Reviewed,
UniProtKB/Swiss-Prot Q09315 (5NT3_CAEEL)
Last modified
June 16, 2009.
Version 49.
History...
Clusters with 100%,
90%,
50% identity |
Documents (2) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Putative cytosolic 5'-nucleotidase 3 EC=3.1.3.5 Alternative name(s): Putative pyrimidine 5'-nucleotidase | ||
| Gene names |
| ||
| Organism | Caenorhabditis elegans [Complete proteome] | ||
| Taxonomic identifier | 6239 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Nematoda › Chromadorea › Rhabditida › Rhabditoidea › Rhabditidae › Peloderinae › Caenorhabditis |
Protein attributes
| Sequence length | 376 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at transcript level. |
General annotation (Comments)
| Catalytic activity | A 5'-ribonucleotide + H2O = a ribonucleoside + phosphate. |
| Subcellular location | Cytoplasm Potential. |
| Sequence similarities | Belongs to the pyrimidine 5'-nucleotidase family. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Nucleotide metabolism |
| Cellular component | Cytoplasm |
| Coding sequence diversity | Alternative splicing |
| Ligand | Magnesium Metal-binding Nucleotide-binding |
| Molecular function | Hydrolase |
| Technical term | Complete proteome |
| Gene Ontology (GO) | |
| Biological process | nucleotide metabolic process Inferred from electronic annotation. Source: UniProtKB-KW |
| Cellular component | cytoplasm Inferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular function | 5'-nucleotidase activity Inferred from electronic annotation. Source: EC magnesium ion bindingInferred from electronic annotation. Source: UniProtKB-KW nucleotide bindingInferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] Note: Experimental confirmation may be lacking for some isoforms. | ||||||
| Isoform b (identifier: Q09315-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform a (identifier: Q09315-2) The sequence of this isoform differs from the canonical sequence as follows: 1-30: MSNKVARRLGKCLFVSGRRFESRQSILQLR → MGHCFSVFSSKETINC | ||||||
| Isoform c (identifier: Q09315-3) The sequence of this isoform differs from the canonical sequence as follows: 1-49: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 376 | 376 | Putative cytosolic 5'-nucleotidase 3 | PRO_0000065315 | |||||
Regions | |||||||||
| Region | 236 – 237 | 2 | Substrate binding By similarity | ||||||
Sites | |||||||||
| Active site | 119 | 1 | Nucleophile By similarity | ||||||
| Active site | 121 | 1 | Proton donor By similarity | ||||||
| Metal binding | 119 | 1 | Magnesium By similarity | ||||||
| Metal binding | 121 | 1 | Magnesium; via carbonyl oxygen By similarity | ||||||
| Metal binding | 312 | 1 | Magnesium By similarity | ||||||
| Binding site | 286 | 1 | Substrate By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 49 | 49 | Missing in isoform c. | VSP_002446 | |||||
| Alternative sequence | 1 – 30 | 30 | MSNKV…ILQLR → MGHCFSVFSSKETINC in isoform a. | VSP_002447 | |||||
Sequences
| ||||||||||||||||||||||||||||||
References
| [1] | "Genome sequence of the nematode C. elegans: a platform for investigating biology." The C. elegans sequencing consortium Science 282:2012-2018(1998) [PubMed: 9851916] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], ALTERNATIVE SPLICING. Strain: Bristol N2. |
Cross-references
Sequence databases | |
|---|---|
| U23172 Genomic DNA. Translation: AAK67227.1. U23172 Genomic DNA. Translation: AAK67228.1. U23172 Genomic DNA. Translation: AAL27245.1. | |
| RefSeq | NP_498293.1. |
| UniGene | Cel.17714 |
3D structure databases | |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q09315. 1 interaction. |
Genome annotation databases | |
| Ensembl | F25B5.3. Caenorhabditis elegans. [Contig view] |
| GeneID | 175843. |
| KEGG | cel:F25B5.3. |
Organism-specific databases | |
| WormBase | WBGene00017775. F25B5.3. |
| WormPep | F25B5.3a. CE26890. [WorfDB] F25B5.3b. CE28001. [WorfDB] F25B5.3c. CE29776. [WorfDB] |
Phylogenomic databases | |
| OMA | Q09315. EKIPHME. |
Enzyme and pathway databases | |
| BRENDA | 3.1.3.5. 672. |
Gene expression databases | |
| ArrayExpress | Q09315. |
Family and domain databases | |
| InterPro | IPR006434. HAD-SF_hydro_IE. IPR018012. HAD-SF_hydro_IE_pln. [Graphical view] |
| PANTHER | PTHR13045. HAD-SF_hydro_IE. 1 hit. |
| Pfam | PF05822. UMPH-1. 1 hit. [Graphical view] |
| TIGRFAMs | TIGR01544. HAD-SF-IE. 1 hit. |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 889908. |
Entry information
| Entry name | 5NT3_CAEEL | ||||||||
| Accession | Primary (citable) accession number: Q09315 Secondary accession number(s): Q95QJ1 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | Caenorhabditis annotation project | ||||||||
Relevant documents
| Caenorhabditis elegans Caenorhabditis elegans: entries, gene names and cross-references to WormPep |
| SIMILARITY comments Index of protein domains and families |

Clusters with


