21:732-742(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: INTERACTION WITH DYSF.
[9]"Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra."
Yu L.R., Zhu Z., Chan K.C., Issaq H.J., Dimitrov D.S., Veenstra T.D.
J. Proteome Res. 6:4150-4162(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-490; SER-511; SER-4986; SER-5099; SER-5110 AND SER-5552, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[10]"Phosphorylation analysis of primary human T lymphocytes using sequential IMAC and titanium oxide enrichment."
Carrascal M., Ovelleiro D., Casas V., Gay M., Abian J.
J. Proteome Res. 7:5167-5176(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-5749 AND SER-5752, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: T-cell.
[11]"Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle."
Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M.
Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-41 AND SER-511, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[12]"A quantitative atlas of mitotic phosphorylation."
Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P.
Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-41; SER-93; SER-511; SER-570; SER-793; SER-4903; SER-4960; SER-4993; THR-5009; SER-5099; THR-5415; SER-5731; SER-5749; SER-5752; SER-5763; SER-5780; SER-5782; SER-5793; THR-5794; SER-5830 AND SER-5841, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[13]"Large-scale phosphoproteome analysis of human liver tissue by enrichment and fractionation of phosphopeptides with strong anion exchange chromatography."
Han G., Ye M., Zhou H., Jiang X., Feng S., Jiang X., Tian R., Wan D., Zou H., Gu J.
Proteomics 8:1346-1361(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Liver.
[14]Carrascal M., Abian J.
Submitted (JAN-2008) to UniProtKB
Cited for: PHOSPHORYLATION AT SER-5749, IDENTIFICATION BY MASS SPECTROMETRY.
[15]"Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
[16]"Large-scale proteomics analysis of the human kinome."
Oppermann F.S., Gnad F., Olsen J.V., Hornberger R., Greff Z., Keri G., Mann M., Daub H.
Mol. Cell. Proteomics 8:1751-1764(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-511 AND SER-5752, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
[17]"Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-511; SER-570; SER-2397; SER-5448; SER-5731; SER-5749; SER-5752 AND SER-5763, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Leukemic T-cell.
[18]"Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-41; SER-93; THR-101; SER-135; SER-177; SER-210; SER-212; SER-216; THR-490; SER-511; SER-559; SER-570; SER-793; SER-1068; THR-1192; SER-1286; THR-1986; THR-2181; THR-2309; SER-2397; SER-2670; SER-2798; THR-2832; THR-2845; SER-3054; SER-3409; SER-3412; SER-3426; THR-3716; SER-3836; SER-4092; THR-4100; SER-4220; THR-4430; SER-4516; SER-4684; SER-4812; SER-4960; SER-4986; SER-5077; SER-5099; SER-5110; SER-5125; SER-5332; SER-5386; SER-5400; SER-5448; SER-5552; SER-5620; SER-5731; SER-5739; SER-5752; SER-5763; SER-5780; SER-5782; SER-5790; THR-5824; SER-5830; SER-5841 AND SER-5857, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[19]"Initial characterization of the human central proteome."
Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.
BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
[20]"System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-93; SER-135; SER-177; THR-490; SER-511; SER-559; SER-5731 AND SER-5841, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
[21]"N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB."
Van Damme P., Lasa M., Polevoda B., Gazquez C., Elosegui-Artola A., Kim D.S., De Juan-Pardo E., Demeyer K., Hole K., Larrea E., Timmerman E., Prieto J., Arnesen T., Sherman F., Gevaert K., Aldabe R.
Proc. Natl. Acad. Sci. U.S.A. 109:12449-12454(2012) [PubMed] [Europe PMC] [Abstract]
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT MET-1, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AP001363 Genomic DNA. No translation available.
AP003064 Genomic DNA. No translation available.
CH471076 Genomic DNA. Translation: EAW74019.1.
BC128460 mRNA. Translation: AAI28461.1.
M80899 mRNA. Translation: AAA69898.1.
M80902 mRNA. Translation: AAA69899.1. Different initiation.
PIRA45259.
RefSeqNP_001611.1. NM_001620.2.
NP_076965.2. NM_024060.3.
XP_005274297.1. XM_005274240.1.
XP_005274298.1. XM_005274241.1.
UniGeneHs.502756.

3D structure databases

PDBe
RCSB PDB
PDBj
EntryMethodResolution (Å)ChainPositionsPDBsum
4DRWX-ray3.50E/F5654-5673[»]
4FTGX-ray2.51E5654-5673[»]
4HRGX-ray2.00C/D5655-5668[»]
ProteinModelPortalQ09666.
SMRQ09666. Positions 7-91.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid122494. 25 interactions.
IntActQ09666. 23 interactions.
MINTMINT-4998803.
STRING9606.ENSP00000367263.

Protein family/group databases

TCDB1.A.31.1.4. the annexin (annexin) family.

PTM databases

PhosphoSiteQ09666.

Polymorphism databases

DMDM160332335.

Proteomic databases

PaxDbQ09666.
PeptideAtlasQ09666.
PRIDEQ09666.

Protocols and materials databases

DNASU79026.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000257247; ENSP00000257247; ENSG00000124942. [Q09666-2]
ENST00000378024; ENSP00000367263; ENSG00000124942. [Q09666-1]
GeneID79026.
KEGGhsa:79026.
UCSCuc001ntk.2. human. [Q09666-2]
uc001ntl.3. human. [Q09666-1]

Organism-specific databases

CTD79026.
GeneCardsGC11M062202.
H-InvDBHIX0171266.
HIX0171345.
HGNCHGNC:347. AHNAK.
HPAHPA019010.
HPA019070.
HPA026643.
MIM103390. gene.
neXtProtNX_Q09666.
PharmGKBPA24640.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG12793.
HOGENOMHOG000033865.
HOVERGENHBG104864.
InParanoidQ09666.
OMAHLKGPKL.
OrthoDBEOG7BCNB3.
PhylomeDBQ09666.
TreeFamTF350595.

Gene expression databases

ArrayExpressQ09666.
BgeeQ09666.
CleanExHS_AHNAK.
GenevestigatorQ09666.

Family and domain databases

Gene3D2.30.42.10. 1 hit.
InterProIPR001478. PDZ.
[Graphical view]
SMARTSM00228. PDZ. 1 hit.
[Graphical view]
SUPFAMSSF50156. SSF50156. 1 hit.
PROSITEPS50106. PDZ. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSAHNAK. human.
GeneWikiAHNAK.
GenomeRNAi79026.
NextBio67715.
PROQ09666.
SOURCESearch...

Entry information

Entry nameAHNK_HUMAN
AccessionPrimary (citable) accession number: Q09666
Secondary accession number(s): A1A586
Entry history
Integrated into UniProtKB/Swiss-Prot: February 1, 1996
Last sequence update: November 13, 2007
Last modified: April 16, 2014
This is version 118 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

PDB cross-references

Index of Protein Data Bank (PDB) cross-references

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 11

Human chromosome 11: entries, gene names and cross-references to MIM